Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Voltage-dependent L-type calcium channel subunit beta-1 (CAB1) (Calcium channel voltage-dependent subunit beta 1)

 CACB1_HUMAN             Reviewed;         598 AA.
Q02641; A8K114; O15331; Q02639; Q02640; Q8N3X9; Q9C085; Q9UD79;
01-JUN-1994, integrated into UniProtKB/Swiss-Prot.
02-MAY-2002, sequence version 3.
05-DEC-2018, entry version 186.
RecName: Full=Voltage-dependent L-type calcium channel subunit beta-1;
Short=CAB1;
AltName: Full=Calcium channel voltage-dependent subunit beta 1;
Name=CACNB1; Synonyms=CACNLB1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
TISSUE=Hippocampus, and Skeletal muscle;
PubMed=1385409;
Powers P.A., Liu S., Hogan K., Gregg R.G.;
"Skeletal muscle and brain isoforms of a beta-subunit of human
voltage-dependent calcium channels are encoded by a single gene.";
J. Biol. Chem. 267:22967-22972(1992).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, SUBUNIT, AND
SUBCELLULAR LOCATION.
PubMed=1309651; DOI=10.1016/0896-6273(92)90109-Q;
Williams M.E., Feldman D.H., McCue A.F., Brenner R., Velicelebi G.,
Ellis S.B., Harpold M.M.;
"Structure and functional expression of alpha 1, alpha 2, and beta
subunits of a novel human neuronal calcium channel subtype.";
Neuron 8:71-84(1992).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3).
TISSUE=Heart;
PubMed=7916667; DOI=10.1161/01.RES.72.6.1337;
Collin T., Wang J., Nargeot J., Schwartz A.;
"Molecular cloning of three isoforms of the L-type voltage-dependent
calcium channel beta subunit from normal human heart.";
Circ. Res. 72:1337-1344(1993).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Brain cortex;
PubMed=8905728; DOI=10.1016/0304-3940(96)13055-X;
Fukuda K., Kaneko S., Yada N., Kikuwaka M., Akaike A., Satoh M.;
"Cyclic AMP-dependent modulation of N- and Q-type Ca2+ channels
expressed in Xenopus oocytes.";
Neurosci. Lett. 217:13-16(1996).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1; 2 AND 3).
PubMed=10624822; DOI=10.1016/S0304-3940(99)00851-4;
Hogan K., Greg R.G., Powers P.A.;
"Structure and alternative splicing of the gene encoding the human
beta1 subunit of voltage dependent calcium channels.";
Neurosci. Lett. 277:111-114(1999).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Hippocampus;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[9]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 146-209.
PubMed=8395940; DOI=10.1093/hmg/2.7.863;
Iles D.E., Segers B., Sengers R.C.A., Monsieurs K., Heytens L.,
Halsall P.J., Hopkins P.M., Ellis F.R., Hall-Curran J.L.,
Stewart A.D., Wieringa B.;
"Genetic mapping of the beta 1- and gamma-subunits of the human
skeletal muscle L-type voltage-dependent calcium channel on chromosome
17q and exclusion as candidate genes for malignant hyperthermia
susceptibility.";
Hum. Mol. Genet. 2:863-868(1993).
[10]
NUCLEOTIDE SEQUENCE [MRNA] OF 445-598 (ISOFORMS 1 AND 3), FUNCTION,
SUBUNIT, TISSUE SPECIFICITY, AND ALTERNATIVE SPLICING.
PubMed=8107964; DOI=10.1016/0028-3908(93)90004-M;
Brust P.F., Simerson S., McCue A.F., Deal C.R., Schoonmaker S.,
Williams M.E., Velicelebi G., Johnson E.C., Harpold M.M., Ellis S.B.;
"Human neuronal voltage-dependent calcium channels: studies on subunit
structure and role in channel assembly.";
Neuropharmacology 32:1089-1102(1993).
[11]
SUBUNIT, SUBCELLULAR LOCATION, FUNCTION, AND TISSUE SPECIFICITY.
PubMed=15615847; DOI=10.1152/ajpheart.00348.2004;
Cohen R.M., Foell J.D., Balijepalli R.C., Shah V., Hell J.W.,
Kamp T.J.;
"Unique modulation of L-type Ca2+ channels by short auxiliary beta1d
subunit present in cardiac muscle.";
Am. J. Physiol. 288:H2363-H2374(2005).
[12]
VARIANT [LARGE SCALE ANALYSIS] LEU-339.
PubMed=16959974; DOI=10.1126/science.1133427;
Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D.,
Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S.,
Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J.,
Dawson D., Willson J.K.V., Gazdar A.F., Hartigan J., Wu L., Liu C.,
Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N.,
Vogelstein B., Kinzler K.W., Velculescu V.E.;
"The consensus coding sequences of human breast and colorectal
cancers.";
Science 314:268-274(2006).
-!- FUNCTION: Regulatory subunit of L-type calcium channels
(PubMed:1309651, PubMed:8107964, PubMed:15615847). Regulates the
activity of L-type calcium channels that contain CACNA1A as pore-
forming subunit (By similarity). Regulates the activity of L-type
calcium channels that contain CACNA1C as pore-forming subunit and
increases the presence of the channel complex at the cell membrane
(PubMed:15615847). Required for functional expression L-type
calcium channels that contain CACNA1D as pore-forming subunit
(PubMed:1309651). Regulates the activity of L-type calcium
channels that contain CACNA1B as pore-forming subunit
(PubMed:8107964). {ECO:0000250|UniProtKB:P19517,
ECO:0000269|PubMed:1309651, ECO:0000269|PubMed:15615847,
ECO:0000269|PubMed:8107964}.
-!- SUBUNIT: Regulatory subunit of L-type calcium channels that
consist of a pore-forming alpha subunit and auxiliary beta, gamma
and delta subunits (By similarity). Interacts with CACNA1A,
CACNA1B, CACNA1C and CACNA1S (By similarity). Component of a
calcium channel complex consisting of a pore-forming alpha subunit
(CACNA1S) and the ancillary subunits CACNB1 or CACNB2, CACNG1 and
CACNA2D1. Identified in a complex with CACNA1C (PubMed:15615847).
Identified in a complex with the L-type calcium channel subunits
CACNA1C, CACNA2D1, CACNB1 and one of the gamma subunits (CACNG4,
CACNG6, CACNG7, or CACNG8) (By similarity). Part of a L-type
calcium channel complex that contains CACNA1D, CACNA2D1 and CACNB1
(PubMed:1309651). Part of a L-type calcium channel complex that
contains CACNA1B, CACNA2D1 and CACNB1 (PubMed:8107964). Interacts
with JSRP1. Interacts with RYR1 (By similarity). Interacts with
CBARP (By similarity). {ECO:0000250|UniProtKB:P19517,
ECO:0000250|UniProtKB:P54283, ECO:0000250|UniProtKB:Q8R3Z5,
ECO:0000269|PubMed:1309651, ECO:0000269|PubMed:15615847,
ECO:0000269|PubMed:8107964}.
-!- INTERACTION:
Q13936:CACNA1C; NbExp=2; IntAct=EBI-15707950, EBI-1038838;
-!- SUBCELLULAR LOCATION: Cell membrane, sarcolemma
{ECO:0000305|PubMed:15615847}; Peripheral membrane protein
{ECO:0000250|UniProtKB:P19517}; Cytoplasmic side
{ECO:0000250|UniProtKB:P19517}. Cell membrane
{ECO:0000305|PubMed:1309651}; Peripheral membrane protein
{ECO:0000305|PubMed:1309651}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1; Synonyms=Beta-1b2, BetaA, Beta-1B, Beta1-2;
IsoId=Q02641-1; Sequence=Displayed;
Name=2; Synonyms=Beta-1M, BetaC, Beta-1a;
IsoId=Q02641-2; Sequence=VSP_000623, VSP_000624, VSP_000625;
Name=3; Synonyms=Beta-1b1, BetaB, Beta-1c, Beta1-3;
IsoId=Q02641-3; Sequence=VSP_000624, VSP_000625;
-!- TISSUE SPECIFICITY: Detected in heart ventricle (at protein level)
(PubMed:15615847). Isoform 1 and isoform 3 are expressed in brain,
heart, spleen, central nervous system and neuroblastoma cells.
Isoform 2 is expressed in skeletal muscle.
{ECO:0000269|PubMed:15615847, ECO:0000269|PubMed:8107964}.
-!- SIMILARITY: Belongs to the calcium channel beta subunit family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=CAA79825.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; M92303; AAA35633.1; -; mRNA.
EMBL; M92301; AAA35631.1; -; mRNA.
EMBL; M92302; AAA35632.1; -; mRNA.
EMBL; M76560; AAA51894.1; -; mRNA.
EMBL; L06110; AAA36167.1; -; mRNA.
EMBL; L06111; AAA36168.1; -; mRNA.
EMBL; L06112; AAA36169.1; -; mRNA.
EMBL; AB054985; BAB21444.1; -; mRNA.
EMBL; U86960; AAB58779.1; -; Genomic_DNA.
EMBL; U86952; AAB58779.1; JOINED; Genomic_DNA.
EMBL; U86953; AAB58779.1; JOINED; Genomic_DNA.
EMBL; U86954; AAB58779.1; JOINED; Genomic_DNA.
EMBL; U86955; AAB58779.1; JOINED; Genomic_DNA.
EMBL; U86956; AAB58779.1; JOINED; Genomic_DNA.
EMBL; U86957; AAB58779.1; JOINED; Genomic_DNA.
EMBL; U86958; AAB58779.1; JOINED; Genomic_DNA.
EMBL; U86959; AAB58779.1; JOINED; Genomic_DNA.
EMBL; U86960; AAB58780.1; -; Genomic_DNA.
EMBL; U86952; AAB58780.1; JOINED; Genomic_DNA.
EMBL; U86953; AAB58780.1; JOINED; Genomic_DNA.
EMBL; U86954; AAB58780.1; JOINED; Genomic_DNA.
EMBL; U86955; AAB58780.1; JOINED; Genomic_DNA.
EMBL; U86956; AAB58780.1; JOINED; Genomic_DNA.
EMBL; U86957; AAB58780.1; JOINED; Genomic_DNA.
EMBL; U86958; AAB58780.1; JOINED; Genomic_DNA.
EMBL; U86959; AAB58780.1; JOINED; Genomic_DNA.
EMBL; U86961; AAB58781.1; ALT_SEQ; Genomic_DNA.
EMBL; U86952; AAB58781.1; JOINED; Genomic_DNA.
EMBL; U86953; AAB58781.1; JOINED; Genomic_DNA.
EMBL; U86954; AAB58781.1; JOINED; Genomic_DNA.
EMBL; U86955; AAB58781.1; JOINED; Genomic_DNA.
EMBL; U86956; AAB58781.1; JOINED; Genomic_DNA.
EMBL; U86957; AAB58781.1; JOINED; Genomic_DNA.
EMBL; U86958; AAB58781.1; JOINED; Genomic_DNA.
EMBL; U86959; AAB58781.1; JOINED; Genomic_DNA.
EMBL; U86960; AAB58781.1; JOINED; Genomic_DNA.
EMBL; AK289729; BAF82418.1; -; mRNA.
EMBL; CH471152; EAW60562.1; -; Genomic_DNA.
EMBL; BC037311; AAH37311.2; -; mRNA.
EMBL; Z21725; CAA79824.1; -; Genomic_DNA.
EMBL; Z21726; CAA79825.1; ALT_INIT; Genomic_DNA.
CCDS; CCDS11334.1; -. [Q02641-2]
CCDS; CCDS42311.1; -. [Q02641-1]
CCDS; CCDS45665.1; -. [Q02641-3]
PIR; A44461; A44461.
PIR; B44461; B44461.
PIR; C44461; C44461.
PIR; I38002; I38002.
PIR; I52859; I52859.
PIR; I65766; I65766.
PIR; I65767; I65767.
PIR; JH0566; JH0566.
RefSeq; NP_000714.3; NM_000723.4. [Q02641-1]
RefSeq; NP_954855.1; NM_199247.2. [Q02641-2]
RefSeq; NP_954856.1; NM_199248.2. [Q02641-3]
UniGene; Hs.635; -.
ProteinModelPortal; Q02641; -.
SMR; Q02641; -.
BioGrid; 107236; 9.
ComplexPortal; CPX-3192; Skeletal muscle VGCC complex.
CORUM; Q02641; -.
IntAct; Q02641; 3.
MINT; Q02641; -.
STRING; 9606.ENSP00000377840; -.
ChEMBL; CHEMBL3988640; -.
DrugBank; DB04855; Dronedarone.
DrugBank; DB00898; Ethanol.
DrugBank; DB00308; Ibutilide.
DrugBank; DB00653; Magnesium Sulfate.
DrugBank; DB01388; Mibefradil.
DrugBank; DB00393; Nimodipine.
DrugBank; DB00421; Spironolactone.
DrugBank; DB00661; Verapamil.
iPTMnet; Q02641; -.
PhosphoSitePlus; Q02641; -.
BioMuta; CACNB1; -.
DMDM; 20455481; -.
MaxQB; Q02641; -.
PaxDb; Q02641; -.
PeptideAtlas; Q02641; -.
PRIDE; Q02641; -.
ProteomicsDB; 58113; -.
ProteomicsDB; 58114; -. [Q02641-2]
ProteomicsDB; 58115; -. [Q02641-3]
DNASU; 782; -.
Ensembl; ENST00000344140; ENSP00000345461; ENSG00000067191. [Q02641-2]
Ensembl; ENST00000394303; ENSP00000377840; ENSG00000067191. [Q02641-1]
Ensembl; ENST00000394310; ENSP00000377847; ENSG00000067191. [Q02641-3]
GeneID; 782; -.
KEGG; hsa:782; -.
UCSC; uc002hrm.2; human. [Q02641-1]
CTD; 782; -.
DisGeNET; 782; -.
EuPathDB; HostDB:ENSG00000067191.15; -.
GeneCards; CACNB1; -.
HGNC; HGNC:1401; CACNB1.
HPA; HPA023343; -.
MIM; 114207; gene.
neXtProt; NX_Q02641; -.
OpenTargets; ENSG00000067191; -.
PharmGKB; PA87; -.
eggNOG; KOG3812; Eukaryota.
eggNOG; ENOG410XRDI; LUCA.
GeneTree; ENSGT00940000153659; -.
HOVERGEN; HBG050765; -.
InParanoid; Q02641; -.
KO; K04862; -.
OMA; RQGSWEE; -.
OrthoDB; EOG091G09C1; -.
PhylomeDB; Q02641; -.
TreeFam; TF316195; -.
Reactome; R-HSA-112308; Presynaptic depolarization and calcium channel opening.
Reactome; R-HSA-419037; NCAM1 interactions.
Reactome; R-HSA-5576892; Phase 0 - rapid depolarisation.
Reactome; R-HSA-5576893; Phase 2 - plateau phase.
GeneWiki; CACNB1; -.
GenomeRNAi; 782; -.
PRO; PR:Q02641; -.
Proteomes; UP000005640; Chromosome 17.
Bgee; ENSG00000067191; Expressed in 183 organ(s), highest expression level in gastrocnemius.
CleanEx; HS_CACNB1; -.
ExpressionAtlas; Q02641; baseline and differential.
Genevisible; Q02641; HS.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0042383; C:sarcolemma; IEA:UniProtKB-SubCell.
GO; GO:0005891; C:voltage-gated calcium channel complex; IBA:GO_Central.
GO; GO:0008331; F:high voltage-gated calcium channel activity; IBA:GO_Central.
GO; GO:0005245; F:voltage-gated calcium channel activity; IGI:ARUK-UCL.
GO; GO:1904646; P:cellular response to amyloid-beta; IGI:ARUK-UCL.
GO; GO:0007268; P:chemical synaptic transmission; IBA:GO_Central.
GO; GO:0007528; P:neuromuscular junction development; IBA:GO_Central.
GO; GO:1902514; P:regulation of calcium ion transmembrane transport via high voltage-gated calcium channel; IGI:ARUK-UCL.
GO; GO:1901385; P:regulation of voltage-gated calcium channel activity; IBA:GO_Central.
InterPro; IPR008145; GK/Ca_channel_bsu.
InterPro; IPR027417; P-loop_NTPase.
InterPro; IPR036028; SH3-like_dom_sf.
InterPro; IPR001452; SH3_domain.
InterPro; IPR005443; VDCC_L_b1su.
InterPro; IPR000584; VDCC_L_bsu.
PANTHER; PTHR11824; PTHR11824; 1.
Pfam; PF00625; Guanylate_kin; 1.
Pfam; PF12052; VGCC_beta4Aa_N; 1.
PRINTS; PR01626; LCACHANNELB.
PRINTS; PR01627; LCACHANNELB1.
SMART; SM00072; GuKc; 1.
SUPFAM; SSF50044; SSF50044; 1.
SUPFAM; SSF52540; SSF52540; 1.
PROSITE; PS50002; SH3; 1.
1: Evidence at protein level;
Alternative splicing; Calcium; Calcium channel; Calcium transport;
Cell membrane; Complete proteome; Ion channel; Ion transport;
Membrane; Phosphoprotein; Polymorphism; Reference proteome;
SH3 domain; Transport; Voltage-gated channel.
CHAIN 1 598 Voltage-dependent L-type calcium channel
subunit beta-1.
/FTId=PRO_0000144046.
DOMAIN 100 169 SH3. {ECO:0000255|PROSITE-
ProRule:PRU00192}.
MOD_RES 44 44 Phosphoserine.
{ECO:0000250|UniProtKB:P54283}.
MOD_RES 47 47 Phosphoserine.
{ECO:0000250|UniProtKB:P54283}.
MOD_RES 73 73 Phosphoserine.
{ECO:0000250|UniProtKB:P54283}.
MOD_RES 186 186 Phosphoserine.
{ECO:0000250|UniProtKB:Q8R3Z5}.
MOD_RES 193 193 Phosphoserine.
{ECO:0000250|UniProtKB:P54283}.
MOD_RES 499 499 Phosphothreonine.
{ECO:0000250|UniProtKB:Q8R3Z5}.
MOD_RES 547 547 Phosphoserine.
{ECO:0000250|UniProtKB:Q8R3Z5}.
VAR_SEQ 210 216 AKQKQKS -> GNEMTNLAFELDPLELEEEEAELGEQSGSA
KTSVSSVTTPPPHGKRIPFFKK (in isoform 2).
{ECO:0000303|PubMed:1385409,
ECO:0000303|PubMed:7916667}.
/FTId=VSP_000623.
VAR_SEQ 445 478 GPYLASGDQPLERATGEHASMHEYPGELGQPPGL -> VQV
LTSLRRNLGFWGGLESSQRGSVVPQEQEHAM (in
isoform 2 and isoform 3).
{ECO:0000303|PubMed:1309651,
ECO:0000303|PubMed:1385409,
ECO:0000303|PubMed:7916667,
ECO:0000303|PubMed:8107964}.
/FTId=VSP_000624.
VAR_SEQ 479 598 Missing (in isoform 2 and isoform 3).
{ECO:0000303|PubMed:1309651,
ECO:0000303|PubMed:1385409,
ECO:0000303|PubMed:7916667,
ECO:0000303|PubMed:8107964}.
/FTId=VSP_000625.
VARIANT 339 339 P -> L (in a colorectal cancer sample;
somatic mutation; dbSNP:rs1266205915).
{ECO:0000269|PubMed:16959974}.
/FTId=VAR_036349.
CONFLICT 5 6 TS -> SG (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 21 21 E -> G (in Ref. 2; AAA51894).
{ECO:0000305}.
CONFLICT 28 28 Missing (in Ref. 3; AAA36168/AAA36169).
{ECO:0000305}.
CONFLICT 29 29 G -> R (in Ref. 3; AAA36167/AAA36168/
AAA36169). {ECO:0000305}.
CONFLICT 135 135 H -> D (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 175 176 KL -> TV (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 182 182 G -> S (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 217 217 T -> S (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 264 264 I -> T (in Ref. 8; AAH37311).
{ECO:0000305}.
CONFLICT 293 296 SNTR -> LQHT (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 344 344 I -> L (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 381 381 P -> H (in Ref. 8; AAH37311).
{ECO:0000305}.
CONFLICT 428 428 M -> I (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 434 435 AA -> RR (in Ref. 1; AAA35631/AAA35632/
AAA35633 and 5; AAB58779/AAB58780/
AAB58781). {ECO:0000305}.
CONFLICT 456 456 E -> D (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 465 465 M -> V (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 482 482 S -> N (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 492 492 R -> W (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 515 515 L -> P (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 532 532 L -> P (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 539 541 GTP -> A (in Ref. 1; AAA35633 and 5;
AAB58781). {ECO:0000305}.
CONFLICT 550 550 Missing (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 559 559 L -> M (in Ref. 3; AAA36167).
{ECO:0000305}.
CONFLICT 573 574 CA -> WP (in Ref. 1; AAA35633 and 5;
AAB58781). {ECO:0000305}.
CONFLICT 593 593 R -> Q (in Ref. 3; AAA36167).
{ECO:0000305}.
SEQUENCE 598 AA; 65714 MW; 44FE4E3BA6F016FD CRC64;
MVQKTSMSRG PYPPSQEIPM EVFDPSPQGK YSKRKGRFKR SDGSTSSDTT SNSFVRQGSA
ESYTSRPSDS DVSLEEDREA LRKEAERQAL AQLEKAKTKP VAFAVRTNVG YNPSPGDEVP
VQGVAITFEP KDFLHIKEKY NNDWWIGRLV KEGCEVGFIP SPVKLDSLRL LQEQKLRQNR
LGSSKSGDNS SSSLGDVVTG TRRPTPPASA KQKQKSTEHV PPYDVVPSMR PIILVGPSLK
GYEVTDMMQK ALFDFLKHRF DGRISITRVT ADISLAKRSV LNNPSKHIII ERSNTRSSLA
EVQSEIERIF ELARTLQLVA LDADTINHPA QLSKTSLAPI IVYIKITSPK VLQRLIKSRG
KSQSKHLNVQ IAASEKLAQC PPEMFDIILD ENQLEDACEH LAEYLEAYWK ATHPPSSTPP
NPLLNRTMAT AALAASPAPV SNLQGPYLAS GDQPLERATG EHASMHEYPG ELGQPPGLYP
SSHPPGRAGT LRALSRQDTF DADTPGSRNS AYTELGDSCV DMETDPSEGP GLGDPAGGGT
PPARQGSWED EEEDYEEELT DNRNRGRNKA RYCAEGGGPV LGRNKNELEG WGRGVYIR


Related products :

Catalog number Product name Quantity
EIAAB05042 CAB1,CACNB1,CACNLB1,Calcium channel voltage-dependent subunit beta 1,Oryctolagus cuniculus,Rabbit,Voltage-dependent L-type calcium channel subunit beta-1
EIAAB05045 CAB1,CACNB1,CACNLB1,Calcium channel voltage-dependent subunit beta 1,Homo sapiens,Human,Voltage-dependent L-type calcium channel subunit beta-1
EIAAB05043 CAB1,Cacnb1,Cacnlb1,Calcium channel voltage-dependent subunit beta 1,Rat,Rattus norvegicus,Voltage-dependent L-type calcium channel subunit beta-1
EIAAB05041 CAB1,Cacnb1,Cacnlb1,Calcium channel voltage-dependent subunit beta 1,Mouse,Mus musculus,Voltage-dependent L-type calcium channel subunit beta-1
EIAAB05044 Bos taurus,Bovine,CAB1,CACNB1,Calcium channel voltage-dependent subunit beta 1,Voltage-dependent L-type calcium channel subunit beta-1
18-003-42610 Voltage-dependent L-type calcium channel subunit beta-1 - CAB1; Calcium channel voltage-dependent subunit beta 1 Polyclonal 0.05 mg Aff Pur
18-003-42829 Voltage-dependent L-type calcium channel subunit beta-2 - CAB2; Calcium channel voltage-dependent subunit beta 2; Lambert-Eaton myasthenic syndrome antigen B; MYSB Polyclonal 0.05 mg Aff Pur
18-003-42828 Voltage-dependent L-type calcium channel subunit beta-2 - CAB2; Calcium channel voltage-dependent subunit beta 2; Lambert-Eaton myasthenic syndrome antigen B; MYSB Polyclonal 0.05 mg Aff Pur
18-003-42611 Voltage-dependent L-type calcium channel subunit beta-2 - CAB2; Calcium channel voltage-dependent subunit beta 2; Lambert-Eaton myasthenic syndrome antigen B; MYSB Polyclonal 0.1 mg Protein A
EIAAB05054 CAB3,CACNB3,CACNLB3,Calcium channel voltage-dependent subunit beta 3,Homo sapiens,Human,Voltage-dependent L-type calcium channel subunit beta-3
EIAAB05057 CAB4,CACNB4,CACNLB4,Calcium channel voltage-dependent subunit beta 4,Homo sapiens,Human,Voltage-dependent L-type calcium channel subunit beta-4
EIAAB05055 CAB3,CACNB3,CACNLB3,Calcium channel voltage-dependent subunit beta 3,Oryctolagus cuniculus,Rabbit,Voltage-dependent L-type calcium channel subunit beta-3
EIAAB05052 CAB3,Cacnb3,Cacnlb3,Calcium channel voltage-dependent subunit beta 3,CCHB3,Mouse,Mus musculus,Voltage-dependent L-type calcium channel subunit beta-3
EIAAB05050 CAB2,CACNB2,CACNLB2,Calcium channel voltage-dependent subunit beta 2,Oryctolagus cuniculus,Rabbit,Voltage-dependent L-type calcium channel subunit beta-2
EIAAB05046 CAB2,Cacnb2,Cacnlb2,Calcium channel voltage-dependent subunit beta 2,Mouse,Mus musculus,Voltage-dependent L-type calcium channel subunit beta-2
EIAAB05056 CAB4,Cacnb4,Cacnlb4,Calcium channel voltage-dependent subunit beta 4,Mouse,Mus musculus,Voltage-dependent L-type calcium channel subunit beta-4
EIAAB05048 CAB2,Cacnb2,Cacnlb2,Calcium channel voltage-dependent subunit beta 2,Rat,Rattus norvegicus,Voltage-dependent L-type calcium channel subunit beta-2
EIAAB05051 CAB3,Cacnb3,Cacnlb3,Calcium channel voltage-dependent subunit beta 3,Rat,Rattus norvegicus,Voltage-dependent L-type calcium channel subunit beta-3
EIAAB05047 CAB2,CACNB2,CACNLB2,Calcium channel voltage-dependent subunit beta 2,Homo sapiens,Human,Lambert-Eaton myasthenic syndrome antigen B,MYSB,MYSB,Voltage-dependent L-type calcium channel subunit beta-2
EIAAB05049 Bos taurus,Bovine,CAB2,CACNB2,Calcium channel voltage-dependent subunit beta 2,Voltage-dependent L-type calcium channel subunit beta-2
EIAAB05053 Bos taurus,Bovine,CAB3,CACNB3,Calcium channel voltage-dependent subunit beta 3,Voltage-dependent L-type calcium channel subunit beta-3
18-003-43129 Voltage-dependent L-type calcium channel subunit beta-3 - CAB3; Calcium channel voltage-dependent subunit beta 3 Polyclonal 0.1 mg Protein A
EIAAB05033 CACNA1H,Homo sapiens,Human,Low-voltage-activated calcium channel alpha1 3.2 subunit,Voltage-dependent T-type calcium channel subunit alpha-1H,Voltage-gated calcium channel subunit alpha Cav3.2
28-223 The L-type calcium channel is composed of four subunits alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by 0.1 mg
25-236 The L-type calcium channel is composed of four subunits alpha-1, alpha-2, beta and gamma. The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by 0.05 mg


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur | Gentaur





GENTAUR Ltd.
Unicorn House, Station Cl
Hertfordshire, Potters Bar EN6 1TL
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017
RIB 30004 00187 00010092253 10
BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG
IBAN FR76 3000 4001 8700 0100 9225 310
france@gentaur.com | Gentaur | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: +49 0241 40 08 90 86, +49 0241 95 78 94 78, +49 0241 40 08 90 86
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur | Gentaur