Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

UDP-glucuronosyltransferase 1-6 (UDPGT 1-6) (UGT1*6) (UGT1-06) (UGT1.6) (EC 2.4.1.17) (Phenol-metabolizing UDP-glucuronosyltransferase) (UDP-glucuronosyltransferase 1-F) (UGT-1F) (UGT1F) (UDP-glucuronosyltransferase 1A6)

 UD16_HUMAN              Reviewed;         532 AA.
P19224; A6NKK6; B8K289; Q96TE7;
01-NOV-1990, integrated into UniProtKB/Swiss-Prot.
11-APR-2003, sequence version 2.
30-AUG-2017, entry version 168.
RecName: Full=UDP-glucuronosyltransferase 1-6;
Short=UDPGT 1-6;
Short=UGT1*6;
Short=UGT1-06;
Short=UGT1.6;
EC=2.4.1.17;
AltName: Full=Phenol-metabolizing UDP-glucuronosyltransferase;
AltName: Full=UDP-glucuronosyltransferase 1-F;
Short=UGT-1F;
Short=UGT1F;
AltName: Full=UDP-glucuronosyltransferase 1A6;
Flags: Precursor;
Name=UGT1A6; Synonyms=GNT1, UGT1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], TISSUE SPECIFICITY, AND VARIANTS
TYR-70 AND PRO-510.
PubMed=1339448;
Ritter J.K., Chen F., Sheen Y.Y., Tran H.M., Kimura S., Yeatman M.T.,
Owens I.S.;
"A novel complex locus UGT1 encodes human bilirubin, phenol, and other
UDP-glucuronosyltransferase isozymes with identical carboxyl
termini.";
J. Biol. Chem. 267:3257-3261(1992).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA].
PubMed=3141926; DOI=10.1073/pnas.85.22.8381;
Harding D., Fournel-Gigleux S., Jackson M.R., Burchell B.;
"Cloning and substrate specificity of a human phenol UDP-
glucuronosyltransferase expressed in COS-7 cells.";
Proc. Natl. Acad. Sci. U.S.A. 85:8381-8385(1988).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
PubMed=11434514; DOI=10.1097/00008571-200106000-00011;
Gong Q.H., Cho J.W., Huang T., Potter C., Gholami N., Basu N.K.,
Kubota S., Carvalho S., Pennington M.W., Owens I.S., Popescu N.C.;
"Thirteen UDP-glucuronosyltransferase genes are encoded at the human
UGT1 gene complex locus.";
Pharmacogenetics 11:357-368(2001).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), AND VARIANTS ALA-181 AND
SER-184.
Guillemette C., Levesque E., Girard H., Bernard O.;
Submitted (JAN-2006) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-488 (ISOFORM 2).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-33.
PubMed=9466822; DOI=10.1006/abbi.1997.0485;
Muenzel P.A., Lehmkoester T., Brueck M., Ritter J.K., Bock K.W.;
"Aryl hydrocarbon receptor-inducible or constitutive expression of
human UDP glucuronosyltransferase UGT1A6.";
Arch. Biochem. Biophys. 350:72-78(1998).
[8]
ALTERNATIVE SPLICING, AND TISSUE SPECIFICITY.
PubMed=18004212; DOI=10.1097/FPC.0b013e3282f1f118;
Girard H., Levesque E., Bellemare J., Journault K., Caillier B.,
Guillemette C.;
"Genetic diversity at the UGT1 locus is amplified by a novel 3'
alternative splicing mechanism leading to nine additional UGT1A
proteins that act as regulators of glucuronidation activity.";
Pharmacogenet. Genomics 17:1077-1089(2007).
[9]
SUBUNIT.
PubMed=20610558; DOI=10.1124/dmd.110.034835;
Bellemare J., Rouleau M., Girard H., Harvey M., Guillemette C.;
"Alternatively spliced products of the UGT1A gene interact with the
enzymatically active proteins to inhibit glucuronosyltransferase
activity in vitro.";
Drug Metab. Dispos. 38:1785-1789(2010).
[10]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[11]
VARIANTS ALA-181 AND SER-184.
PubMed=9429234;
Ciotti M., Marrone A., Potter C., Owens I.S.;
"Genetic polymorphism in the human UGT1A6 (planar phenol) UDP-
glucuronosyltransferase: pharmacological implications.";
Pharmacogenetics 7:485-495(1997).
[12]
VARIANTS ALA-7; ALA-181 AND SER-184.
PubMed=15284531; DOI=10.1097/01.fpc.0000114771.78957.cb;
Nagar S., Zalatoris J.J., Blanchard R.L.;
"Human UGT1A6 pharmacogenetics: identification of a novel SNP,
characterization of allele frequencies and functional analysis of
recombinant allozymes in human liver tissue and in cultured cells.";
Pharmacogenetics 14:487-499(2004).
[13]
VARIANTS ALA-181 AND SER-184.
PubMed=19204906; DOI=10.1002/humu.20946;
Menard V., Girard H., Harvey M., Perusse L., Guillemette C.;
"Analysis of inherited genetic variations at the UGT1 locus in the
French-Canadian population.";
Hum. Mutat. 30:677-687(2009).
-!- FUNCTION: UDPGT is of major importance in the conjugation and
subsequent elimination of potentially toxic xenobiotics and
endogenous compounds. This isoform has specificity for phenols.
Isoform 3 lacks transferase activity but acts as a negative
regulator of isoform 1 (By similarity). {ECO:0000250}.
-!- CATALYTIC ACTIVITY: UDP-glucuronate + acceptor = UDP + acceptor
beta-D-glucuronoside.
-!- SUBUNIT: Isoform 1 interacts with isoform 3/i2 suggesting that
oligomerization is involved in negative regulation of transferase
activity by isoform 3. Isoform 1 also interacts with respective i2
isoforms of UGT1A1, UGT1A3, UGT1A4, UGT1A7, UGT1A8, UGT1A9 and
UGT1A10. {ECO:0000269|PubMed:20610558}.
-!- SUBCELLULAR LOCATION: Microsome. Endoplasmic reticulum membrane
{ECO:0000305}; Single-pass membrane protein {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1; Synonyms=i1;
IsoId=P19224-1; Sequence=Displayed;
Name=2;
IsoId=P19224-2; Sequence=VSP_045779;
Note=No experimental confirmation available.;
Name=3; Synonyms=i2, UGT1A6s;
IsoId=P19224-3; Sequence=VSP_053962;
-!- TISSUE SPECIFICITY: Expressed in skin. Isoforms 1 and 3 are
expressed in kidney and liver. Isoform 1 but not isoform 2 is
expressed in colon, esophagus and small intestine.
{ECO:0000269|PubMed:1339448, ECO:0000269|PubMed:18004212}.
-!- POLYMORPHISM: Polymorphisms in the UGT1A6 gene define four common
haplotypes: UGT1A6*1, UGT1A6*2, UGT1A6*3 and UGT1A6*4. Liver
tissue samples that were homozygous for UGT1A6*2 exhibited a high
rate of glucuronidation relative to tissues with other genotypes.
Biochemical kinetic studies indicate that the UGT1A6*2 allozyme,
expressed homozygously, had almost two-fold greater activity
toward p-nitrophenol than UGT1A6*1 and when expressed
heterozygously (UGT1A6*1/*2) it is associated with low enzyme
activity. Common genetic variation in UGT1A6 confers functionally
significant differences in biochemical phenotype. This genetic
variation might impact clinical efficacy or toxicity of drugs
metabolized by UGT1A6. {ECO:0000269|PubMed:15284531,
ECO:0000269|PubMed:9429234}.
-!- MISCELLANEOUS: The gene is part of the UGT1A complex locus which
displays alternative use of promoters, first exons and terminal
exons. The locus is defined by 13 first exons, which are
alternatively spliced to 3 other common exons and 2 alternative
terminal exons 5. From the 27 possible mRNA isoforms, 9 produce
functionally active polypeptides (UGT1A1, 1A3, 1A4, 1A5, 1A6, 1A7,
1A8, 1A9 and 1A10) called isoforms 1 (i1). Use of an alternative
exon 5 (5b) as terminal exon is leading to 9 additional
alternatively spliced products termed isoforms i2 and which lack
transferase activity.
-!- SIMILARITY: Belongs to the UDP-glycosyltransferase family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BM924331; Type=Erroneous termination; Positions=420; Note=Translated as Glu.; Evidence={ECO:0000305};
Sequence=BM924331; Type=Frameshift; Positions=451, 463; Evidence={ECO:0000305};
Sequence=BM924331; Type=Miscellaneous discrepancy; Note=Probable cloning artifact.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; M84130; AAC41717.1; -; Genomic_DNA.
EMBL; M84124; AAA61247.1; ALT_SEQ; Genomic_DNA.
EMBL; M84122; AAA61247.1; JOINED; Genomic_DNA.
EMBL; M84123; AAA61247.1; JOINED; Genomic_DNA.
EMBL; J04093; AAA61251.1; -; mRNA.
EMBL; AF297093; AAG30420.1; -; Genomic_DNA.
EMBL; DQ364250; ABC96774.1; -; mRNA.
EMBL; AC006985; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC114812; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BM924331; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AF014112; AAB87411.1; -; Genomic_DNA.
CCDS; CCDS2507.1; -. [P19224-1]
CCDS; CCDS2508.1; -. [P19224-2]
PIR; A31340; A31340.
RefSeq; NP_001063.2; NM_001072.3. [P19224-1]
UniGene; Hs.554822; -.
ProteinModelPortal; P19224; -.
BioGrid; 120056; 1.
IntAct; P19224; 7.
STRING; 9606.ENSP00000303174; -.
BindingDB; P19224; -.
ChEMBL; CHEMBL1743316; -.
DrugBank; DB00316; Acetaminophen.
DrugBank; DB08826; Deferiprone.
DrugBank; DB00688; Mycophenolate mofetil.
DrugBank; DB01024; Mycophenolic acid.
DrugBank; DB00818; Propofol.
DrugBank; DB00197; Troglitazone.
DrugBank; DB00313; Valproic Acid.
CAZy; GT1; Glycosyltransferase Family 1.
iPTMnet; P19224; -.
PhosphoSitePlus; P19224; -.
BioMuta; UGT1A6; -.
DMDM; 29840832; -.
EPD; P19224; -.
PaxDb; P19224; -.
PeptideAtlas; P19224; -.
PRIDE; P19224; -.
DNASU; 54578; -.
Ensembl; ENST00000305139; ENSP00000303174; ENSG00000167165. [P19224-1]
Ensembl; ENST00000373424; ENSP00000362523; ENSG00000167165. [P19224-2]
GeneID; 54578; -.
KEGG; hsa:54578; -.
UCSC; uc002vuu.4; human. [P19224-1]
CTD; 54578; -.
DisGeNET; 54578; -.
GeneCards; UGT1A6; -.
HGNC; HGNC:12538; UGT1A6.
HPA; CAB009819; -.
HPA; HPA054065; -.
MIM; 191740; gene.
MIM; 606431; gene.
neXtProt; NX_P19224; -.
OpenTargets; ENSG00000167165; -.
PharmGKB; PA37181; -.
eggNOG; KOG1192; Eukaryota.
eggNOG; COG1819; LUCA.
GeneTree; ENSGT00760000118949; -.
HOGENOM; HOG000220832; -.
HOVERGEN; HBG004033; -.
InParanoid; P19224; -.
KO; K00699; -.
OMA; ESKHYTR; -.
OrthoDB; EOG091G06JC; -.
PhylomeDB; P19224; -.
TreeFam; TF315472; -.
BRENDA; 2.4.1.17; 2681.
Reactome; R-HSA-156588; Glucuronidation.
SABIO-RK; P19224; -.
GeneWiki; UGT1A6; -.
GenomeRNAi; 54578; -.
PRO; PR:P19224; -.
Proteomes; UP000005640; Chromosome 2.
Bgee; ENSG00000167165; -.
ExpressionAtlas; P19224; baseline and differential.
Genevisible; P19224; HS.
GO; GO:0005783; C:endoplasmic reticulum; IDA:UniProtKB.
GO; GO:0005789; C:endoplasmic reticulum membrane; TAS:Reactome.
GO; GO:0070062; C:extracellular exosome; IDA:UniProtKB.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0019899; F:enzyme binding; IPI:BHF-UCL.
GO; GO:0015020; F:glucuronosyltransferase activity; IDA:UniProtKB.
GO; GO:0046982; F:protein heterodimerization activity; IDA:UniProtKB.
GO; GO:0042803; F:protein homodimerization activity; IDA:UniProtKB.
GO; GO:0052695; P:cellular glucuronidation; IDA:UniProtKB.
GO; GO:0052696; P:flavonoid glucuronidation; IBA:GO_Central.
GO; GO:2001030; P:negative regulation of cellular glucuronidation; ISS:BHF-UCL.
GO; GO:0045922; P:negative regulation of fatty acid metabolic process; ISS:BHF-UCL.
GO; GO:1904224; P:negative regulation of glucuronosyltransferase activity; ISS:BHF-UCL.
GO; GO:0052697; P:xenobiotic glucuronidation; IBA:GO_Central.
GO; GO:0006805; P:xenobiotic metabolic process; IDA:UniProtKB.
InterPro; IPR002213; UDP_glucos_trans.
InterPro; IPR035595; UDP_glycos_trans_CS.
PANTHER; PTHR11926; PTHR11926; 1.
Pfam; PF00201; UDPGT; 1.
PROSITE; PS00375; UDPGT; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Endoplasmic reticulum;
Glycoprotein; Glycosyltransferase; Membrane; Microsome; Polymorphism;
Reference proteome; Signal; Transferase; Transmembrane;
Transmembrane helix.
SIGNAL 1 26 {ECO:0000255}.
CHAIN 27 532 UDP-glucuronosyltransferase 1-6.
/FTId=PRO_0000036005.
TRANSMEM 490 506 Helical. {ECO:0000255}.
CARBOHYD 294 294 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 346 346 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 267 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_045779.
VAR_SEQ 434 532 SYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLR
PAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRK
CLGKKGRVKKAHKSKTH -> RKKQQSGRQM (in
isoform 3). {ECO:0000303|Ref.4}.
/FTId=VSP_053962.
VARIANT 7 7 S -> A (in allele UGT1A6*2, allele
UGT1A6*3 and allele UGT1A6*4;
dbSNP:rs6759892).
{ECO:0000269|PubMed:15284531}.
/FTId=VAR_024685.
VARIANT 70 70 S -> Y (in dbSNP:rs1042708).
{ECO:0000269|PubMed:1339448}.
/FTId=VAR_026628.
VARIANT 181 181 T -> A (in allele UGT1A6*2;
dbSNP:rs2070959).
{ECO:0000269|PubMed:15284531,
ECO:0000269|PubMed:19204906,
ECO:0000269|PubMed:9429234,
ECO:0000269|Ref.4}.
/FTId=VAR_014784.
VARIANT 184 184 R -> S (in allele UGT1A6*2 and allele
UGT1A6*4; dbSNP:rs1105879).
{ECO:0000269|PubMed:15284531,
ECO:0000269|PubMed:19204906,
ECO:0000269|PubMed:9429234,
ECO:0000269|Ref.4}.
/FTId=VAR_015559.
VARIANT 510 510 A -> P (in dbSNP:rs1042709).
{ECO:0000269|PubMed:1339448}.
/FTId=VAR_026629.
CONFLICT 231 231 E -> K (in Ref. 1; AAA61251).
{ECO:0000305}.
CONFLICT 247 249 YQK -> SE (in Ref. 1; AAA61251).
{ECO:0000305}.
CONFLICT 328 328 I -> N (in Ref. 1; AAA61251).
{ECO:0000305}.
CONFLICT 419 419 S -> F (in Ref. 6; BM924331).
{ECO:0000305}.
CONFLICT 446 446 H -> S (in Ref. 6; BM924331).
{ECO:0000305}.
CONFLICT 468 468 K -> Q (in Ref. 6; BM924331).
{ECO:0000305}.
CONFLICT 476 477 AA -> GS (in Ref. 6; BM924331).
{ECO:0000305}.
CONFLICT 514 514 R -> P (in Ref. 1; AAA61251).
{ECO:0000305}.
SEQUENCE 532 AA; 60751 MW; 4A9EA6A88CBC3136 CRC64;
MACLLRSFQR ISAGVFFLAL WGMVVGDKLL VVPQDGSHWL SMKDIVEVLS DRGHEIVVVV
PEVNLLLKES KYYTRKIYPV PYDQEELKNR YQSFGNNHFA ERSFLTAPQT EYRNNMIVIG
LYFINCQSLL QDRDTLNFFK ESKFDALFTD PALPCGVILA EYLGLPSVYL FRGFPCSLEH
TFSRSPDPVS YIPRCYTKFS DHMTFSQRVA NFLVNLLEPY LFYCLFSKYE ELASAVLKRD
VDIITLYQKV SVWLLRYDFV LEYPRPVMPN MVFIGGINCK KRKDLSQEFE AYINASGEHG
IVVFSLGSMV SEIPEKKAMA IADALGKIPQ TVLWRYTGTR PSNLANNTIL VKWLPQNDLL
GHPMTRAFIT HAGSHGVYES ICNGVPMVMM PLFGDQMDNA KRMETKGAGV TLNVLEMTSE
DLENALKAVI NDKSYKENIM RLSSLHKDRP VEPLDLAVFW VEFVMRHKGA PHLRPAAHDL
TWYQYHSLDV IGFLLAVVLT VAFITFKCCA YGYRKCLGKK GRVKKAHKSK TH


Related products :

Catalog number Product name Quantity
EIAAB45210 GNT1,Homo sapiens,Human,Phenol-metabolizing UDP-glucuronosyltransferase,UDP-glucuronosyltransferase 1-6,UDP-glucuronosyltransferase 1A6,UDP-glucuronosyltransferase 1-F,UDPGT 1-6,UGT1,UGT1*6,UGT1.6,UGT
EIAAB45199 GNT1,Homo sapiens,Human,UDP-glucuronosyltransferase 1-10,UDP-glucuronosyltransferase 1A10,UDP-glucuronosyltransferase 1-J,UDPGT 1-10,UGT1,UGT1*10,UGT1.10,UGT1-10,UGT1A10,UGT1J,UGT-1J
EIAAB45218 GNT1,Homo sapiens,Human,lugP4,UDP-glucuronosyltransferase 1-9,UDP-glucuronosyltransferase 1A9,UDP-glucuronosyltransferase 1-I,UDPGT 1-9,UGT1,UGT1*9,UGT1.9,UGT1-09,UGT1A9,UGT1I,UGT-1I
EIAAB45196 Bilirubin-specific UDPGT isozyme 1,GNT1,Homo sapiens,hUG-BR1,Human,UDP-glucuronosyltransferase 1-1,UDP-glucuronosyltransferase 1-A,UDP-glucuronosyltransferase 1A1,UDPGT 1-1,UGT1,UGT1*1,UGT1.1,UGT1-01,
EIAAB45204 Bilirubin-specific UDPGT isozyme 2,GNT1,Homo sapiens,hUG-BR2,Human,UDP-glucuronosyltransferase 1-4,UDP-glucuronosyltransferase 1A4,UDP-glucuronosyltransferase 1-D,UDPGT 1-4,UGT1,UGT1*4,UGT1.4,UGT1-04,
EIAAB45207 GNT1,Homo sapiens,Human,UDP-glucuronosyltransferase 1-5,UDP-glucuronosyltransferase 1A5,UDP-glucuronosyltransferase 1-E,UDPGT 1-5,UGT1,UGT1*5,UGT1.5,UGT1-05,UGT1A5,UGT1E,UGT-1E
EIAAB45212 GNT1,Homo sapiens,Human,UDP-glucuronosyltransferase 1-7,UDP-glucuronosyltransferase 1A7,UDP-glucuronosyltransferase 1-G,UDPGT 1-7,UGT1,UGT1*7,UGT1.7,UGT1-07,UGT1A7,UGT1G,UGT-1G
EIAAB45203 GNT1,Homo sapiens,Human,UDP-glucuronosyltransferase 1-3,UDP-glucuronosyltransferase 1A3,UDP-glucuronosyltransferase 1-C,UDPGT 1-3,UGT1,UGT1*3,UGT1.3,UGT1-03,UGT1A3,UGT1C,UGT-1C
EIAAB45215 GNT1,Homo sapiens,Human,UDP-glucuronosyltransferase 1-8,UDP-glucuronosyltransferase 1A8,UDP-glucuronosyltransferase 1-H,UDPGT 1-8,UGT1,UGT1*8,UGT1.8,UGT1-08,UGT1A8,UGT1H,UGT-1H
EIAAB45208 Mouse,Mus musculus,Phenol UDP-glucuronosyltransferase,UDP-glucuronosyltransferase 1-6,UDPGT 1-6,UGP1A1,Ugt1,UGT1*6,UGT1.6,UGT1-06,UGT1A6,Ugt1a6,Ugt1a6a
EIAAB45197 Mouse,Mus musculus,UDP-glucuronosyltransferase 1-1,UDP-glucuronosyltransferase 1A1,UDPGT 1-1,Ugt1,UGT1*1,UGT1.1,UGT1-01,Ugt1a1,UGTBR1
EIAAB45198 B1,Rat,Rattus norvegicus,UDP-glucuronosyltransferase 1-1,UDP-glucuronosyltransferase 1A1,UDPGT 1-1,Ugt1,UGT1*1,UGT1.1,UGT1-01,Ugt1a1
EIAAB45217 Mouse,Mus musculus,UDP-glucuronosyltransferase 1-7,UDP-glucuronosyltransferase 1-9,UDPGT,UDPGT 1-9,Ugt1,UGT1*9,UGT1.9,UGT1-09,UGT1A12,Ugt1a12,Ugt1a9,UGTP4
EIAAB45209 Oryctolagus cuniculus,Rabbit,UDP-glucuronosyltransferase 1-6,UDPGT 1-6,UGT1,UGT1*6,UGT1.6,UGT1-06,UGT1A6
EIAAB45205 Oryctolagus cuniculus,Rabbit,UDP-glucuronosyltransferase 1-4,UDPGT 1-4,UGT1,UGT1*4,UGT1.4,UGT1-04,UGT1A4
EIAAB45211 A1,P-nitrophenol-specific UDPGT,Rat,Rattus norvegicus,UDP-glucuronosyltransferase 1-6,UDPGT 1-6,Ugt1,UGT1*6,UGT1.6,UGT1-06,UGT1A6
EIAAB45200 Bilirubin-specific UDPGT,Mouse,Mus musculus,UDP-glucuronosyltransferase 1-2,UDPGT 1-2,Ugt1,UGT1*2,UGT1.2,UGT1-02,UGT1A2
EIAAB45201 B2,Bilirubin-specific UDPGT,Rat,Rattus norvegicus,UDP-glucuronosyltransferase 1-2,UDPGT 1-2,Ugt1,UGT1*2,UGT1.2,UGT1-02,UGT1A2
EIAAB45202 B3,Rat,Rattus norvegicus,UDP-glucuronosyltransferase 1-3,UDPGT 1-3,Ugt1,UGT1*3,UGT1.3,UGT1-03,UGT1A3
EIAAB45213 A2,Rat,Rattus norvegicus,UDP-glucuronosyltransferase 1-7,UDPGT 1-7,Ugt1,UGT1*7,UGT1.7,UGT1-07,UGT1A7
EIAAB45216 A3,Rat,Rattus norvegicus,UDP-glucuronosyltransferase 1-8,UDPGT 1-8,Ugt1,UGT1*8,UGT1.8,UGT1-08,UGT1A8
EIAAB45206 B5,Rat,Rattus norvegicus,UDP-glucuronosyltransferase 1-5,UDPGT 1-5,Ugt1,UGT1*5,UGT1.5,UGT1-05,UGT1A5
EIAAB45214 Mouse,Mus musculus,UDP-glucuronosyltransferase 1-7C,UDPGT 1-7C,UGT1*7C,UGT1.7C,UGT1-07C,UGT1A10,Ugt1a10,Ugt1a7c
UD13_RAT ELISA Kit FOR UDP-glucuronosyltransferase 1-3; organism: Rat; gene name: Ugt1 96T
UD12_RAT ELISA Kit FOR UDP-glucuronosyltransferase 1-2; organism: Rat; gene name: Ugt1 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur