Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Vascular endothelial growth factor A (VEGF-A) (Vascular permeability factor) (VPF)

 VEGFA_MOUSE             Reviewed;         214 AA.
Q00731; O70123; Q66S31; Q6GT23; Q6WZL9;
01-APR-1993, integrated into UniProtKB/Swiss-Prot.
01-OCT-1996, sequence version 2.
10-MAY-2017, entry version 168.
RecName: Full=Vascular endothelial growth factor A;
Short=VEGF-A;
AltName: Full=Vascular permeability factor;
Short=VPF;
Flags: Precursor;
Name=Vegfa; Synonyms=Vegf;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS VEGF-1; VEGF-2 AND VEGF-3).
PubMed=1592003;
Breier G., Albrecht U., Sterrer S., Risau W.;
"Expression of vascular endothelial growth factor during embryonic
angiogenesis and endothelial cell differentiation.";
Development 114:521-532(1992).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-1).
PubMed=1644816;
Claffey K.P., Wilkison W.O., Spiegelman B.M.;
"Vascular endothelial growth factor. Regulation by cell
differentiation and activated second messenger pathways.";
J. Biol. Chem. 267:16317-16322(1992).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-4).
STRAIN=ICR;
PubMed=9446618; DOI=10.1074/jbc.273.5.3033;
Sugihara T., Wadhwa R., Kaul S.C., Mitsui Y.;
"A novel alternatively spliced form of murine vascular endothelial
growth factor, VEGF 115.";
J. Biol. Chem. 273:3033-3038(1998).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM VEGF-5).
STRAIN=FVB/N;
Jankowsky J.A., Adamski F.M., Robertson F.M.;
"Identification of a unique Mus musculus VEGF isoform of 102 amino
acids.";
Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=C57BL/6J;
PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
Lindblad-Toh K., Eichler E.E., Ponting C.P.;
"Lineage-specific biology revealed by a finished genome assembly of
the mouse.";
PLoS Biol. 7:E1000112-E1000112(2009).
[6]
PARTIAL NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM L-VEGF-1).
STRAIN=C57BL/6J; TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
NUCLEOTIDE SEQUENCE [MRNA] OF 1-123 (ISOFORMS VEGF-1/VEGF-2/VEGF-3).
STRAIN=C57BL/6J; TISSUE=Retina;
Minchenko O.H., Minchenko D.O., Opentanova I.L.;
"Alternatively spliced forms of mouse VEGF.";
Submitted (SEP-2004) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-3 (ISOFORMS
VEGF-1/VEGF-2/VEGF-3/VEGF-4/VEGF-5).
PubMed=8632007; DOI=10.1074/jbc.271.7.3877;
Shima D.T., Kuroki M., Deutsch U., Ng Y., Adamis A.P., D'Amore P.A.;
"The mouse gene for vascular endothelial growth factor. Genomic
structure, definition of the transcriptional unit, and
characterization of transcriptional and post-transcriptional
regulatory sequences.";
J. Biol. Chem. 271:3877-3883(1996).
[9]
DEVELOPMENTAL STAGE.
PubMed=10878616;
DOI=10.1002/1097-0177(200007)218:3<507::AID-DVDY1012>3.0.CO;2-5;
Pepper M.S., Baetens D., Mandriota S.J., Di Sanza C., Oikemus S.,
Lane T.F., Soriano J.V., Montesano R., Iruela-Arispe M.L.;
"Regulation of VEGF and VEGF receptor expression in the rodent mammary
gland during pregnancy, lactation, and involution.";
Dev. Dyn. 218:507-524(2000).
[10]
INDUCTION.
PubMed=16259067; DOI=10.3349/ymj.2005.46.5.679;
Shin S.-Y., Lee H.-J., Ko D.-S., Lee H.-C., Park W.I.;
"The regulators of VEGF expression in mouse ovaries.";
Yonsei Med. J. 46:679-686(2005).
[11]
FUNCTION, AND INTERACTION WITH NRP1.
PubMed=26503042; DOI=10.1038/nature15510;
He W., Bai G., Zhou H., Wei N., White N.M., Lauer J., Liu H., Shi Y.,
Dumitru C.D., Lettieri K., Shubayev V., Jordanova A.,
Guergueltcheva V., Griffin P.R., Burgess R.W., Pfaff S.L., Yang X.L.;
"CMT2D neuropathy is linked to the neomorphic binding activity of
glycyl-tRNA synthetase.";
Nature 526:710-714(2015).
[12]
ERRATUM.
PubMed=26789244; DOI=10.1038/nature16499;
He W., Bai G., Zhou H., Wei N., White N.M., Lauer J., Liu H., Shi Y.,
Dan Dumitru C., Lettieri K., Shubayev V., Jordanova A.,
Guergueltcheva V., Griffin P.R., Burgess R.W., Pfaff S.L., Yang X.L.;
"Corrigendum: CMT2D neuropathy is linked to the neomorphic binding
activity of glycyl-tRNA synthetase.";
Nature 532:402-402(2016).
-!- FUNCTION: Growth factor active in angiogenesis, vasculogenesis and
endothelial cell growth. Induces endothelial cell proliferation,
promotes cell migration, inhibits apoptosis and induces
permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and
KDR/VEGFR2 receptors, heparan sulfate and heparin. May play a role
in increasing vascular permeability during lactation, when
increased transport of molecules from the blood is required for
efficient milk protein synthesis (By similarity). Binding to NRP1
receptor initiates a signaling pathway needed for motor neuron
axon guidance and cell body migration, including for the caudal
migration of facial motor neurons from rhombomere 4 to rhombomere
6 during embryonic development (PubMed:26503042). {ECO:0000250,
ECO:0000269|PubMed:26503042}.
-!- SUBUNIT: Homodimer; disulfide-linked. Also found as heterodimer
with PGF (By similarity). Interacts with NRP1 (PubMed:26503042).
{ECO:0000250, ECO:0000269|PubMed:26503042}.
-!- SUBCELLULAR LOCATION: Isoform VEGF-1: Secreted.
-!- SUBCELLULAR LOCATION: Isoform VEGF-2: Secreted.
-!- SUBCELLULAR LOCATION: Isoform VEGF-3: Cell membrane; Peripheral
membrane protein. Note=Remains cell-surface associated unless
released by heparin.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative promoter usage, Alternative splicing, Alternative initiation; Named isoforms=6;
Name=VEGF-3; Synonyms=VEGF188;
IsoId=Q00731-1; Sequence=Displayed;
Name=VEGF-1; Synonyms=VEGF164;
IsoId=Q00731-2; Sequence=VSP_004626, VSP_004627;
Name=VEGF-2; Synonyms=VEGF120;
IsoId=Q00731-3; Sequence=VSP_004628;
Name=VEGF-4; Synonyms=VEGF115;
IsoId=Q00731-4; Sequence=VSP_016418, VSP_016421;
Name=VEGF-5; Synonyms=VEGF102;
IsoId=Q00731-5; Sequence=VSP_016419, VSP_016420;
Name=L-VEGF-1;
IsoId=Q00731-6; Sequence=VSP_038746, VSP_004626, VSP_004627;
Note=Gene prediction based on EST data. Produced by alternative
promoter usage and alternative initiation. Starts at an
alternative upstream CUG codon.;
-!- TISSUE SPECIFICITY: In developing embryos, expressed mainly in the
choroid plexus, paraventricular neuroepithelium, placenta and
kidney glomeruli. Also found in bronchial epithelium, adrenal
gland and in seminiferous tubules of testis. High expression of
VEGF continues in kidney glomeruli and choroid plexus in adults.
-!- DEVELOPMENTAL STAGE: Levels increase during pregnancy (maximum
5.5-fold at 5 days) and a more marked increase occurs during
lactation (maximal 9.7-fold at 7 days). Levels decrease
progressively during the phase of involution.
{ECO:0000269|PubMed:10878616}.
-!- INDUCTION: By IL-6 and FSH in vitro.
{ECO:0000269|PubMed:16259067}.
-!- DOMAIN: Isoform VEGF-3 contains a basic insert which acts as a
cell retention signal.
-!- SIMILARITY: Belongs to the PDGF/VEGF growth factor family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAH61468.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; S37052; AAB22252.1; -; mRNA.
EMBL; S38083; AAB22253.1; -; mRNA.
EMBL; S38100; AAB22254.1; -; mRNA.
EMBL; M95200; AAA40547.1; -; mRNA.
EMBL; U50279; AAC05442.1; -; mRNA.
EMBL; AY263146; AAP86647.1; -; mRNA.
EMBL; AC127690; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC061468; AAH61468.1; ALT_INIT; mRNA.
EMBL; AY707864; AAU11325.1; -; mRNA.
EMBL; AY750956; AAU95484.1; -; mRNA.
EMBL; AY750957; AAU95485.1; -; mRNA.
EMBL; U41383; -; NOT_ANNOTATED_CDS; Genomic_DNA.
CCDS; CCDS28818.2; -. [Q00731-6]
CCDS; CCDS70817.1; -. [Q00731-3]
PIR; A44881; A44881.
PIR; B44881; B44881.
RefSeq; NP_001020421.2; NM_001025250.3.
RefSeq; NP_001020428.2; NM_001025257.3.
RefSeq; NP_001103736.1; NM_001110266.1.
RefSeq; NP_001103737.1; NM_001110267.1.
RefSeq; NP_001103738.1; NM_001110268.1.
RefSeq; NP_001273985.1; NM_001287056.1. [Q00731-1]
RefSeq; NP_001273986.1; NM_001287057.1. [Q00731-2]
RefSeq; NP_001273987.1; NM_001287058.1. [Q00731-3]
RefSeq; NP_001303970.1; NM_001317041.1.
RefSeq; NP_033531.3; NM_009505.4. [Q00731-6]
UniGene; Mm.282184; -.
ProteinModelPortal; Q00731; -.
SMR; Q00731; -.
BioGrid; 204512; 3.
DIP; DIP-31909N; -.
IntAct; Q00731; 2.
STRING; 10090.ENSMUSP00000115883; -.
PhosphoSitePlus; Q00731; -.
MaxQB; Q00731; -.
PaxDb; Q00731; -.
PRIDE; Q00731; -.
Ensembl; ENSMUST00000024747; ENSMUSP00000024747; ENSMUSG00000023951. [Q00731-3]
Ensembl; ENSMUST00000214739; ENSMUSP00000149539; ENSMUSG00000023951. [Q00731-6]
GeneID; 22339; -.
KEGG; mmu:22339; -.
UCSC; uc008crn.4; mouse. [Q00731-1]
UCSC; uc008cro.4; mouse. [Q00731-2]
UCSC; uc008crp.4; mouse. [Q00731-3]
UCSC; uc008crr.3; mouse. [Q00731-5]
CTD; 7422; -.
MGI; MGI:103178; Vegfa.
eggNOG; ENOG410IGCM; Eukaryota.
eggNOG; ENOG410ZWYU; LUCA.
GeneTree; ENSGT00730000110791; -.
HOGENOM; HOG000230896; -.
HOVERGEN; HBG000105; -.
InParanoid; Q00731; -.
KO; K05448; -.
PhylomeDB; Q00731; -.
Reactome; R-MMU-114608; Platelet degranulation.
Reactome; R-MMU-194313; VEGF ligand-receptor interactions.
Reactome; R-MMU-195399; VEGF binds to VEGFR leading to receptor dimerization.
Reactome; R-MMU-3928663; EPHA-mediated growth cone collapse.
Reactome; R-MMU-4420097; VEGFA-VEGFR2 Pathway.
Reactome; R-MMU-5218921; VEGFR2 mediated cell proliferation.
ChiTaRS; Vegfa; mouse.
PRO; PR:Q00731; -.
Proteomes; UP000000589; Chromosome 17.
Bgee; ENSMUSG00000023951; -.
CleanEx; MM_VEGFA; -.
ExpressionAtlas; Q00731; baseline and differential.
Genevisible; Q00731; MM.
GO; GO:0009986; C:cell surface; ISS:UniProtKB.
GO; GO:0005737; C:cytoplasm; IDA:MGI.
GO; GO:0005576; C:extracellular region; IDA:MGI.
GO; GO:0005615; C:extracellular space; IDA:BHF-UCL.
GO; GO:0005634; C:nucleus; IDA:MGI.
GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0030141; C:secretory granule; ISS:UniProtKB.
GO; GO:0042056; F:chemoattractant activity; IDA:BHF-UCL.
GO; GO:0005125; F:cytokine activity; ISS:UniProtKB.
GO; GO:0050840; F:extracellular matrix binding; IDA:MGI.
GO; GO:0001968; F:fibronectin binding; ISS:UniProtKB.
GO; GO:0008083; F:growth factor activity; IDA:MGI.
GO; GO:0008201; F:heparin binding; IDA:MGI.
GO; GO:0042802; F:identical protein binding; ISO:MGI.
GO; GO:0038191; F:neuropilin binding; ISO:MGI.
GO; GO:0005161; F:platelet-derived growth factor receptor binding; ISS:UniProtKB.
GO; GO:0046982; F:protein heterodimerization activity; ISO:MGI.
GO; GO:0048018; F:receptor agonist activity; ISS:UniProtKB.
GO; GO:0005102; F:receptor binding; IDA:MGI.
GO; GO:0043183; F:vascular endothelial growth factor receptor 1 binding; IDA:MGI.
GO; GO:0043184; F:vascular endothelial growth factor receptor 2 binding; IDA:MGI.
GO; GO:0005172; F:vascular endothelial growth factor receptor binding; ISS:UniProtKB.
GO; GO:0032147; P:activation of protein kinase activity; ISS:UniProtKB.
GO; GO:0001525; P:angiogenesis; IDA:MGI.
GO; GO:0048844; P:artery morphogenesis; IMP:MGI.
GO; GO:0002575; P:basophil chemotaxis; ISO:MGI.
GO; GO:0001568; P:blood vessel development; IMP:MGI.
GO; GO:0002043; P:blood vessel endothelial cell proliferation involved in sprouting angiogenesis; IMP:CACAO.
GO; GO:0048514; P:blood vessel morphogenesis; IDA:MGI.
GO; GO:0060346; P:bone trabecula formation; IMP:MGI.
GO; GO:0061430; P:bone trabecula morphogenesis; IMP:MGI.
GO; GO:0001569; P:branching involved in blood vessel morphogenesis; IMP:MGI.
GO; GO:0048754; P:branching morphogenesis of an epithelial tube; IDA:MGI.
GO; GO:0048593; P:camera-type eye morphogenesis; IMP:MGI.
GO; GO:0048739; P:cardiac muscle fiber development; IMP:MGI.
GO; GO:0060948; P:cardiac vascular smooth muscle cell development; IMP:BHF-UCL.
GO; GO:0048469; P:cell maturation; IMP:MGI.
GO; GO:0016477; P:cell migration; IDA:MGI.
GO; GO:0002042; P:cell migration involved in sprouting angiogenesis; ISS:UniProtKB.
GO; GO:0008283; P:cell proliferation; IMP:MGI.
GO; GO:0071456; P:cellular response to hypoxia; ISS:UniProtKB.
GO; GO:0035924; P:cellular response to vascular endothelial growth factor stimulus; IGI:BHF-UCL.
GO; GO:0071679; P:commissural neuron axon guidance; IDA:BHF-UCL.
GO; GO:0060982; P:coronary artery morphogenesis; IMP:BHF-UCL.
GO; GO:0003169; P:coronary vein morphogenesis; IMP:BHF-UCL.
GO; GO:0071542; P:dopaminergic neuron differentiation; IGI:MGI.
GO; GO:0035767; P:endothelial cell chemotaxis; ISS:UniProtKB.
GO; GO:0043542; P:endothelial cell migration; IMP:MGI.
GO; GO:0030855; P:epithelial cell differentiation; IMP:MGI.
GO; GO:0042462; P:eye photoreceptor cell development; IMP:MGI.
GO; GO:0040007; P:growth; IMP:MGI.
GO; GO:0003007; P:heart morphogenesis; IMP:MGI.
GO; GO:0048873; P:homeostasis of number of cells within a tissue; IMP:MGI.
GO; GO:0001701; P:in utero embryonic development; IMP:MGI.
GO; GO:0050930; P:induction of positive chemotaxis; ISO:MGI.
GO; GO:0001822; P:kidney development; IMP:MGI.
GO; GO:0007595; P:lactation; IMP:MGI.
GO; GO:0030324; P:lung development; IDA:MGI.
GO; GO:0060426; P:lung vasculature development; IDA:MGI.
GO; GO:0036303; P:lymph vessel morphogenesis; IMP:BHF-UCL.
GO; GO:0001946; P:lymphangiogenesis; IGI:MGI.
GO; GO:0030225; P:macrophage differentiation; ISS:UniProtKB.
GO; GO:0060749; P:mammary gland alveolus development; IMP:MGI.
GO; GO:0007498; P:mesoderm development; IMP:MGI.
GO; GO:0030224; P:monocyte differentiation; ISS:UniProtKB.
GO; GO:0097475; P:motor neuron migration; IMP:UniProtKB.
GO; GO:0043066; P:negative regulation of apoptotic process; IMP:MGI.
GO; GO:0022408; P:negative regulation of cell-cell adhesion; IGI:MGI.
GO; GO:0043154; P:negative regulation of cysteine-type endopeptidase activity involved in apoptotic process; ISO:MGI.
GO; GO:2001237; P:negative regulation of extrinsic apoptotic signaling pathway; IDA:BHF-UCL.
GO; GO:0045599; P:negative regulation of fat cell differentiation; IMP:MGI.
GO; GO:0010629; P:negative regulation of gene expression; IMP:MGI.
GO; GO:0043524; P:negative regulation of neuron apoptotic process; IDA:BHF-UCL.
GO; GO:0000122; P:negative regulation of transcription from RNA polymerase II promoter; ISO:MGI.
GO; GO:0048666; P:neuron development; IMP:BHF-UCL.
GO; GO:0003151; P:outflow tract morphogenesis; IMP:BHF-UCL.
GO; GO:0001541; P:ovarian follicle development; IMP:MGI.
GO; GO:0050918; P:positive chemotaxis; IDA:BHF-UCL.
GO; GO:0045766; P:positive regulation of angiogenesis; IDA:MGI.
GO; GO:0048842; P:positive regulation of axon extension involved in axon guidance; IDA:BHF-UCL.
GO; GO:0043536; P:positive regulation of blood vessel endothelial cell migration; ISS:UniProtKB.
GO; GO:0090190; P:positive regulation of branching involved in ureteric bud morphogenesis; IDA:UniProtKB.
GO; GO:0045785; P:positive regulation of cell adhesion; ISS:UniProtKB.
GO; GO:0051781; P:positive regulation of cell division; IEA:UniProtKB-KW.
GO; GO:0030335; P:positive regulation of cell migration; ISO:MGI.
GO; GO:0090050; P:positive regulation of cell migration involved in sprouting angiogenesis; ISS:UniProtKB.
GO; GO:0008284; P:positive regulation of cell proliferation; IDA:MGI.
GO; GO:0038091; P:positive regulation of cell proliferation by VEGF-activated platelet derived growth factor receptor signaling pathway; ISS:UniProtKB.
GO; GO:0051272; P:positive regulation of cellular component movement; ISS:UniProtKB.
GO; GO:0032793; P:positive regulation of CREB transcription factor activity; ISS:UniProtKB.
GO; GO:0038033; P:positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway; ISS:BHF-UCL.
GO; GO:0010595; P:positive regulation of endothelial cell migration; ISS:UniProtKB.
GO; GO:0001938; P:positive regulation of endothelial cell proliferation; IDA:MGI.
GO; GO:0050679; P:positive regulation of epithelial cell proliferation; IMP:MGI.
GO; GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; IDA:BHF-UCL.
GO; GO:0051894; P:positive regulation of focal adhesion assembly; ISS:UniProtKB.
GO; GO:0010628; P:positive regulation of gene expression; ISO:MGI.
GO; GO:1901727; P:positive regulation of histone deacetylase activity; ISO:MGI.
GO; GO:1901492; P:positive regulation of lymphangiogenesis; IDA:MGI.
GO; GO:0043406; P:positive regulation of MAP kinase activity; ISS:UniProtKB.
GO; GO:0060754; P:positive regulation of mast cell chemotaxis; ISO:MGI.
GO; GO:0002053; P:positive regulation of mesenchymal cell proliferation; IDA:MGI.
GO; GO:0002052; P:positive regulation of neuroblast proliferation; IGI:MGI.
GO; GO:0045669; P:positive regulation of osteoblast differentiation; IMP:MGI.
GO; GO:1900745; P:positive regulation of p38MAPK cascade; ISO:MGI.
GO; GO:0033138; P:positive regulation of peptidyl-serine phosphorylation; ISS:BHF-UCL.
GO; GO:1900086; P:positive regulation of peptidyl-tyrosine autophosphorylation; ISS:UniProtKB.
GO; GO:0050731; P:positive regulation of peptidyl-tyrosine phosphorylation; IDA:MGI.
GO; GO:0050927; P:positive regulation of positive chemotaxis; ISS:UniProtKB.
GO; GO:0031954; P:positive regulation of protein autophosphorylation; ISS:UniProtKB.
GO; GO:0031334; P:positive regulation of protein complex assembly; ISS:UniProtKB.
GO; GO:0051897; P:positive regulation of protein kinase B signaling; IDA:BHF-UCL.
GO; GO:0090037; P:positive regulation of protein kinase C signaling; ISS:UniProtKB.
GO; GO:1903572; P:positive regulation of protein kinase D signaling; ISS:BHF-UCL.
GO; GO:1902966; P:positive regulation of protein localization to early endosome; ISO:MGI.
GO; GO:0001934; P:positive regulation of protein phosphorylation; ISS:UniProtKB.
GO; GO:0002092; P:positive regulation of receptor internalization; ISS:UniProtKB.
GO; GO:1902336; P:positive regulation of retinal ganglion cell axon guidance; IMP:BHF-UCL.
GO; GO:0045944; P:positive regulation of transcription from RNA polymerase II promoter; ISS:UniProtKB.
GO; GO:0061419; P:positive regulation of transcription from RNA polymerase II promoter in response to hypoxia; ISO:MGI.
GO; GO:0030949; P:positive regulation of vascular endothelial growth factor receptor signaling pathway; ISS:UniProtKB.
GO; GO:0043117; P:positive regulation of vascular permeability; IDA:MGI.
GO; GO:0031077; P:post-embryonic camera-type eye development; IMP:MGI.
GO; GO:0060319; P:primitive erythrocyte differentiation; IMP:MGI.
GO; GO:0008360; P:regulation of cell shape; ISS:UniProtKB.
GO; GO:0030823; P:regulation of cGMP metabolic process; ISO:MGI.
GO; GO:0045601; P:regulation of endothelial cell differentiation; IDA:MGI.
GO; GO:1901532; P:regulation of hematopoietic progenitor cell differentiation; IDA:MGI.
GO; GO:0090259; P:regulation of retinal ganglion cell axon guidance; IDA:BHF-UCL.
GO; GO:0006357; P:regulation of transcription from RNA polymerase II promoter; ISO:MGI.
GO; GO:0001666; P:response to hypoxia; ISS:UniProtKB.
GO; GO:0061304; P:retinal blood vessel morphogenesis; IMP:CACAO.
GO; GO:0002040; P:sprouting angiogenesis; IDA:BHF-UCL.
GO; GO:0043129; P:surfactant homeostasis; IMP:MGI.
GO; GO:0035148; P:tube formation; ISS:UniProtKB.
GO; GO:0048010; P:vascular endothelial growth factor receptor signaling pathway; IDA:MGI.
GO; GO:0038084; P:vascular endothelial growth factor signaling pathway; IDA:BHF-UCL.
GO; GO:0001944; P:vasculature development; IMP:MGI.
GO; GO:0038190; P:VEGF-activated neuropilin signaling pathway; IMP:BHF-UCL.
CDD; cd00135; PDGF; 1.
Gene3D; 2.10.160.10; -; 1.
Gene3D; 2.10.90.10; -; 1.
InterPro; IPR029034; Cystine-knot_cytokine.
InterPro; IPR023581; PD_growth_factor_CS.
InterPro; IPR000072; PDGF/VEGF_dom.
InterPro; IPR027928; VEGF_C.
Pfam; PF00341; PDGF; 1.
Pfam; PF14554; VEGF_C; 1.
SMART; SM00141; PDGF; 1.
SUPFAM; SSF57501; SSF57501; 1.
SUPFAM; SSF57593; SSF57593; 1.
PROSITE; PS00249; PDGF_1; 1.
PROSITE; PS50278; PDGF_2; 1.
1: Evidence at protein level;
Alternative initiation; Alternative promoter usage;
Alternative splicing; Angiogenesis; Cell membrane; Complete proteome;
Developmental protein; Differentiation; Disulfide bond; Glycoprotein;
Growth factor; Heparin-binding; Membrane; Mitogen; Reference proteome;
Secreted; Signal.
SIGNAL 1 26 {ECO:0000250}.
CHAIN 27 214 Vascular endothelial growth factor A.
/FTId=PRO_0000023388.
CARBOHYD 100 100 N-linked (GlcNAc...) asparagine.
{ECO:0000305}.
DISULFID 51 93 {ECO:0000250}.
DISULFID 76 76 Interchain. {ECO:0000250}.
DISULFID 82 127 {ECO:0000250}.
DISULFID 85 85 Interchain. {ECO:0000250}.
DISULFID 86 129 {ECO:0000250}.
VAR_SEQ 1 1 M -> MTDRQTDTAPSPSAHLLAGGLPTVDAAASREEPKPA
PGGGVEGVGARGIARKLFVQLLGSSRSVVAVVCAAGDKPIG
AGRSASSGLEKPGPEKRGEEEKEEERGPQWALGSQEPSSWT
GEAAVCADSAPAARAPQAPARASVPEGRGARQGAQESGLPR
SPSRRGSASRAGPGRASETM (in isoform L-VEGF-
1). {ECO:0000305}.
/FTId=VSP_038746.
VAR_SEQ 105 141 IMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKK ->
VGTCGTGDGAGAGGGRRTVVQGGALEGCLGLCLGNFW (in
isoform VEGF-4).
{ECO:0000303|PubMed:9446618}.
/FTId=VSP_016418.
VAR_SEQ 105 128 IMRIKPHQSQHIGEMSFLQHSRCE -> VGTCGTGDGAGAG
GAGGQWYKEGH (in isoform VEGF-5).
{ECO:0000303|Ref.4}.
/FTId=VSP_016419.
VAR_SEQ 129 214 Missing (in isoform VEGF-5).
{ECO:0000303|Ref.4}.
/FTId=VSP_016420.
VAR_SEQ 140 140 K -> N (in isoform VEGF-1 and isoform L-
VEGF-1). {ECO:0000303|PubMed:1592003,
ECO:0000303|PubMed:1644816}.
/FTId=VSP_004626.
VAR_SEQ 141 208 Missing (in isoform VEGF-2).
{ECO:0000303|PubMed:1592003}.
/FTId=VSP_004628.
VAR_SEQ 141 164 Missing (in isoform VEGF-1 and isoform L-
VEGF-1). {ECO:0000303|PubMed:1592003,
ECO:0000303|PubMed:1644816}.
/FTId=VSP_004627.
VAR_SEQ 142 214 Missing (in isoform VEGF-4).
{ECO:0000303|PubMed:9446618}.
/FTId=VSP_016421.
CONFLICT 61 61 F -> I (in Ref. 3; AAC05442).
{ECO:0000305}.
CONFLICT 117 118 GE -> ER (in Ref. 2; AAA40547).
{ECO:0000305}.
SEQUENCE 214 AA; 25283 MW; B5540B51E4BB6E17 CRC64;
MNFLLSWVHW TLALLLYLHH AKWSQAAPTT EGEQKSHEVI KFMDVYQRSY CRPIETLVDI
FQEYPDEIEY IFKPSCVPLM RCAGCCNDEA LECVPTSESN ITMQIMRIKP HQSQHIGEMS
FLQHSRCECR PKKDRTKPEK KSVRGKGKGQ KRKRKKSRFK SWSVHCEPCS ERRKHLFVQD
PQTCKCSCKN TDSRCKARQL ELNERTCRCD KPRR


Related products :

Catalog number Product name Quantity
20-271-80050 Vascular Endothelial Cell Growth Factor - Mouse Anti Human Vascular Endothelial Cell Growth Factor; VEGF-A; Vascular permeability factor; VPF Monoclonal 0.5 mg
20-271-80050 Vascular Endothelial Cell Growth Factor - Mouse Anti Human Vascular Endothelial Cell Growth Factor; VEGF-A; Vascular permeability factor; VPF Monoclonal 1 mg
U0143h CLIA Homo sapiens,Human,Vascular endothelial growth factor A,Vascular permeability factor,VEGF,VEGFA,VEGF-A,VPF 96T
E0143h ELISA kit Homo sapiens,Human,Vascular endothelial growth factor A,Vascular permeability factor,VEGF,VEGFA,VEGF-A,VPF 96T
E0143h ELISA Homo sapiens,Human,Vascular endothelial growth factor A,Vascular permeability factor,VEGF,VEGFA,VEGF-A,VPF 96T
U0143b CLIA Bos taurus,Bovine,Vascular endothelial growth factor A,Vascular permeability factor,VEGF,VEGFA,VEGF-A,VPF 96T
E0143r ELISA kit Rat,Rattus norvegicus,Vascular endothelial growth factor A,Vascular permeability factor,Vegf,Vegfa,VEGF-A,VPF 96T
U0143r CLIA Rat,Rattus norvegicus,Vascular endothelial growth factor A,Vascular permeability factor,Vegf,Vegfa,VEGF-A,VPF 96T
E0143m ELISA kit Mouse,Mus musculus,Vascular endothelial growth factor A,Vascular permeability factor,Vegf,Vegfa,VEGF-A,VPF 96T
U0143m CLIA Mouse,Mus musculus,Vascular endothelial growth factor A,Vascular permeability factor,Vegf,Vegfa,VEGF-A,VPF 96T
E0143b ELISA kit Bos taurus,Bovine,Vascular endothelial growth factor A,Vascular permeability factor,VEGF,VEGFA,VEGF-A,VPF 96T
E0143b ELISA Bos taurus,Bovine,Vascular endothelial growth factor A,Vascular permeability factor,VEGF,VEGFA,VEGF-A,VPF 96T
E0143m ELISA Mouse,Mus musculus,Vascular endothelial growth factor A,Vascular permeability factor,Vegf,Vegfa,VEGF-A,VPF 96T
E0143r ELISA Rat,Rattus norvegicus,Vascular endothelial growth factor A,Vascular permeability factor,Vegf,Vegfa,VEGF-A,VPF 96T
E0143p ELISA Pig,Sus scrofa,Vascular endothelial growth factor A,Vascular permeability factor,VEGF,VEGFA,VEGF-A,VPF 96T
E0143p ELISA kit Pig,Sus scrofa,Vascular endothelial growth factor A,Vascular permeability factor,VEGF,VEGFA,VEGF-A,VPF 96T
U0143p CLIA Pig,Sus scrofa,Vascular endothelial growth factor A,Vascular permeability factor,VEGF,VEGFA,VEGF-A,VPF 96T
10-663-45071 Vascular Endothelial Growth Factor-121 glycosylated (VEGF-121) Human - VEGF-A; Vascular permeability factor; VPF N_A 0.002 mg
10-663-45071 Vascular Endothelial Growth Factor-121 glycosylated (VEGF-121) Human - VEGF-A; Vascular permeability factor; VPF N_A 0.01 mg
10-663-45174 Vascular Endothelial Growth Factor variant (VEGF-121) Human - VEGF-A; Vascular permeability factor; VPF N_A 0.002 mg
10-663-45174 Vascular Endothelial Growth Factor variant (VEGF-121) Human - VEGF-A; Vascular permeability factor; VPF N_A 1 mg
10-663-45174 Vascular Endothelial Growth Factor variant (VEGF-121) Human - VEGF-A; Vascular permeability factor; VPF N_A 0.01 mg
10-663-45071 Vascular Endothelial Growth Factor-121 glycosylated (VEGF-121) Human - VEGF-A; Vascular permeability factor; VPF N_A 1 mg
20-663-48024 Vascular Endothelial Cell Growth Factor (mAHuVEGF) - Mouse Anti-Human Vascular Endothelial Cell Growth Factor (mAHuVEGF); VEGF-A; Vascular permeability factor; VPF Monoclonal 1 mg
20-663-48024 Vascular Endothelial Cell Growth Factor (mAHuVEGF) - Mouse Anti-Human Vascular Endothelial Cell Growth Factor (mAHuVEGF); VEGF-A; Vascular permeability factor; VPF Monoclonal 0.5 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur