Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Type-1 angiotensin II receptor-associated protein (AT1 receptor-associated protein)

 ATRAP_HUMAN             Reviewed;         159 AA.
Q6RW13; A8MVQ5; Q5SNV4; Q5SNV5; Q96AC0; Q96PL4; Q9NRW9;
19-JUL-2005, integrated into UniProtKB/Swiss-Prot.
05-JUL-2004, sequence version 1.
18-JUL-2018, entry version 130.
RecName: Full=Type-1 angiotensin II receptor-associated protein;
AltName: Full=AT1 receptor-associated protein;
Name=AGTRAP; Synonyms=ATRAP;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, AND
INTERACTION WITH RACK1 AND AGTR1.
TISSUE=Fetal brain;
PubMed=11733189; DOI=10.1016/S1357-2725(01)00094-2;
Wang W., Huang Y., Zhou Z., Tang R., Zhao W., Zeng L., Xu M.,
Cheng C., Gu S., Ying K., Xie Y., Mao Y.;
"Identification and characterization of AGTRAP, a human homolog of
murine angiotensin II receptor-associated protein (Agtrap).";
Int. J. Biochem. Cell Biol. 34:93-102(2002).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Kidney;
Ye R.D., He R.;
Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
TISSUE=Pancreas islet cell;
Melton D., Brown J., Kenty G., Permutt A., Lee C., Kaestner K.,
Lemishka I., Scearce M., Brestelli J., Gradwohl G., Clifton S.,
Hillier L., Marra M., Pape D., Wylie T., Martin J., Blistain A.,
Schmitt A., Theising B., Ritter E., Ronko I., Bennett J., Cardenas M.,
Gibbons M., McCann R., Cole R., Tsagareishvili R., Williams T.,
Jackson Y., Bowers Y.;
Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANT VAL-143.
SeattleSNPs variation discovery resource;
Submitted (NOV-2003) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 5).
TISSUE=Colon, and Eye;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
FUNCTION, SUBCELLULAR LOCATION, AND INTERACTION WITH AGTR1.
PubMed=12960423; DOI=10.1091/mbc.E03-06-0383;
Lopez-Ilasaca M., Liu X., Tamura K., Dzau V.J.;
"The angiotensin II type I receptor-associated protein, ATRAP, is a
transmembrane protein and a modulator of angiotensin II signaling.";
Mol. Biol. Cell 14:5038-5050(2003).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[10]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-126; SER-127; THR-135;
SER-138 AND SER-153, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE
SCALE ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[11]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25944712; DOI=10.1002/pmic.201400617;
Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M.,
Ayoub D., Lane L., Bairoch A., Van Dorsselaer A., Carapito C.;
"N-terminome analysis of the human mitochondrial proteome.";
Proteomics 15:2519-2524(2015).
-!- FUNCTION: Appears to be a negative regulator of type-1 angiotensin
II receptor-mediated signaling by regulating receptor
internalisation as well as mechanism of receptor desensitization
such as phosphorylation. Induces also a decrease in cell
proliferation and angiotensin II-stimulated transcriptional
activity. {ECO:0000269|PubMed:12960423}.
-!- SUBUNIT: Interacts with RACK1, and with the C-terminal region of
AGTR1. {ECO:0000269|PubMed:11733189, ECO:0000269|PubMed:12960423}.
-!- INTERACTION:
Q96CM8:ACSF2; NbExp=3; IntAct=EBI-741181, EBI-2876502;
P54886:ALDH18A1; NbExp=3; IntAct=EBI-741181, EBI-1210304;
Q9Y2T2:AP3M1; NbExp=3; IntAct=EBI-741181, EBI-2371151;
Q96II5:ARAF; NbExp=3; IntAct=EBI-741181, EBI-9383168;
P53365:ARFIP2; NbExp=4; IntAct=EBI-741181, EBI-638194;
P18496:ATP10 (xeno); NbExp=3; IntAct=EBI-11522760, EBI-3323;
P32453:ATP11 (xeno); NbExp=3; IntAct=EBI-11522760, EBI-3306;
Q96DR5:BPIFA2; NbExp=3; IntAct=EBI-741181, EBI-10284754;
Q86UA3:C12orf10; NbExp=3; IntAct=EBI-741181, EBI-10258793;
P04632:CAPNS1; NbExp=3; IntAct=EBI-741181, EBI-711828;
P00431:CCP1 (xeno); NbExp=3; IntAct=EBI-11522760, EBI-4389;
O95971:CD160; NbExp=3; IntAct=EBI-741181, EBI-4314390;
P04819:CDC9 (xeno); NbExp=3; IntAct=EBI-11522760, EBI-5991;
P49017:COQ5 (xeno); NbExp=3; IntAct=EBI-11522760, EBI-4937;
Q8NI60:COQ8A; NbExp=5; IntAct=EBI-11522760, EBI-745535;
Q9UGL9:CRCT1; NbExp=3; IntAct=EBI-741181, EBI-713677;
Q9BW61:DDA1; NbExp=3; IntAct=EBI-741181, EBI-2510241;
Q8NHQ9:DDX55; NbExp=3; IntAct=EBI-741181, EBI-5459844;
Q9NR28:DIABLO; NbExp=5; IntAct=EBI-11522760, EBI-517508;
Q5VYK3:ECPAS; NbExp=3; IntAct=EBI-741181, EBI-521451;
Q8IWE2:FAM114A1; NbExp=3; IntAct=EBI-741181, EBI-2686288;
Q8N612:FAM160A2; NbExp=3; IntAct=EBI-741181, EBI-742137;
O95363:FARS2; NbExp=3; IntAct=EBI-741181, EBI-2513774;
Q14CZ7:FASTKD3; NbExp=3; IntAct=EBI-741181, EBI-10234819;
Q969F0:FATE1; NbExp=3; IntAct=EBI-741181, EBI-743099;
A0A0S2Z3E9:FGA; NbExp=3; IntAct=EBI-11522760, EBI-16439102;
P60520:GABARAPL2; NbExp=3; IntAct=EBI-741181, EBI-720116;
A0A0S2Z4D9:GAD1; NbExp=3; IntAct=EBI-11522760, EBI-16430771;
Q8IVA8:GAD1; NbExp=3; IntAct=EBI-741181, EBI-10209663;
Q99259:GAD1; NbExp=5; IntAct=EBI-11522760, EBI-743184;
Q05329:GAD2; NbExp=3; IntAct=EBI-741181, EBI-9304251;
P39905:GDNF; NbExp=3; IntAct=EBI-741181, EBI-10207709;
Q12789:GTF3C1; NbExp=3; IntAct=EBI-741181, EBI-357956;
P49590:HARS2; NbExp=3; IntAct=EBI-741181, EBI-3909030;
Q99525:HIST1H4G; NbExp=3; IntAct=EBI-741181, EBI-10294329;
P09429:HMGB1; NbExp=3; IntAct=EBI-741181, EBI-389432;
Q8IWL3:HSCB; NbExp=3; IntAct=EBI-741181, EBI-1805738;
P34932:HSPA4; NbExp=3; IntAct=EBI-741181, EBI-356933;
Q9H1K1:ISCU; NbExp=3; IntAct=EBI-741181, EBI-1047335;
P25791:LMO2; NbExp=3; IntAct=EBI-741181, EBI-739696;
Q8TBB1:LNX1; NbExp=3; IntAct=EBI-741181, EBI-739832;
Q96PE7:MCEE; NbExp=5; IntAct=EBI-11522760, EBI-10292326;
Q9NQG6:MIEF1; NbExp=3; IntAct=EBI-741181, EBI-740987;
Q96C03:MIEF2; NbExp=3; IntAct=EBI-741181, EBI-750153;
Q6IN84:MRM1; NbExp=3; IntAct=EBI-741181, EBI-5454865;
Q96E29:MTERF3; NbExp=3; IntAct=EBI-741181, EBI-7825321;
Q9UIF7-3:MUTYH; NbExp=3; IntAct=EBI-741181, EBI-10321956;
Q9ULP0:NDRG4; NbExp=3; IntAct=EBI-741181, EBI-10323810;
Q9ULP0-2:NDRG4; NbExp=5; IntAct=EBI-11522760, EBI-11978907;
Q9UMS0:NFU1; NbExp=3; IntAct=EBI-741181, EBI-725252;
P25208:NFYB; NbExp=3; IntAct=EBI-741181, EBI-389728;
Q16617:NKG7; NbExp=3; IntAct=EBI-741181, EBI-3919611;
Q5JS98:PBX3; NbExp=3; IntAct=EBI-741181, EBI-10244393;
Q96AL5:PBX3; NbExp=3; IntAct=EBI-741181, EBI-741171;
Q9UKL6:PCTP; NbExp=3; IntAct=EBI-741181, EBI-4402391;
O00330:PDHX; NbExp=4; IntAct=EBI-741181, EBI-751566;
Q9BSJ6:PIMREG; NbExp=3; IntAct=EBI-11522760, EBI-2568609;
Q9UKF7:PITPNC1; NbExp=6; IntAct=EBI-741181, EBI-749241;
Q9NVS9:PNPO; NbExp=5; IntAct=EBI-11522760, EBI-11030787;
P43378:PTPN9; NbExp=4; IntAct=EBI-741181, EBI-742898;
Q6IQ43:PTPN9; NbExp=3; IntAct=EBI-741181, EBI-10250413;
Q96LZ7:RMDN2; NbExp=3; IntAct=EBI-741181, EBI-2806908;
A8MRB1:S100B; NbExp=3; IntAct=EBI-11522760, EBI-16432654;
P24280:SEC14 (xeno); NbExp=3; IntAct=EBI-11522760, EBI-16535;
Q9HC62:SENP2; NbExp=3; IntAct=EBI-741181, EBI-714881;
Q13596:SNX1; NbExp=3; IntAct=EBI-741181, EBI-2822329;
Q9NZD8:SPG21; NbExp=4; IntAct=EBI-741181, EBI-742688;
Q99909:SSX3; NbExp=3; IntAct=EBI-741181, EBI-10295431;
O60225:SSX5; NbExp=3; IntAct=EBI-741181, EBI-10186198;
Q7L1H2:STAG3L1; NbExp=3; IntAct=EBI-741181, EBI-10255998;
E5KS60:SUCLA2; NbExp=3; IntAct=EBI-741181, EBI-10176959;
Q9P2R7:SUCLA2; NbExp=5; IntAct=EBI-11522760, EBI-2269898;
Q17RD7:SYT16; NbExp=3; IntAct=EBI-741181, EBI-10238936;
P38340:TAE1 (xeno); NbExp=3; IntAct=EBI-11522760, EBI-21116;
Q969Z0:TBRG4; NbExp=3; IntAct=EBI-741181, EBI-702328;
Q96MN5:TCEANC2; NbExp=3; IntAct=EBI-741181, EBI-5462748;
Q00059:TFAM; NbExp=3; IntAct=EBI-741181, EBI-1049924;
Q96J77:TPD52L3; NbExp=3; IntAct=EBI-741181, EBI-932162;
P68363:TUBA1B; NbExp=3; IntAct=EBI-741181, EBI-487083;
Q99757:TXN2; NbExp=3; IntAct=EBI-741181, EBI-2932492;
Q02724:ULP1 (xeno); NbExp=3; IntAct=EBI-11522760, EBI-20050;
Q12259:YLR108C (xeno); NbExp=3; IntAct=EBI-11522760, EBI-30776;
P38815:YPT35 (xeno); NbExp=3; IntAct=EBI-11522760, EBI-24665;
Q9BQ24:ZFYVE21; NbExp=3; IntAct=EBI-741181, EBI-2849569;
-!- SUBCELLULAR LOCATION: Endoplasmic reticulum membrane
{ECO:0000269|PubMed:12960423}; Multi-pass membrane protein
{ECO:0000269|PubMed:12960423}. Golgi apparatus membrane
{ECO:0000269|PubMed:12960423}; Multi-pass membrane protein
{ECO:0000269|PubMed:12960423}. Cytoplasmic vesicle membrane
{ECO:0000269|PubMed:12960423}; Multi-pass membrane protein
{ECO:0000269|PubMed:12960423}. Note=Present in perinuclear
vesicular membranes, Endoplasmic reticulum, Golgi and endocytic
vesicles.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1;
IsoId=Q6RW13-1; Sequence=Displayed;
Name=2;
IsoId=Q6RW13-2; Sequence=VSP_014839;
Name=3;
IsoId=Q6RW13-3; Sequence=VSP_039290;
Note=No experimental confirmation available.;
Name=5;
IsoId=Q6RW13-5; Sequence=VSP_040406;
Name=4;
IsoId=Q6RW13-4; Sequence=VSP_039291;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Ubiquitous but more abundant in kidney, heart,
pancreas and thyroid. {ECO:0000269|PubMed:11733189}.
-!- SEQUENCE CAUTION:
Sequence=CAI15876.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/agtrap/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF312374; AAL26806.1; -; mRNA.
EMBL; AF165187; AAF89547.1; -; mRNA.
EMBL; CA866314; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AY488088; AAR25556.1; -; Genomic_DNA.
EMBL; AL953897; CAI15876.1; ALT_SEQ; Genomic_DNA.
EMBL; AL953897; CAI15877.1; -; Genomic_DNA.
EMBL; AL953897; CAI15878.1; -; Genomic_DNA.
EMBL; AL953897; CAI15879.1; -; Genomic_DNA.
EMBL; CH471130; EAW71702.1; -; Genomic_DNA.
EMBL; BC017328; AAH17328.1; -; mRNA.
EMBL; BE782705; -; NOT_ANNOTATED_CDS; mRNA.
CCDS; CCDS136.1; -. [Q6RW13-1]
CCDS; CCDS30585.1; -. [Q6RW13-2]
CCDS; CCDS30586.1; -. [Q6RW13-4]
CCDS; CCDS41248.1; -. [Q6RW13-3]
CCDS; CCDS44056.1; -. [Q6RW13-5]
RefSeq; NP_001035284.1; NM_001040194.1. [Q6RW13-2]
RefSeq; NP_001035285.1; NM_001040195.1. [Q6RW13-4]
RefSeq; NP_001035286.1; NM_001040196.1. [Q6RW13-5]
RefSeq; NP_001035287.1; NM_001040197.1. [Q6RW13-3]
RefSeq; NP_065083.3; NM_020350.4. [Q6RW13-1]
UniGene; Hs.464438; -.
ProteinModelPortal; Q6RW13; -.
BioGrid; 121356; 96.
IntAct; Q6RW13; 147.
MINT; Q6RW13; -.
STRING; 9606.ENSP00000319713; -.
iPTMnet; Q6RW13; -.
PhosphoSitePlus; Q6RW13; -.
SwissPalm; Q6RW13; -.
BioMuta; AGTRAP; -.
DMDM; 71152303; -.
EPD; Q6RW13; -.
MaxQB; Q6RW13; -.
PaxDb; Q6RW13; -.
PeptideAtlas; Q6RW13; -.
PRIDE; Q6RW13; -.
ProteomicsDB; 67329; -.
ProteomicsDB; 67330; -. [Q6RW13-2]
ProteomicsDB; 67331; -. [Q6RW13-3]
ProteomicsDB; 67332; -. [Q6RW13-4]
ProteomicsDB; 67333; -. [Q6RW13-5]
TopDownProteomics; Q6RW13-1; -. [Q6RW13-1]
TopDownProteomics; Q6RW13-2; -. [Q6RW13-2]
DNASU; 57085; -.
Ensembl; ENST00000314340; ENSP00000319713; ENSG00000177674. [Q6RW13-1]
Ensembl; ENST00000376629; ENSP00000365816; ENSG00000177674. [Q6RW13-2]
Ensembl; ENST00000376637; ENSP00000365824; ENSG00000177674. [Q6RW13-4]
Ensembl; ENST00000400895; ENSP00000383688; ENSG00000177674. [Q6RW13-3]
Ensembl; ENST00000452018; ENSP00000408505; ENSG00000177674. [Q6RW13-5]
GeneID; 57085; -.
KEGG; hsa:57085; -.
UCSC; uc001ast.4; human. [Q6RW13-1]
CTD; 57085; -.
DisGeNET; 57085; -.
EuPathDB; HostDB:ENSG00000177674.15; -.
GeneCards; AGTRAP; -.
HGNC; HGNC:13539; AGTRAP.
HPA; HPA044120; -.
MIM; 608729; gene.
neXtProt; NX_Q6RW13; -.
OpenTargets; ENSG00000177674; -.
PharmGKB; PA38363; -.
eggNOG; ENOG410IYP8; Eukaryota.
eggNOG; ENOG4111P37; LUCA.
GeneTree; ENSGT00390000017402; -.
HOGENOM; HOG000034218; -.
HOVERGEN; HBG080881; -.
InParanoid; Q6RW13; -.
OMA; YHMYRER; -.
OrthoDB; EOG091G0TSZ; -.
PhylomeDB; Q6RW13; -.
TreeFam; TF324477; -.
Reactome; R-HSA-6802952; Signaling by BRAF and RAF fusions.
ChiTaRS; AGTRAP; human.
GeneWiki; AGTRAP; -.
GenomeRNAi; 57085; -.
PRO; PR:Q6RW13; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000177674; -.
CleanEx; HS_AGTRAP; -.
ExpressionAtlas; Q6RW13; baseline and differential.
Genevisible; Q6RW13; HS.
GO; GO:0005938; C:cell cortex; IEA:Ensembl.
GO; GO:0030659; C:cytoplasmic vesicle membrane; IEA:UniProtKB-SubCell.
GO; GO:0005829; C:cytosol; IDA:HPA.
GO; GO:0005789; C:endoplasmic reticulum membrane; IEA:UniProtKB-SubCell.
GO; GO:0000139; C:Golgi membrane; IEA:UniProtKB-SubCell.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0043231; C:intracellular membrane-bounded organelle; IDA:HPA.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0005886; C:plasma membrane; IEA:Ensembl.
GO; GO:0004945; F:angiotensin type II receptor activity; IEA:Ensembl.
GO; GO:0008217; P:regulation of blood pressure; IEA:Ensembl.
GO; GO:0001666; P:response to hypoxia; IEA:Ensembl.
InterPro; IPR009436; AGTRAP.
PANTHER; PTHR16521; PTHR16521; 1.
Pfam; PF06396; AGTRAP; 1.
ProDom; PD357679; PD357679; 1.
SMART; SM00805; AGTRAP; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasmic vesicle;
Endoplasmic reticulum; Golgi apparatus; Membrane; Phosphoprotein;
Polymorphism; Reference proteome; Transmembrane; Transmembrane helix.
CHAIN 1 159 Type-1 angiotensin II receptor-associated
protein.
/FTId=PRO_0000064735.
TOPO_DOM 1 23 Extracellular. {ECO:0000255}.
TRANSMEM 24 44 Helical. {ECO:0000255}.
TOPO_DOM 45 55 Cytoplasmic. {ECO:0000255}.
TRANSMEM 56 76 Helical. {ECO:0000255}.
TOPO_DOM 77 86 Extracellular. {ECO:0000255}.
TRANSMEM 87 107 Helical. {ECO:0000255}.
TOPO_DOM 108 159 Cytoplasmic. {ECO:0000255}.
REGION 110 122 Interaction with AGTR1.
MOD_RES 126 126 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 127 127 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 135 135 Phosphothreonine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 138 138 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 153 153 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
VAR_SEQ 10 159 VILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDS
IDAISMFLGGLLATIFLDIVHISIFYPRVSLTDTGRFGVGM
AILSLLLKPLSCCFVYHMYRERGGELLVHTGFLGSSQDRSA
YQTIDSAEAPADPFAVPEGRSQDARGY -> GLHCILRLLC
LGQLHHPGLGRVGCGSAGLHRRHKHVSGWLAGHHLPGHRAH
QHLLPAGQPHGHGPLWRGHGHPQLAAQAALLLLRLPHVPGA
RGFPWVFSGP (in isoform 4).
{ECO:0000303|Ref.3}.
/FTId=VSP_039291.
VAR_SEQ 21 159 WGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGGL
LATIFLDIVHISIFYPRVSLTDTGRFGVGMAILSLLLKPLS
CCFVYHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPA
DPFAVPEGRSQDARGY -> CFWRHFSAKPRLETIELTCAL
CKLRSAAHRATAGLHCILRLLCLGQLHHPGLGRVGCGSAGL
HRRHKHVSGWLAGHHLPGHRAHQHLLPAGQPHGHGPLWRGH
GHPQLAAQAALLLLRLPHVPGARG (in isoform 3).
{ECO:0000305}.
/FTId=VSP_039290.
VAR_SEQ 21 159 WGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGGL
LATIFLDIVHISIFYPRVSLTDTGRFGVGMAILSLLLKPLS
CCFVYHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPA
DPFAVPEGRSQDARGY -> CFWRHFSAKPRLETIELTCAL
CKLRSAAHRATAGLHCILRLLCLGQLHHPGLGRVGCGSAGL
HRRHKHVSGWLAGHHLPGHRAHQHLLPAGQPHGHGPLWRGH
GHPQLAAQAALLLLRLPHVPGARGFPWVFSGP (in
isoform 5).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_040406.
VAR_SEQ 115 121 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_014839.
VARIANT 143 143 A -> V (in dbSNP:rs17875960).
{ECO:0000269|Ref.4}.
/FTId=VAR_023075.
CONFLICT 158 158 G -> R (in Ref. 2; AAF89547).
{ECO:0000305}.
CONFLICT 159 159 Y -> S (in Ref. 1; AAL26806).
{ECO:0000305}.
SEQUENCE 159 AA; 17419 MW; 7E1D5C7E79AE6BC5 CRC64;
MELPAVNLKV ILLGHWLLTT WGCIVFSGSY AWANFTILAL GVWAVAQRDS IDAISMFLGG
LLATIFLDIV HISIFYPRVS LTDTGRFGVG MAILSLLLKP LSCCFVYHMY RERGGELLVH
TGFLGSSQDR SAYQTIDSAE APADPFAVPE GRSQDARGY


Related products :

Catalog number Product name Quantity
GB-30074 G-protein coupled receptor (GPCRs) related antibodies: Anti-angiotensin II receptor, type 1 (AGTR1), Rabbit-Poly 100μg
GB-30075 G-protein coupled receptor (GPCRs) related antibodies: Anti-angiotensin II receptor, type 2 (AGTR2), Rabbit-Poly 100μg
EIAAB25784 Angiotensin-II type 2 receptor-interacting protein,AT2 receptor-binding protein,Atbp,Atip,Cctsg1,Coiled-coiled tumor suppressor gene 1 protein,Kiaa1288,Microtubule-associated tumor suppressor 1 homolo
E1658h ELISA AGTR1,AGTR1A,AGTR1B,Angiotensin II type-1 receptor,AT1,AT1AR,AT1BR,AT2R1,AT2R1B,Homo sapiens,Human,Type-1 angiotensin II receptor 96T
E1658h ELISA kit AGTR1,AGTR1A,AGTR1B,Angiotensin II type-1 receptor,AT1,AT1AR,AT1BR,AT2R1,AT2R1B,Homo sapiens,Human,Type-1 angiotensin II receptor 96T
U1658h CLIA AGTR1,AGTR1A,AGTR1B,Angiotensin II type-1 receptor,AT1,AT1AR,AT1BR,AT2R1,AT2R1B,Homo sapiens,Human,Type-1 angiotensin II receptor 96T
EIAAB25786 Angiotensin-II type 2 receptor-interacting protein,AT2 receptor-binding protein,ATBP,ATIP,GK1,Homo sapiens,Human,KIAA1288,Microtubule-associated tumor suppressor 1,Mitochondrial tumor suppressor 1,MTS
E1658m ELISA Agtr1,Agtr1a,Angiotensin II type-1A receptor,AT1A,Mouse,Mus musculus,Type-1A angiotensin II receptor 96T
U1658m CLIA Agtr1,Agtr1a,Angiotensin II type-1A receptor,AT1A,Mouse,Mus musculus,Type-1A angiotensin II receptor 96T
E1658m ELISA kit Agtr1,Agtr1a,Angiotensin II type-1A receptor,AT1A,Mouse,Mus musculus,Type-1A angiotensin II receptor 96T
E0973h ELISA AGTR2,Angiotensin II type-2 receptor,AT2,Homo sapiens,Human,Type-2 angiotensin II receptor 96T
E1658Rb ELISA AGTR1,Angiotensin II type-1 receptor,AT1,Oryctolagus cuniculus,Rabbit,Type-1 angiotensin II receptor 96T
U0973h CLIA AGTR2,Angiotensin II type-2 receptor,AT2,Homo sapiens,Human,Type-2 angiotensin II receptor 96T
E1658Rb ELISA kit AGTR1,Angiotensin II type-1 receptor,AT1,Oryctolagus cuniculus,Rabbit,Type-1 angiotensin II receptor 96T
U1658Rb CLIA AGTR1,Angiotensin II type-1 receptor,AT1,Oryctolagus cuniculus,Rabbit,Type-1 angiotensin II receptor 96T
E0973h ELISA kit AGTR2,Angiotensin II type-2 receptor,AT2,Homo sapiens,Human,Type-2 angiotensin II receptor 96T
18-461-10226 Apelin receptor - G-protein coupled receptor APJ; Angiotensin receptor-like 1; HG11 Polyclonal 0.05 ml
18-461-10227 Apelin receptor - G-protein coupled receptor APJ; Angiotensin receptor-like 1; HG11 Polyclonal 0.05 ml
18-461-10228 Apelin receptor - G-protein coupled receptor APJ; Angiotensin receptor-like 1; HG11 Polyclonal 0.05 ml
18-461-10592 Apelin receptor - G-protein coupled receptor APJ; Angiotensin receptor-like 1; HG11 Polyclonal 0.05 ml
E1658b ELISA AGTR1,Angiotensin II type-1 receptor,AT1,Bos taurus,Bovine,Type-1 angiotensin II receptor 96T
E0973m ELISA Agtr2,Angiotensin II type-2 receptor,AT2,Mouse,Mus musculus,Type-2 angiotensin II receptor 96T
U0973m CLIA Agtr2,Angiotensin II type-2 receptor,AT2,Mouse,Mus musculus,Type-2 angiotensin II receptor 96T
U0973r CLIA Agtr2,Angiotensin II type-2 receptor,AT2,Rat,Rattus norvegicus,Type-2 angiotensin II receptor 96T
U1658b CLIA AGTR1,Angiotensin II type-1 receptor,AT1,Bos taurus,Bovine,Type-1 angiotensin II receptor 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur