Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Tyrosine-protein kinase Btk29A (EC 2.7.10.2) (Dsrc28C) (Dsrc29a)

 BTKL_DROME              Reviewed;         786 AA.
P08630; A4V0F3; A4V0F4; O45032; O76132; O76133; P11361; Q6NNV0;
Q8T0A0; Q9VLQ2; Q9VLQ3;
01-AUG-1988, integrated into UniProtKB/Swiss-Prot.
25-NOV-2002, sequence version 2.
22-NOV-2017, entry version 201.
RecName: Full=Tyrosine-protein kinase Btk29A;
EC=2.7.10.2;
AltName: Full=Dsrc28C;
AltName: Full=Dsrc29a;
Name=Btk29A; Synonyms=Src2, Src29A, Tec29; ORFNames=CG8049;
Drosophila melanogaster (Fruit fly).
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
Pterygota; Neoptera; Holometabola; Diptera; Brachycera; Muscomorpha;
Ephydroidea; Drosophilidae; Drosophila; Sophophora.
NCBI_TaxID=7227;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), TISSUE SPECIFICITY, AND
DEVELOPMENTAL STAGE.
PubMed=3110602; DOI=10.1128/MCB.7.6.2119;
Gregory R.J., Kammermeyer K.L., Vincent W.S. III, Wadsworth S.G.;
"Primary sequence and developmental expression of a novel Drosophila
melanogaster src gene.";
Mol. Cell. Biol. 7:2119-2127(1987).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B), FUNCTION, TISSUE
SPECIFICITY, DEVELOPMENTAL STAGE, AND DISRUPTION PHENOTYPE.
STRAIN=Canton-S, and Oregon-R; TISSUE=Head;
PubMed=10330180; DOI=10.1128/MCB.19.6.4405;
Baba K., Takeshita A., Majima K., Ueda R., Kondo S., Juni N.,
Yamamoto D.;
"The Drosophila Bruton's tyrosine kinase (Btk) homolog is required for
adult survival and male genital formation.";
Mol. Cell. Biol. 19:4405-4413(1999).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=Berkeley;
PubMed=10731132; DOI=10.1126/science.287.5461.2185;
Adams M.D., Celniker S.E., Holt R.A., Evans C.A., Gocayne J.D.,
Amanatides P.G., Scherer S.E., Li P.W., Hoskins R.A., Galle R.F.,
George R.A., Lewis S.E., Richards S., Ashburner M., Henderson S.N.,
Sutton G.G., Wortman J.R., Yandell M.D., Zhang Q., Chen L.X.,
Brandon R.C., Rogers Y.-H.C., Blazej R.G., Champe M., Pfeiffer B.D.,
Wan K.H., Doyle C., Baxter E.G., Helt G., Nelson C.R., Miklos G.L.G.,
Abril J.F., Agbayani A., An H.-J., Andrews-Pfannkoch C., Baldwin D.,
Ballew R.M., Basu A., Baxendale J., Bayraktaroglu L., Beasley E.M.,
Beeson K.Y., Benos P.V., Berman B.P., Bhandari D., Bolshakov S.,
Borkova D., Botchan M.R., Bouck J., Brokstein P., Brottier P.,
Burtis K.C., Busam D.A., Butler H., Cadieu E., Center A., Chandra I.,
Cherry J.M., Cawley S., Dahlke C., Davenport L.B., Davies P.,
de Pablos B., Delcher A., Deng Z., Mays A.D., Dew I., Dietz S.M.,
Dodson K., Doup L.E., Downes M., Dugan-Rocha S., Dunkov B.C., Dunn P.,
Durbin K.J., Evangelista C.C., Ferraz C., Ferriera S., Fleischmann W.,
Fosler C., Gabrielian A.E., Garg N.S., Gelbart W.M., Glasser K.,
Glodek A., Gong F., Gorrell J.H., Gu Z., Guan P., Harris M.,
Harris N.L., Harvey D.A., Heiman T.J., Hernandez J.R., Houck J.,
Hostin D., Houston K.A., Howland T.J., Wei M.-H., Ibegwam C.,
Jalali M., Kalush F., Karpen G.H., Ke Z., Kennison J.A., Ketchum K.A.,
Kimmel B.E., Kodira C.D., Kraft C.L., Kravitz S., Kulp D., Lai Z.,
Lasko P., Lei Y., Levitsky A.A., Li J.H., Li Z., Liang Y., Lin X.,
Liu X., Mattei B., McIntosh T.C., McLeod M.P., McPherson D.,
Merkulov G., Milshina N.V., Mobarry C., Morris J., Moshrefi A.,
Mount S.M., Moy M., Murphy B., Murphy L., Muzny D.M., Nelson D.L.,
Nelson D.R., Nelson K.A., Nixon K., Nusskern D.R., Pacleb J.M.,
Palazzolo M., Pittman G.S., Pan S., Pollard J., Puri V., Reese M.G.,
Reinert K., Remington K., Saunders R.D.C., Scheeler F., Shen H.,
Shue B.C., Siden-Kiamos I., Simpson M., Skupski M.P., Smith T.J.,
Spier E., Spradling A.C., Stapleton M., Strong R., Sun E.,
Svirskas R., Tector C., Turner R., Venter E., Wang A.H., Wang X.,
Wang Z.-Y., Wassarman D.A., Weinstock G.M., Weissenbach J.,
Williams S.M., Woodage T., Worley K.C., Wu D., Yang S., Yao Q.A.,
Ye J., Yeh R.-F., Zaveri J.S., Zhan M., Zhang G., Zhao Q., Zheng L.,
Zheng X.H., Zhong F.N., Zhong W., Zhou X., Zhu S.C., Zhu X.,
Smith H.O., Gibbs R.A., Myers E.W., Rubin G.M., Venter J.C.;
"The genome sequence of Drosophila melanogaster.";
Science 287:2185-2195(2000).
[4]
GENOME REANNOTATION, AND ALTERNATIVE SPLICING.
STRAIN=Berkeley;
PubMed=12537572; DOI=10.1186/gb-2002-3-12-research0083;
Misra S., Crosby M.A., Mungall C.J., Matthews B.B., Campbell K.S.,
Hradecky P., Huang Y., Kaminker J.S., Millburn G.H., Prochnik S.E.,
Smith C.D., Tupy J.L., Whitfield E.J., Bayraktaroglu L., Berman B.P.,
Bettencourt B.R., Celniker S.E., de Grey A.D.N.J., Drysdale R.A.,
Harris N.L., Richter J., Russo S., Schroeder A.J., Shu S.Q.,
Stapleton M., Yamada C., Ashburner M., Gelbart W.M., Rubin G.M.,
Lewis S.E.;
"Annotation of the Drosophila melanogaster euchromatic genome: a
systematic review.";
Genome Biol. 3:RESEARCH0083.1-RESEARCH0083.22(2002).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS A AND B).
STRAIN=Berkeley; TISSUE=Embryo;
PubMed=12537569; DOI=10.1186/gb-2002-3-12-research0080;
Stapleton M., Carlson J.W., Brokstein P., Yu C., Champe M.,
George R.A., Guarin H., Kronmiller B., Pacleb J.M., Park S., Wan K.H.,
Rubin G.M., Celniker S.E.;
"A Drosophila full-length cDNA resource.";
Genome Biol. 3:RESEARCH0080.1-RESEARCH0080.8(2002).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A).
STRAIN=Berkeley;
Stapleton M., Brokstein P., Hong L., Agbayani A., Carlson J.W.,
Champe M., Chavez C., Dorsett V., Dresnek D., Farfan D., Frise E.,
George R.A., Gonzalez M., Guarin H., Kronmiller B., Li P.W., Liao G.,
Miranda A., Mungall C.J., Nunoo J., Pacleb J.M., Paragas V., Park S.,
Patel S., Phouanenavong S., Wan K.H., Yu C., Lewis S.E., Rubin G.M.,
Celniker S.E.;
Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [MRNA] OF 199-786 (ISOFORM A).
TISSUE=Eye-antennal disk;
PubMed=9660966; DOI=10.1016/S1097-2765(00)80082-9;
Guarnieri D.J., Dodson G.S., Simon M.A.;
"SRC64 regulates the localization of a Tec-family kinase required for
Drosophila ring canal growth.";
Mol. Cell 1:831-840(1998).
[8]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 552-684.
PubMed=3923437; DOI=10.1093/nar/13.6.2153;
Wadsworth S.C., Madhavan K., Bilodeau-Wentworth D.;
"Maternal inheritance of transcripts from three Drosophila src-related
genes.";
Nucleic Acids Res. 13:2153-2170(1985).
[9]
FUNCTION, AND TISSUE SPECIFICITY.
PubMed=9655810;
Dodson G.S., Guarnieri D.J., Simon M.A.;
"Src64 is required for ovarian ring canal morphogenesis during
Drosophila oogenesis.";
Development 125:2883-2892(1998).
[10]
SIMILARITY TO BTK SUBFAMILY.
Sjolander K.;
Unpublished observations (JUL-1997).
-!- FUNCTION: Required for proper ring canal development. Also
required for the development of male genitalia and for adult
survival. {ECO:0000269|PubMed:10330180,
ECO:0000269|PubMed:9655810}.
-!- CATALYTIC ACTIVITY: ATP + a [protein]-L-tyrosine = ADP + a
[protein]-L-tyrosine phosphate. {ECO:0000255|PROSITE-
ProRule:PRU10028}.
-!- COFACTOR:
Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000250};
Note=Binds 1 zinc ion per subunit. {ECO:0000250};
-!- SUBCELLULAR LOCATION: Note=Ring canals.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=B; Synonyms=D, E, Type 2;
IsoId=P08630-1; Sequence=Displayed;
Name=A; Synonyms=C, F, Type 1;
IsoId=P08630-2; Sequence=VSP_004964, VSP_004965;
-!- TISSUE SPECIFICITY: Ring canals in the egg chambers and imaginal
disks of third-instar larvae. {ECO:0000269|PubMed:10330180,
ECO:0000269|PubMed:3110602, ECO:0000269|PubMed:9655810}.
-!- DEVELOPMENTAL STAGE: Expressed both maternally and zygotically.
Predominantly in early to middle embryogenesis, in larvae and
adult females. {ECO:0000269|PubMed:10330180,
ECO:0000269|PubMed:3110602}.
-!- DISRUPTION PHENOTYPE: Flies exhibit shortened copulatory duration
(due to incomplete fusion of the left and right halves of the
apodeme that holds the penis during copulation) and reduced adult-
stage life span. {ECO:0000269|PubMed:10330180}.
-!- SIMILARITY: Belongs to the protein kinase superfamily. Tyr protein
kinase family. TEC subfamily. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
-!- SEQUENCE CAUTION:
Sequence=AAA28912.1; Type=Frameshift; Positions=62, 215, 218, 220, 401; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; M16599; AAA28912.1; ALT_FRAME; mRNA.
EMBL; AB009840; BAA24063.1; -; mRNA.
EMBL; AB009841; BAA24064.1; -; mRNA.
EMBL; AE014134; AAF52631.3; -; Genomic_DNA.
EMBL; AE014134; AAF52632.2; -; Genomic_DNA.
EMBL; AE014134; AAN11161.1; -; Genomic_DNA.
EMBL; AE014134; AAN11162.1; -; Genomic_DNA.
EMBL; AE014134; ABV53648.1; -; Genomic_DNA.
EMBL; AE014134; ABV53649.1; -; Genomic_DNA.
EMBL; AY069457; AAL39602.1; -; mRNA.
EMBL; AY128441; AAM75034.1; -; mRNA.
EMBL; BT011183; AAR88544.1; -; mRNA.
EMBL; AF044337; AAB99858.1; -; mRNA.
EMBL; X02305; CAA26170.1; -; Genomic_DNA.
PIR; A23051; A23051.
PIR; A27807; TVFFDS.
RefSeq; NP_001097120.1; NM_001103650.2. [P08630-2]
RefSeq; NP_001097121.1; NM_001103651.3. [P08630-1]
RefSeq; NP_476745.1; NM_057397.6. [P08630-1]
RefSeq; NP_476746.1; NM_057398.4. [P08630-2]
RefSeq; NP_723369.1; NM_164804.2. [P08630-1]
RefSeq; NP_723370.1; NM_164805.2. [P08630-2]
UniGene; Dm.7306; -.
ProteinModelPortal; P08630; -.
SMR; P08630; -.
BioGrid; 60259; 23.
DIP; DIP-23748N; -.
IntAct; P08630; 1.
MINT; MINT-896102; -.
STRING; 7227.FBpp0079237; -.
iPTMnet; P08630; -.
PaxDb; P08630; -.
PRIDE; P08630; -.
EnsemblMetazoa; FBtr0079615; FBpp0079235; FBgn0003502. [P08630-2]
EnsemblMetazoa; FBtr0079616; FBpp0079236; FBgn0003502. [P08630-1]
EnsemblMetazoa; FBtr0079617; FBpp0079237; FBgn0003502. [P08630-1]
EnsemblMetazoa; FBtr0079618; FBpp0079238; FBgn0003502. [P08630-2]
EnsemblMetazoa; FBtr0112835; FBpp0111748; FBgn0003502. [P08630-2]
EnsemblMetazoa; FBtr0112836; FBpp0111749; FBgn0003502. [P08630-1]
GeneID; 34132; -.
KEGG; dme:Dmel_CG8049; -.
CTD; 34132; -.
FlyBase; FBgn0003502; Btk29A.
eggNOG; KOG0197; Eukaryota.
eggNOG; COG0515; LUCA.
GeneTree; ENSGT00760000119011; -.
InParanoid; P08630; -.
KO; K07364; -.
OMA; RYPVCSW; -.
OrthoDB; EOG091G0D46; -.
PhylomeDB; P08630; -.
SignaLink; P08630; -.
ChiTaRS; Btk29A; fly.
GenomeRNAi; 34132; -.
PRO; PR:P08630; -.
Proteomes; UP000000803; Chromosome 2L.
Bgee; FBgn0003502; -.
ExpressionAtlas; P08630; differential.
Genevisible; P08630; DM.
GO; GO:0045177; C:apical part of cell; IDA:FlyBase.
GO; GO:0071944; C:cell periphery; IDA:FlyBase.
GO; GO:0005737; C:cytoplasm; IDA:FlyBase.
GO; GO:0031234; C:extrinsic component of cytoplasmic side of plasma membrane; IBA:GO_Central.
GO; GO:0045172; C:germline ring canal; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; IDA:FlyBase.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0004715; F:non-membrane spanning protein tyrosine kinase activity; IBA:GO_Central.
GO; GO:0004713; F:protein tyrosine kinase activity; IDA:FlyBase.
GO; GO:0030036; P:actin cytoskeleton organization; IMP:FlyBase.
GO; GO:0007349; P:cellularization; IMP:FlyBase.
GO; GO:0007619; P:courtship behavior; NAS:FlyBase.
GO; GO:0008340; P:determination of adult lifespan; IMP:UniProtKB.
GO; GO:0042023; P:DNA endoreduplication; IMP:FlyBase.
GO; GO:0007391; P:dorsal closure; TAS:FlyBase.
GO; GO:0007301; P:female germline ring canal formation; IDA:UniProtKB.
GO; GO:0008258; P:head involution; IMP:FlyBase.
GO; GO:0007485; P:imaginal disc-derived male genitalia development; IMP:UniProtKB.
GO; GO:0045087; P:innate immune response; IBA:GO_Central.
GO; GO:0007254; P:JNK cascade; TAS:FlyBase.
GO; GO:0030717; P:karyosome formation; IMP:FlyBase.
GO; GO:0048477; P:oogenesis; IMP:FlyBase.
GO; GO:0007424; P:open tracheal system development; IMP:FlyBase.
GO; GO:0030723; P:ovarian fusome organization; IMP:FlyBase.
GO; GO:0007300; P:ovarian nurse cell to oocyte transport; IMP:FlyBase.
GO; GO:0038083; P:peptidyl-tyrosine autophosphorylation; IBA:GO_Central.
GO; GO:0018108; P:peptidyl-tyrosine phosphorylation; IDA:FlyBase.
GO; GO:0006468; P:protein phosphorylation; NAS:FlyBase.
GO; GO:0030833; P:regulation of actin filament polymerization; IMP:FlyBase.
GO; GO:0042127; P:regulation of cell proliferation; IBA:GO_Central.
GO; GO:0044719; P:regulation of imaginal disc-derived wing size; IMP:FlyBase.
GO; GO:0007435; P:salivary gland morphogenesis; IMP:FlyBase.
GO; GO:0046960; P:sensitization; IMP:FlyBase.
GO; GO:0035277; P:spiracle morphogenesis, open tracheal system; IMP:FlyBase.
GO; GO:0007169; P:transmembrane receptor protein tyrosine kinase signaling pathway; IBA:GO_Central.
Gene3D; 2.30.29.30; -; 1.
Gene3D; 3.30.505.10; -; 1.
InterPro; IPR011009; Kinase-like_dom_sf.
InterPro; IPR011993; PH-like_dom_sf.
InterPro; IPR001849; PH_domain.
InterPro; IPR000719; Prot_kinase_dom.
InterPro; IPR017441; Protein_kinase_ATP_BS.
InterPro; IPR001245; Ser-Thr/Tyr_kinase_cat_dom.
InterPro; IPR000980; SH2.
InterPro; IPR036860; SH2_dom_sf.
InterPro; IPR036028; SH3-like_dom_sf.
InterPro; IPR001452; SH3_domain.
InterPro; IPR008266; Tyr_kinase_AS.
InterPro; IPR020635; Tyr_kinase_cat_dom.
InterPro; IPR001562; Znf_Btk_motif.
Pfam; PF00779; BTK; 1.
Pfam; PF00169; PH; 1.
Pfam; PF07714; Pkinase_Tyr; 1.
Pfam; PF00017; SH2; 1.
Pfam; PF00018; SH3_1; 1.
PRINTS; PR00401; SH2DOMAIN.
PRINTS; PR00109; TYRKINASE.
SMART; SM00233; PH; 1.
SMART; SM00252; SH2; 1.
SMART; SM00326; SH3; 1.
SMART; SM00219; TyrKc; 1.
SUPFAM; SSF50044; SSF50044; 1.
SUPFAM; SSF50729; SSF50729; 2.
SUPFAM; SSF55550; SSF55550; 1.
SUPFAM; SSF56112; SSF56112; 1.
PROSITE; PS50003; PH_DOMAIN; 1.
PROSITE; PS00107; PROTEIN_KINASE_ATP; 1.
PROSITE; PS50011; PROTEIN_KINASE_DOM; 1.
PROSITE; PS00109; PROTEIN_KINASE_TYR; 1.
PROSITE; PS50001; SH2; 1.
PROSITE; PS50002; SH3; 1.
PROSITE; PS51113; ZF_BTK; 1.
2: Evidence at transcript level;
Alternative splicing; ATP-binding; Complete proteome; Kinase;
Metal-binding; Nucleotide-binding; Phosphoprotein; Proto-oncogene;
Reference proteome; SH2 domain; SH3 domain; Transferase;
Tyrosine-protein kinase; Zinc; Zinc-finger.
CHAIN 1 786 Tyrosine-protein kinase Btk29A.
/FTId=PRO_0000088068.
DOMAIN 41 184 PH. {ECO:0000255|PROSITE-
ProRule:PRU00145}.
DOMAIN 342 402 SH3. {ECO:0000255|PROSITE-
ProRule:PRU00192}.
DOMAIN 410 503 SH2. {ECO:0000255|PROSITE-
ProRule:PRU00191}.
DOMAIN 526 779 Protein kinase. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
ZN_FING 187 223 Btk-type. {ECO:0000255|PROSITE-
ProRule:PRU00432}.
NP_BIND 532 540 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
COMPBIAS 14 27 Ser-rich.
COMPBIAS 231 264 Ser-rich.
COMPBIAS 263 289 Gly-rich.
ACT_SITE 647 647 Proton acceptor. {ECO:0000255|PROSITE-
ProRule:PRU00159, ECO:0000255|PROSITE-
ProRule:PRU10028}.
METAL 195 195 Zinc. {ECO:0000250}.
METAL 206 206 Zinc. {ECO:0000250}.
METAL 207 207 Zinc. {ECO:0000250}.
METAL 217 217 Zinc. {ECO:0000250}.
BINDING 554 554 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00159}.
MOD_RES 677 677 Phosphotyrosine; by autocatalysis.
{ECO:0000250}.
VAR_SEQ 1 183 Missing (in isoform A).
{ECO:0000303|PubMed:10330180,
ECO:0000303|PubMed:12537569,
ECO:0000303|PubMed:3110602,
ECO:0000303|PubMed:9660966,
ECO:0000303|Ref.6}.
/FTId=VSP_004964.
VAR_SEQ 184 231 EDSNTPKSYRYHPGLWSGKKWSCCKGLSRTTFGCRAAAHWR
EANNNPS -> MIPCVSLAETSVIGNMKERVKEMKVFGCRL
NFWNHIGHSLTSSKTKEG (in isoform A).
{ECO:0000303|PubMed:10330180,
ECO:0000303|PubMed:12537569,
ECO:0000303|PubMed:3110602,
ECO:0000303|PubMed:9660966,
ECO:0000303|Ref.6}.
/FTId=VSP_004965.
CONFLICT 243 243 S -> A (in Ref. 1; AAA28912).
{ECO:0000305}.
CONFLICT 317 317 T -> N (in Ref. 1; AAA28912 and 2;
BAA24063/BAA24064). {ECO:0000305}.
CONFLICT 352 353 PF -> LG (in Ref. 1; AAA28912).
{ECO:0000305}.
CONFLICT 363 363 L -> VG (in Ref. 1; AAA28912).
{ECO:0000305}.
CONFLICT 398 400 KPK -> QAE (in Ref. 1; AAA28912).
{ECO:0000305}.
CONFLICT 414 414 D -> Y (in Ref. 1; AAA28912).
{ECO:0000305}.
CONFLICT 524 525 ME -> IQ (in Ref. 1; AAA28912).
{ECO:0000305}.
CONFLICT 589 589 S -> T (in Ref. 1; AAA28912 and 7;
CAA26170). {ECO:0000305}.
CONFLICT 657 657 S -> F (in Ref. 7; CAA26170).
{ECO:0000305}.
CONFLICT 681 684 GGTK -> AEPS (in Ref. 7; CAA26170).
{ECO:0000305}.
SEQUENCE 786 AA; 87392 MW; E2BCE122E6AAA0AA CRC64;
MMGTKHRNSH VNGSIKSSSS LRSSSKSFQA KMDLMSERLY DVVKSGSMVK RAQNKKRFTP
VNYKHRWFEL TKRTFSYFDV ENVERRRERG RIHLKGVRLV EEATVSGEGG DPFAPDGYPF
QVGYCEISAS ANSHQLENGN GGGSGVGIEG QQSGRAVPQY TLYVIANSEK ERSEWIRAIR
QVCEDSNTPK SYRYHPGLWS GKKWSCCKGL SRTTFGCRAA AHWREANNNP SNGSSPAQNS
TRSISPNSST TNSQFSLQHN SSGSLGGGVG GGLGGGGSLG LGGGGGGGGS CTPTSLQPQS
SLTTFKQSPT LLNGNGTLLD ANMPGGIPTP GTPNSKAKDN SHFVKLVVAL YPFKAIEGGD
LSLEKNAEYE VIDDSQEHWW KVKDALGNVG YIPSNYVKPK ALLGLERYEW YVGDMSRQRA
ESLLKQGDKE GCFVVRKSST KGLYTLSLHT KVPQSHVKHY HIKQNARCEY YLSEKHCCET
IPDLINYHRH NSGGLACRLK SSPCDRPVPP TAGLSHDKWE IHPMELMLME ELGSGQFGVV
RRGKWRGSID TAVKMMKEGT MSEDDFIEEA KVMTKLQHPN LVQLYGVCSK HRPIYIVTEY
MKHGSLLNYL RRHEKTLIGN MGLLLDMCIQ VSKGMTYLER HNYIHRDLAA RNCLVGSENV
VKVADFGLAR YVLDDQYTSS GGTKFPIKWA PPEVLNYTRF SSKSDVWAYG VLMWEIFTCG
KMPYGRLKNT EVVERVQRGI ILEKPKSCAK EIYDVMKLCW SHGPEERPAF RVLMDQLALV
AQTLTD


Related products :

Catalog number Product name Quantity
32-123 Brutons tyrosine kinase (BTK) is a member of the BTK_Tec family of cytoplasmic tyrosine kinases.All members of the family contain SH3 and SH2 domains and, with the exception of Txk and Dsrc28C, also c 0.1 mL
EIAAB33008 CCK4,CCK-4,Colon carcinoma kinase 4,Homo sapiens,Human,Inactive tyrosine-protein kinase 7,Protein-tyrosine kinase 7,Pseudo tyrosine kinase receptor 7,PTK7,Tyrosine-protein kinase-like 7
EIAAB33010 Inactive tyrosine-protein kinase 7,Mouse,Mus musculus,Protein chuzhoi,Protein-tyrosine kinase 7,Pseudo tyrosine kinase receptor 7,Ptk7,Tyrosine-protein kinase-like 7
E1915m ELISA Agammaglobulinaemia tyrosine kinase,ATK,B-cell progenitor kinase,BPK,Bpk,Bruton tyrosine kinase,Btk,Kinase EMB,Mouse,Mus musculus,Tyrosine-protein kinase BTK 96T
U1915m CLIA Agammaglobulinaemia tyrosine kinase,ATK,B-cell progenitor kinase,BPK,Bpk,Bruton tyrosine kinase,Btk,Kinase EMB,Mouse,Mus musculus,Tyrosine-protein kinase BTK 96T
U1915m CLIA kit Agammaglobulinaemia tyrosine kinase,ATK,B-cell progenitor kinase,BPK,Bpk,Bruton tyrosine kinase,Btk,Kinase EMB,Mouse,Mus musculus,Tyrosine-protein kinase BTK 96T
E1915m ELISA kit Agammaglobulinaemia tyrosine kinase,ATK,B-cell progenitor kinase,BPK,Bpk,Bruton tyrosine kinase,Btk,Kinase EMB,Mouse,Mus musculus,Tyrosine-protein kinase BTK 96T
EIAAB33009 Chicken,Gallus gallus,Inactive tyrosine-protein kinase 7,Kinase-like protein,KLG,Protein-tyrosine kinase 7,Pseudo tyrosine kinase receptor 7,PTK7,Tyrosine-protein kinase-like 7
EIAAB44680 BYK,DTK,Homo sapiens,Human,RSE,SKY,TYRO3,Tyrosine-protein kinase byk,Tyrosine-protein kinase DTK,Tyrosine-protein kinase receptor TYRO3,Tyrosine-protein kinase RSE,Tyrosine-protein kinase SKY
E1915h ELISA Agammaglobulinaemia tyrosine kinase,AGMX1,ATK,ATK,B-cell progenitor kinase,BPK,BPK,Bruton tyrosine kinase,BTK,Homo sapiens,Human,Tyrosine-protein kinase BTK 96T
E1915h ELISA kit Agammaglobulinaemia tyrosine kinase,AGMX1,ATK,ATK,B-cell progenitor kinase,BPK,BPK,Bruton tyrosine kinase,BTK,Homo sapiens,Human,Tyrosine-protein kinase BTK 96T
U1915h CLIA Agammaglobulinaemia tyrosine kinase,AGMX1,ATK,ATK,B-cell progenitor kinase,BPK,BPK,Bruton tyrosine kinase,BTK,Homo sapiens,Human,Tyrosine-protein kinase BTK 96T
U1915h CLIA kit Agammaglobulinaemia tyrosine kinase,AGMX1,ATK,ATK,B-cell progenitor kinase,BPK,BPK,Bruton tyrosine kinase,BTK,Homo sapiens,Human,Tyrosine-protein kinase BTK 96T
U2227h CLIA BMX,Bone marrow tyrosine kinase gene in chromosome X protein,Cytoplasmic tyrosine-protein kinase BMX,Epithelial and endothelial tyrosine kinase,ETK,Homo sapiens,Human,NTK38 96T
E2227h ELISA BMX,Bone marrow tyrosine kinase gene in chromosome X protein,Cytoplasmic tyrosine-protein kinase BMX,Epithelial and endothelial tyrosine kinase,ETK,Homo sapiens,Human,NTK38 96T
E2227h ELISA kit BMX,Bone marrow tyrosine kinase gene in chromosome X protein,Cytoplasmic tyrosine-protein kinase BMX,Epithelial and endothelial tyrosine kinase,ETK,Homo sapiens,Human,NTK38 96T
U2227h CLIA kit BMX,Bone marrow tyrosine kinase gene in chromosome X protein,Cytoplasmic tyrosine-protein kinase BMX,Epithelial and endothelial tyrosine kinase,ETK,Homo sapiens,Human,NTK38 96T
E2227h BMX,Bone marrow tyrosine kinase gene in chromosome X protein,Cytoplasmic tyrosine-protein kinase BMX,Epithelial and endothelial tyrosine kinase,ETK,Homo sapiens,Human,NTK38
10-782-55014 Cytoplasmic tyrosine-protein kinase BMX - EC 2.7.10.2; Bone marrow tyrosine kinase gene in chromosome X protein; Epithelial and endothelial tyrosine kinase; ETK; NTK38 N_A 0.01 mg
10-782-55014 Cytoplasmic tyrosine-protein kinase BMX - EC 2.7.10.2; Bone marrow tyrosine kinase gene in chromosome X protein; Epithelial and endothelial tyrosine kinase; ETK; NTK38 N_A 0.02 mg
10-782-55014 Cytoplasmic tyrosine-protein kinase BMX - EC 2.7.10.2; Bone marrow tyrosine kinase gene in chromosome X protein; Epithelial and endothelial tyrosine kinase; ETK; NTK38 N_A 0.001 mg
10-782-55014 Cytoplasmic tyrosine-protein kinase BMX - EC 2.7.10.2; Bone marrow tyrosine kinase gene in chromosome X protein; Epithelial and endothelial tyrosine kinase; ETK; NTK38 N_A 0.005 mg
18-661-15209 Tyrosine-protein kinase BTK - EC 2.7.10.2; Bruton tyrosine kinase; Agammaglobulinaemia tyrosine kinase; ATK; B cell progenitor kinase; BPK Polyclonal 0.1 mg
EIAAB13100 EK6,ELK,ELK,EPH tyrosine kinase 2,EPHB1,EPH-like kinase 6,Ephrin type-B receptor 1,EPHT2,hEK6,HEK6,Homo sapiens,Human,NET,NET,Neuronally-expressed EPH-related tyrosine kinase,Tyrosine-protein kinase r
EIAAB13074 Eck,Epha2,Ephrin type-A receptor 2,Epithelial cell kinase,Mouse,Mus musculus,Myk2,Sek2,Tyrosine-protein kinase receptor ECK,Tyrosine-protein kinase receptor MPK-5,Tyrosine-protein kinase receptor SEK-


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur