Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Uroplakin-1a (UP1a) (Tetraspanin-21) (Tspan-21) (Uroplakin Ia) (UPIa) (UPKa)

 UPK1A_HUMAN             Reviewed;         258 AA.
O00322; Q3KNU5; Q3KNU6;
01-NOV-1997, integrated into UniProtKB/Swiss-Prot.
01-JUL-1997, sequence version 1.
05-DEC-2018, entry version 140.
RecName: Full=Uroplakin-1a;
Short=UP1a;
AltName: Full=Tetraspanin-21;
Short=Tspan-21;
AltName: Full=Uroplakin Ia;
Short=UPIa;
Short=UPKa;
Name=UPK1A; Synonyms=TSPAN21;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057824; DOI=10.1038/nature02399;
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J.,
Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M.,
Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E.,
Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M.,
Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C.,
Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M.,
Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T.,
Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H.,
Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S.,
Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J.,
Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M.,
Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J.,
Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D.,
Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A.,
Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I.,
Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
Rubin E.M., Lucas S.M.;
"The DNA sequence and biology of human chromosome 19.";
Nature 428:529-535(2004).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), AND VARIANT
THR-257.
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[3]
NUCLEOTIDE SEQUENCE [MRNA] OF 3-258 (ISOFORM 1), AND TISSUE
SPECIFICITY.
TISSUE=Ureter;
PubMed=15913809; DOI=10.1016/j.bbaexp.2005.04.004;
Hall G.D., Weeks R.J., Olsburgh J., Southgate J., Knowles M.A.,
Selby P.J., Chester J.D.;
"Transcriptional control of the human urothelial-specific gene,
uroplakin Ia.";
Biochim. Biophys. Acta 1729:126-134(2005).
[4]
TISSUE SPECIFICITY.
PubMed=9846985; DOI=10.1016/S0002-9440(10)65709-4;
Lobban E.D., Smith B.A., Hall G.D., Harnden P., Roberts P.,
Selby P.J., Trejdosiewicz L.K., Southgate J.;
"Uroplakin gene expression by normal and neoplastic human
urothelium.";
Am. J. Pathol. 153:1957-1967(1998).
-!- FUNCTION: Component of the asymmetric unit membrane (AUM); a
highly specialized biomembrane elaborated by terminally
differentiated urothelial cells. May play an important role in
normal bladder epithelial physiology, possibly in regulating
membrane permeability of superficial umbrella cells or in
stabilizing the apical membrane through AUM/cytoskeletal
interactions (By similarity). {ECO:0000250}.
-!- SUBUNIT: Homodimer; disulfide-linked. Interacts with uroplakin-2
(UPK2) (By similarity). {ECO:0000250}.
-!- INTERACTION:
P08191:fimH (xeno); NbExp=2; IntAct=EBI-14031976, EBI-1028015;
P35247:SFTPD; NbExp=3; IntAct=EBI-14031976, EBI-11316157;
-!- SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=O00322-1; Sequence=Displayed;
Name=2;
IsoId=O00322-2; Sequence=VSP_030005;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: High expression restricted to ureteric
urothelium (most superficial cells); low expression in prostate.
Expression in normal urothelial cells is lost in culture. Some
expression in tumor cell lines derived from urothelial
malignancies. {ECO:0000269|PubMed:15913809,
ECO:0000269|PubMed:9846985}.
-!- SIMILARITY: Belongs to the tetraspanin (TM4SF) family.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AC002115; AAB57631.1; -; Genomic_DNA.
EMBL; AC002314; AAB62736.1; -; Genomic_DNA.
EMBL; BC107097; AAI07098.1; -; mRNA.
EMBL; BC107098; AAI07099.1; -; mRNA.
EMBL; AF085807; AAC34887.1; -; mRNA.
CCDS; CCDS12470.1; -. [O00322-1]
CCDS; CCDS62640.1; -. [O00322-2]
RefSeq; NP_001268372.1; NM_001281443.1. [O00322-2]
RefSeq; NP_008931.1; NM_007000.3. [O00322-1]
UniGene; Hs.159309; -.
ProteinModelPortal; O00322; -.
BioGrid; 116233; 88.
IntAct; O00322; 2.
STRING; 9606.ENSP00000222275; -.
TCDB; 8.A.40.7.1; the tetraspanin (tetraspanin) family.
BioMuta; UPK1A; -.
PaxDb; O00322; -.
PeptideAtlas; O00322; -.
PRIDE; O00322; -.
ProteomicsDB; 47838; -.
ProteomicsDB; 47839; -. [O00322-2]
Ensembl; ENST00000222275; ENSP00000222275; ENSG00000105668. [O00322-1]
Ensembl; ENST00000379013; ENSP00000368298; ENSG00000105668. [O00322-2]
Ensembl; ENST00000616789; ENSP00000478942; ENSG00000105668. [O00322-2]
Ensembl; ENST00000617999; ENSP00000483176; ENSG00000105668. [O00322-1]
GeneID; 11045; -.
KEGG; hsa:11045; -.
UCSC; uc002oaw.5; human. [O00322-1]
CTD; 11045; -.
DisGeNET; 11045; -.
EuPathDB; HostDB:ENSG00000105668.7; -.
GeneCards; UPK1A; -.
H-InvDB; HIX0202895; -.
HGNC; HGNC:12577; UPK1A.
HPA; HPA049879; -.
MIM; 611557; gene.
neXtProt; NX_O00322; -.
OpenTargets; ENSG00000105668; -.
PharmGKB; PA37209; -.
eggNOG; KOG3882; Eukaryota.
eggNOG; ENOG4111IRY; LUCA.
GeneTree; ENSGT00940000160881; -.
HOGENOM; HOG000230653; -.
HOVERGEN; HBG054305; -.
InParanoid; O00322; -.
KO; K17347; -.
OMA; RSMILTY; -.
OrthoDB; EOG091G0G8N; -.
PhylomeDB; O00322; -.
TreeFam; TF335659; -.
GeneWiki; UPK1A; -.
GenomeRNAi; 11045; -.
PRO; PR:O00322; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000105668; Expressed in 82 organ(s), highest expression level in urinary bladder.
CleanEx; HS_UPK1A; -.
Genevisible; O00322; HS.
GO; GO:0120001; C:apical plasma membrane urothelial plaque; IEA:Ensembl.
GO; GO:0009986; C:cell surface; IDA:AgBase.
GO; GO:0005783; C:endoplasmic reticulum; ISS:UniProtKB.
GO; GO:0070062; C:extracellular exosome; HDA:UniProtKB.
GO; GO:0016021; C:integral component of membrane; ISS:UniProtKB.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0005886; C:plasma membrane; ISS:UniProtKB.
GO; GO:0042803; F:protein homodimerization activity; ISS:UniProtKB.
GO; GO:0007166; P:cell surface receptor signaling pathway; IBA:GO_Central.
GO; GO:0030855; P:epithelial cell differentiation; IDA:UniProtKB.
GO; GO:0051259; P:protein complex oligomerization; ISS:UniProtKB.
InterPro; IPR000301; Tetraspanin.
InterPro; IPR018499; Tetraspanin/Peripherin.
InterPro; IPR008952; Tetraspanin_EC2_sf.
InterPro; IPR034765; Uroplakin-1a.
PANTHER; PTHR19282:SF25; PTHR19282:SF25; 1.
Pfam; PF00335; Tetraspanin; 1.
PIRSF; PIRSF002419; Tetraspanin; 1.
PRINTS; PR00259; TMFOUR.
SUPFAM; SSF48652; SSF48652; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Disulfide bond; Glycoprotein;
Membrane; Polymorphism; Reference proteome; Transmembrane;
Transmembrane helix.
CHAIN 1 258 Uroplakin-1a.
/FTId=PRO_0000219286.
TOPO_DOM 1 14 Cytoplasmic. {ECO:0000255}.
TRANSMEM 15 35 Helical. {ECO:0000255}.
TOPO_DOM 36 59 Extracellular. {ECO:0000255}.
TRANSMEM 60 86 Helical. {ECO:0000255}.
TOPO_DOM 87 91 Cytoplasmic. {ECO:0000255}.
TRANSMEM 92 112 Helical. {ECO:0000255}.
TOPO_DOM 113 230 Extracellular. {ECO:0000255}.
TRANSMEM 231 252 Helical. {ECO:0000255}.
TOPO_DOM 253 258 Cytoplasmic. {ECO:0000255}.
CARBOHYD 170 170 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 217 258 GCFEHIGHAIDSYTWGISWFGFAILMWTLPVMLIAMYFYTM
L -> AGVQWHNLSSLQRLPPGFKGFSHLSFQSSWDYRAAS
NTSATPSTATRGVSRGLGLPS (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_030005.
VARIANT 33 33 S -> A (in dbSNP:rs2267586).
/FTId=VAR_052332.
VARIANT 257 257 M -> T (in dbSNP:rs2285421).
{ECO:0000269|PubMed:15489334}.
/FTId=VAR_020094.
SEQUENCE 258 AA; 28879 MW; 79AF29E0DAEC4E44 CRC64;
MASAAAAEAE KGSPVVVGLL VVGNIIILLS GLSLFAETIW VTADQYRVYP LMGVSGKDDV
FAGAWIAIFC GFSFFMVASF GVGAALCRRR SMVLTYLVLM LIVYIFECAS CITSYTHRDY
MVSNPSLITK QMLTFYSADT DQGQELTRLW DRVMIEQECC GTSGPMDWVN FTSAFRAATP
EVVFPWPPLC CRRTGNFIPL NEEGCRLGHM DYLFTKGCFE HIGHAIDSYT WGISWFGFAI
LMWTLPVMLI AMYFYTML


Related products :

Catalog number Product name Quantity
EIAAB45384 Homo sapiens,Human,Tetraspanin-21,TSPAN21,Tspan-21,UP1a,UPIa,UPK1A,UPKa,Uroplakin Ia,Uroplakin-1a
EIAAB45385 Mouse,Mus musculus,UP1a,UPIa,Upk1a,UPKa,Uroplakin Ia,Uroplakin-1a
EIAAB45386 Bos taurus,Bovine,UP1a,UPIa,UPK1A,Uroplakin Ia,Uroplakin-1a
EIAAB45389 Homo sapiens,Human,Tetraspanin-20,TSPAN20,Tspan-20,UP1b,UPIb,UPK1B,Uroplakin Ib,Uroplakin-1b
18-783-77174 RABBIT ANTI HUMAN UROPLAKIN 1A - UPIa; Polyclonal 1 ml
EIAAB45399 Mouse,Mus musculus,p35,UP3b,UPIIIb,Upk3b,Uroplakin IIIb,Uroplakin-3b
EIAAB45396 Mouse,Mus musculus,UP3a,UPIII,Upk3,Upk3a,Uroplakin III,Uroplakin-3a
EIAAB45397 Bos taurus,Bovine,UP3a,UPIII,UPK3,UPK3A,Uroplakin III,Uroplakin-3a
EIAAB45400 Bos taurus,Bovine,p35,UP3b,UPIIIb,UPK3B,Uroplakin IIIb,Uroplakin-3b
EIAAB45387 Rat,Rattus norvegicus,UP1b,UPIb,Upk1b,Uroplakin Ib,Uroplakin-1b
EIAAB45390 Mouse,Mus musculus,UP1b,UPIb,Upk1b,Uroplakin Ib,Uroplakin-1b
EIAAB45393 Homo sapiens,Human,UP2,UPII,UPK2,Uroplakin II,Uroplakin-2
EIAAB45388 Bos taurus,Bovine,UP1b,UPIb,UPK1B,Uroplakin Ib,Uroplakin-1b
EIAAB45395 Homo sapiens,Human,UP3a,UPIII,UPK3,UPK3A,Uroplakin III,Uroplakin-3a
EIAAB45398 Homo sapiens,Human,p35,UP3b,UPIIIb,UPK3B,Uroplakin IIIb,Uroplakin-3b
EIAAB45391 Mouse,Mus musculus,UP2,UPII,Upk2,Uroplakin II,Uroplakin-2
EIAAB45394 Bos taurus,Bovine,UP2,UPII,UPK2,Uroplakin II,Uroplakin-2
EIAAB45392 Pig,Sus scrofa,UP2,UPII,UPK2,Uroplakin II,Uroplakin-2
3620BP-50 Uroplakin III Blocking Peptide target: Uroplakin III 50 μg
orb27370 Uroplakin III antibody Monoclonal Mouse Monoclonal to Uroplakin III 50
EIAAB44229 Homo sapiens,Human,Tetraspan NET-1,Tetraspanin TM4-C,Tetraspanin-1,TSPAN1,Tspan-1
EIAAB44249 Homo sapiens,Human,Tetraspanin TM4-B,Tetraspanin-16,TM4SF16,Transmembrane 4 superfamily member 16,TSPAN16,Tspan-16
EIAAB44261 Homo sapiens,Human,Tetraspanin TM4-A,Tetraspanin-3,TM4SF8,Transmembrane 4 superfamily member 8,TSPAN3,Tspan-3
EIAAB44262 Mouse,Mus musculus,OAP-1,OSP-associated protein 1,Tetraspanin TM4-A,Tetraspanin-3,Tm4sf8,Transmembrane 4 superfamily member 8,Tspan3,Tspan-3
EIAAB44280 A15 homolog,Homo sapiens,Human,Putative NF-kappa-B-activating protein 321,T245 protein,Tetraspanin TM4-D,Tetraspanin-6,TM4SF6,Transmembrane 4 superfamily member 6,TSPAN6,Tspan-6,UNQ767_PRO1560


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur | Gentaur





GENTAUR Ltd.
Unicorn House, Station Cl
Hertfordshire, Potters Bar EN6 1TL
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017
RIB 30004 00187 00010092253 10
BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG
IBAN FR76 3000 4001 8700 0100 9225 310
france@gentaur.com | Gentaur | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: +49 0241 40 08 90 86, +49 0241 95 78 94 78, +49 0241 40 08 90 86
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur | Gentaur