Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Uncharacterized protein C1orf109

 CA109_HUMAN             Reviewed;         203 AA.
Q9NX04; D3DPT1; Q8WVD1;
06-FEB-2007, integrated into UniProtKB/Swiss-Prot.
01-OCT-2000, sequence version 1.
18-JUL-2018, entry version 108.
RecName: Full=Uncharacterized protein C1orf109 {ECO:0000305};
Name=C1orf109 {ECO:0000312|HGNC:HGNC:26039};
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Uterus;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
FUNCTION, SUBCELLULAR LOCATION, MUTAGENESIS OF SER-104; SER-134 AND
SER-182, AND PHOSPHORYLATION BY CK2.
PubMed=22548824; DOI=10.1186/1423-0127-19-49;
Liu S.S., Zheng H.X., Jiang H.D., He J., Yu Y., Qu Y.P., Yue L.,
Zhang Y., Li Y.;
"Identification and characterization of a novel gene, c1orf109,
encoding a CK2 substrate that is involved in cancer cell
proliferation.";
J. Biomed. Sci. 19:49-49(2012).
-!- FUNCTION: May promote cancer cell proliferation by controlling the
G1 to S phase transition. {ECO:0000269|PubMed:22548824}.
-!- INTERACTION:
Q08117:AES; NbExp=3; IntAct=EBI-8643161, EBI-717810;
Q6P1W5:C1orf94; NbExp=3; IntAct=EBI-8643161, EBI-946029;
Q8IYA8:CCDC36; NbExp=5; IntAct=EBI-8643161, EBI-8638439;
Q53EZ4:CEP55; NbExp=5; IntAct=EBI-8643161, EBI-747776;
Q9BW66:CINP; NbExp=9; IntAct=EBI-8643161, EBI-739784;
O43186:CRX; NbExp=3; IntAct=EBI-8643161, EBI-748171;
Q08379:GOLGA2; NbExp=3; IntAct=EBI-8643161, EBI-618309;
Q13422:IKZF1; NbExp=3; IntAct=EBI-8643161, EBI-745305;
Q9UKT9:IKZF3; NbExp=5; IntAct=EBI-8643161, EBI-747204;
Q9BW62:KATNAL1; NbExp=5; IntAct=EBI-8643161, EBI-743591;
Q9BVG8:KIFC3; NbExp=4; IntAct=EBI-8643161, EBI-2125614;
A1A4E9:KRT13; NbExp=3; IntAct=EBI-8643161, EBI-10171552;
P08727:KRT19; NbExp=5; IntAct=EBI-8643161, EBI-742756;
Q15323:KRT31; NbExp=5; IntAct=EBI-8643161, EBI-948001;
Q6A162:KRT40; NbExp=3; IntAct=EBI-8643161, EBI-10171697;
O95751:LDOC1; NbExp=3; IntAct=EBI-8643161, EBI-740738;
Q9BRK4:LZTS2; NbExp=5; IntAct=EBI-8643161, EBI-741037;
P50222:MEOX2; NbExp=3; IntAct=EBI-8643161, EBI-748397;
Q9H000:MKRN2; NbExp=3; IntAct=EBI-8643161, EBI-2341005;
Q5JR59:MTUS2; NbExp=3; IntAct=EBI-8643161, EBI-742948;
Q7Z6G3-2:NECAB2; NbExp=5; IntAct=EBI-8643161, EBI-10172876;
Q5VU43:PDE4DIP; NbExp=3; IntAct=EBI-8643161, EBI-1105124;
Q8IXK0:PHC2; NbExp=3; IntAct=EBI-8643161, EBI-713786;
O00444:PLK4; NbExp=3; IntAct=EBI-8643161, EBI-746202;
Q9BZL4-5:PPP1R12C; NbExp=3; IntAct=EBI-8643161, EBI-10289057;
Q04864:REL; NbExp=3; IntAct=EBI-8643161, EBI-307352;
Q6NUQ1:RINT1; NbExp=5; IntAct=EBI-8643161, EBI-726876;
Q9H4P4:RNF41; NbExp=5; IntAct=EBI-8643161, EBI-2130266;
O00560:SDCBP; NbExp=3; IntAct=EBI-8643161, EBI-727004;
Q96R06:SPAG5; NbExp=3; IntAct=EBI-8643161, EBI-413317;
Q8NA61:SPERT; NbExp=3; IntAct=EBI-8643161, EBI-741724;
O75558:STX11; NbExp=5; IntAct=EBI-8643161, EBI-714135;
O75478:TADA2A; NbExp=5; IntAct=EBI-8643161, EBI-742268;
Q99081:TCF12; NbExp=3; IntAct=EBI-8643161, EBI-722877;
P15884:TCF4; NbExp=3; IntAct=EBI-8643161, EBI-533224;
Q9UBB9:TFIP11; NbExp=5; IntAct=EBI-8643161, EBI-1105213;
Q13077:TRAF1; NbExp=5; IntAct=EBI-8643161, EBI-359224;
Q8IWZ5:TRIM42; NbExp=3; IntAct=EBI-8643161, EBI-5235829;
Q9BYV2:TRIM54; NbExp=5; IntAct=EBI-8643161, EBI-2130429;
Q8N6Y0:USHBP1; NbExp=3; IntAct=EBI-8643161, EBI-739895;
Q8N1B4:VPS52; NbExp=5; IntAct=EBI-8643161, EBI-2799833;
O96006:ZBED1; NbExp=6; IntAct=EBI-8643161, EBI-740037;
Q8TD17:ZNF398; NbExp=4; IntAct=EBI-8643161, EBI-8643207;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:22548824}.
Cytoplasm {ECO:0000269|PubMed:22548824}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9NX04-1; Sequence=Displayed;
Name=2;
IsoId=Q9NX04-2; Sequence=VSP_022733, VSP_022734;
-!- PTM: Phosphorylated on serines by CK2 kinase.
{ECO:0000269|PubMed:22548824}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AK000515; BAA91221.1; -; mRNA.
EMBL; CH471059; EAX07327.1; -; Genomic_DNA.
EMBL; CH471059; EAX07329.1; -; Genomic_DNA.
EMBL; CH471059; EAX07330.1; -; Genomic_DNA.
EMBL; BC018109; AAH18109.1; -; mRNA.
EMBL; BC063843; AAH63843.1; -; mRNA.
CCDS; CCDS423.1; -. [Q9NX04-1]
RefSeq; NP_001289959.1; NM_001303030.1.
RefSeq; NP_001289960.1; NM_001303031.1.
RefSeq; NP_060320.1; NM_017850.2. [Q9NX04-1]
RefSeq; XP_016857035.1; XM_017001546.1.
RefSeq; XP_016857036.1; XM_017001547.1.
RefSeq; XP_016857040.1; XM_017001551.1.
RefSeq; XP_016857041.1; XM_017001552.1.
RefSeq; XP_016857042.1; XM_017001553.1.
RefSeq; XP_016857043.1; XM_017001554.1.
RefSeq; XP_016857044.1; XM_017001555.1.
RefSeq; XP_016857045.1; XM_017001556.1. [Q9NX04-1]
UniGene; Hs.272673; -.
UniGene; Hs.733219; -.
ProteinModelPortal; Q9NX04; -.
BioGrid; 120293; 51.
IntAct; Q9NX04; 139.
MINT; Q9NX04; -.
iPTMnet; Q9NX04; -.
PhosphoSitePlus; Q9NX04; -.
BioMuta; C1orf109; -.
DMDM; 74761780; -.
EPD; Q9NX04; -.
MaxQB; Q9NX04; -.
PaxDb; Q9NX04; -.
PeptideAtlas; Q9NX04; -.
PRIDE; Q9NX04; -.
ProteomicsDB; 83013; -.
ProteomicsDB; 83014; -. [Q9NX04-2]
DNASU; 54955; -.
Ensembl; ENST00000358011; ENSP00000350704; ENSG00000116922. [Q9NX04-1]
Ensembl; ENST00000464085; ENSP00000477159; ENSG00000116922. [Q9NX04-1]
Ensembl; ENST00000494120; ENSP00000477273; ENSG00000116922. [Q9NX04-2]
GeneID; 54955; -.
KEGG; hsa:54955; -.
UCSC; uc001cbn.4; human. [Q9NX04-1]
CTD; 54955; -.
DisGeNET; 54955; -.
EuPathDB; HostDB:ENSG00000116922.14; -.
GeneCards; C1orf109; -.
HGNC; HGNC:26039; C1orf109.
HPA; HPA027110; -.
HPA; HPA027127; -.
MIM; 614799; gene.
neXtProt; NX_Q9NX04; -.
OpenTargets; ENSG00000116922; -.
PharmGKB; PA142672493; -.
eggNOG; ENOG410IGVE; Eukaryota.
eggNOG; ENOG41127GW; LUCA.
GeneTree; ENSGT00390000008551; -.
HOVERGEN; HBG080964; -.
InParanoid; Q9NX04; -.
OMA; CFPVVEE; -.
OrthoDB; EOG091G0KY0; -.
PhylomeDB; Q9NX04; -.
TreeFam; TF332524; -.
ChiTaRS; C1orf109; human.
GeneWiki; C1orf109_(gene); -.
GenomeRNAi; 54955; -.
PRO; PR:Q9NX04; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000116922; -.
CleanEx; HS_C1orf109; -.
ExpressionAtlas; Q9NX04; baseline and differential.
Genevisible; Q9NX04; HS.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
InterPro; IPR029159; CK2S.
Pfam; PF15011; CK2S; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm; Nucleus;
Phosphoprotein; Reference proteome.
CHAIN 1 203 Uncharacterized protein C1orf109.
/FTId=PRO_0000274382.
VAR_SEQ 75 113 RKQLVAGDIVLDKLGERLAILLKVRDMVSSHVERVFQIY
-> QPSSSRCETWSAAMWSECFRSMSNTQTQLALMLSCSLQ
Q (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_022733.
VAR_SEQ 114 203 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_022734.
MUTAGEN 104 104 S->A: Abolishes phosphorylation by CK2
kinase; when associated with A-134 and A-
182. {ECO:0000269|PubMed:22548824}.
MUTAGEN 134 134 S->A: Abolishes phosphorylation by CK2
kinase; when associated with A-104 and A-
182. {ECO:0000269|PubMed:22548824}.
MUTAGEN 182 182 S->A: Abolishes phosphorylation by CK2
kinase; when associated with A-104 and A-
134. {ECO:0000269|PubMed:22548824}.
SEQUENCE 203 AA; 23373 MW; CBD3883CB1A2C281 CRC64;
MTQDRPLLAV QEALKKCFPV VEEQQGLWQS ALRDCQPLLS SLSNLAEQLQ AAQNLRFEDV
PALRAFPDLK ERLRRKQLVA GDIVLDKLGE RLAILLKVRD MVSSHVERVF QIYEQHADTV
GIDAVLQPSA VSPSVADMLE WLQDIERHYR KSYLKRKYLL SSIQWGDLAN IQALPKAWDR
ISKDEHQDLV QDILLNVSFF LEE


Related products :

Catalog number Product name Quantity
EIAAB04891 C1orf109,Homo sapiens,Human,Uncharacterized protein C1orf109
CSB-EL003500HU Human Uncharacterized protein C1orf109(C1orf109) ELISA kit SpeciesHuman 96T
I0902 Uncharacterized protein C1orf109 (C1orf109), Human, ELISA Kit 96T
CSB-EL003500HU Human Uncharacterized protein C1orf109(C1orf109) ELISA kit 96T
EIAAB08798 C16orf11,Homo sapiens,Human,Uncharacterized protein C16orf11,Uncharacterized protein RJD1
002819A C1orf109 250ul
i002218b C1orf109 siRNA_Lentivectors 500ng
i002218 C1orf109-set siRNA_Lentivectors 4x500ng
i002218c C1orf109 siRNA_Lentivectors 500ng
i002218a C1orf109 siRNA_Lentivectors 500ng
i002218d C1orf109 siRNA_Lentivectors 500ng
AP5465b C1orf109 Antibody (C_term) 0.1 mg
NBL1-08292 C1orf109 Lysate 0.1 mg
AP5465b C1orf109 Antibody (C-term)
AP5465b-ev20 C1orf109 Antibody (C-term)
GWB-40F44E C1orf109 Over-expression Lysate Product
MT-h02060 C1orf109 3&_39;UTR Lenti-reporter-Luc Vector 1ug
BP5465b C1orf109 Antibody (C_term) Blocking peptide 0.1 mg
BP5465b C1orf109 Antibody (C-term) Blocking peptide 2
bs-15005R Rabbit Anti-C1orf109 Polyclonal Antibody 100ul
EIAAB10060 CXorf52,Homo sapiens,Human,LINC00204A,NCRNA00204,Putative uncharacterized protein CXorf52,Putative uncharacterized protein encoded by LINC00204A,SPCX
bs-15005R-Cy3 Rabbit Anti-C1orf109 Polyclonal Antibody, Cy3 Conjugated 100ul
C1orf109 C1orf106 Gene chromosome 1 open reading frame 106
C1orf111 C1orf109 Gene chromosome 1 open reading frame 109
bs-15005R-Cy5.5 Rabbit Anti-C1orf109 Polyclonal Antibody, Cy5.5 Conjugated 100ul


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur