Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

WASH complex subunit 2

 WASC2_MOUSE             Reviewed;        1334 AA.
Q6PGL7; Q3TQ99; Q80TW8; Q80UQ4; Q8CAP0;
05-FEB-2008, integrated into UniProtKB/Swiss-Prot.
05-JUL-2004, sequence version 1.
28-FEB-2018, entry version 89.
RecName: Full=WASH complex subunit 2 {ECO:0000312|MGI:MGI:106463};
Name=Washc2 {ECO:0000312|MGI:MGI:106463};
Synonyms=D6Wsu116e, Fam21, Kiaa0592;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Brain;
PubMed=12693553; DOI=10.1093/dnares/10.1.35;
Okazaki N., Kikuno R., Ohara R., Inamoto S., Aizawa H., Yuasa S.,
Nakajima D., Nagase T., Ohara O., Koga H.;
"Prediction of the coding sequences of mouse homologues of KIAA gene:
II. The complete nucleotide sequences of 400 mouse KIAA-homologous
cDNAs identified by screening of terminal sequences of cDNA clones
randomly sampled from size-fractionated libraries.";
DNA Res. 10:35-48(2003).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=C57BL/6J; TISSUE=Head, and Thymus;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=C57BL/6J, and FVB/N-3; TISSUE=Brain, and Mammary tumor;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Brain cortex;
PubMed=17114649; DOI=10.1074/mcp.M600046-MCP200;
Munton R.P., Tweedie-Cullen R., Livingstone-Zatchej M., Weinandy F.,
Waidelich M., Longo D., Gehrig P., Potthast F., Rutishauser D.,
Gerrits B., Panse C., Schlapbach R., Mansuy I.M.;
"Qualitative and quantitative analyses of protein phosphorylation in
naive and stimulated mouse synaptosomal preparations.";
Mol. Cell. Proteomics 6:283-293(2007).
[5]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-747, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=17242355; DOI=10.1073/pnas.0609836104;
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
"Large-scale phosphorylation analysis of mouse liver.";
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
[6]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157; SER-159; SER-284;
SER-388; SER-533; SER-613; SER-614; SER-723; SER-747; SER-1169;
SER-1172; SER-1173 AND SER-1333, AND IDENTIFICATION BY MASS
SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19144319; DOI=10.1016/j.immuni.2008.11.006;
Trost M., English L., Lemieux S., Courcelles M., Desjardins M.,
Thibault P.;
"The phagosomal proteome in interferon-gamma-activated macrophages.";
Immunity 30:143-154(2009).
[7]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-614 AND SER-747, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Embryonic fibroblast;
PubMed=19131326; DOI=10.1074/mcp.M800451-MCP200;
Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.;
"Large scale localization of protein phosphorylation by use of
electron capture dissociation mass spectrometry.";
Mol. Cell. Proteomics 8:904-912(2009).
[8]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157; THR-322; SER-533;
SER-613; SER-614; SER-723; SER-747; SER-752; SER-798; SER-870;
SER-873; SER-1169 AND SER-1172, AND IDENTIFICATION BY MASS
SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung,
Pancreas, Spleen, and Testis;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and
expression.";
Cell 143:1174-1189(2010).
[9]
INTERACTION WITH TBC1D23.
PubMed=29084197; DOI=10.1038/ncb3627;
Shin J.J.H., Gillingham A.K., Begum F., Chadwick J., Munro S.;
"TBC1D23 is a bridging factor for endosomal vesicle capture by golgins
at the trans-Golgi.";
Nat. Cell Biol. 19:1424-1432(2017).
-!- FUNCTION: Acts at least in part as component of the WASH core
complex whose assembly at the surface of endosomes inhibits WASH
nucleation-promoting factor (NPF) activity in recruiting and
activating the Arp2/3 complex to induce actin polymerization and
is involved in the fission of tubules that serve as transport
intermediates during endosome sorting. Mediates the recruitment of
the WASH core complex to endosome membranes via binding to
phospholipids and VPS35 of the retromer CSC. Mediates the
recruitment of the F-actin-capping protein dimer to the WASH core
complex probably promoting localized F-actin polymerization needed
for vesicle scission. Via its C-terminus binds various
phospholipids, most strongly phosphatidylinositol 4-phosphate
(PtdIns-(4)P), phosphatidylinositol 5-phosphate (PtdIns-(5)P) and
phosphatidylinositol 3,5-bisphosphate (PtdIns-(3,5)P2). Involved
in the endosome-to-plasma membrane trafficking and recycling of
SNX27-retromer-dependent cargo proteins, such as GLUT1. Required
for the association of DNAJC13, SDCCAG3, ANKRD50 with retromer CSC
subunit VPS35. Required for the endosomal recruitment of CCC
complex subunits COMMD1, CCDC93 and C16orf62 homolog (By
similarity). {ECO:0000250|UniProtKB:Q9Y4E1}.
-!- SUBUNIT: Component of the WASH core complex also described as WASH
regulatory complex SHRC composed of WASHC1, WASHC2, WASHC3, WASHC4
and WASHC5; in the complex interacts (via N-terminus) directly
with WASHC1. The WASH core complex associates with the F-actin-
capping protein dimer (formed by CAPZA1, CAPZA2 or CAPZA3 and
CAPZB) in a transient or substoichiometric manner which was
initially described as WASH complex. Interacts with VPS35;
mediates the association with the retromer CSC complex. Interacts
with FKBP15. Interacts with CCDC93, CCDC22, C16orf62 homolog;
indicative for an association of the WASH core complex with the
CCC complex (By similarity). Directly interacts with TBC1D23
(PubMed:29084197). {ECO:0000250|UniProtKB:Q9Y4E1,
ECO:0000269|PubMed:29084197}.
-!- SUBCELLULAR LOCATION: Early endosome membrane
{ECO:0000250|UniProtKB:Q9Y4E1}. Cell membrane
{ECO:0000250|UniProtKB:Q9Y4E1}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q6PGL7-1; Sequence=Displayed;
Name=2;
IsoId=Q6PGL7-2; Sequence=VSP_030949;
Note=No experimental confirmation available.;
-!- DOMAIN: The LFa (leucine-phenylalanine-acidic) motif bind directly
to VPS35 of retromer CSC; adjacent motifs can act cooperatively to
bind multiple CSCs, although there is significant variability in
the affinities of different motifs for retromer.
{ECO:0000250|UniProtKB:Q9Y4E1}.
-!- SIMILARITY: Belongs to the FAM21 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAH49979.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AK122320; BAC65602.2; -; Transcribed_RNA.
EMBL; AK163765; BAE37485.1; -; mRNA.
EMBL; AK038318; BAC29966.1; -; mRNA.
EMBL; BC049979; AAH49979.1; ALT_SEQ; mRNA.
EMBL; BC056942; AAH56942.1; -; mRNA.
CCDS; CCDS20450.1; -. [Q6PGL7-1]
RefSeq; NP_080861.2; NM_026585.3. [Q6PGL7-1]
UniGene; Mm.28524; -.
ProteinModelPortal; Q6PGL7; -.
SMR; Q6PGL7; -.
IntAct; Q6PGL7; 3.
MINT; Q6PGL7; -.
STRING; 10090.ENSMUSP00000038983; -.
iPTMnet; Q6PGL7; -.
PhosphoSitePlus; Q6PGL7; -.
EPD; Q6PGL7; -.
PaxDb; Q6PGL7; -.
PeptideAtlas; Q6PGL7; -.
PRIDE; Q6PGL7; -.
Ensembl; ENSMUST00000036759; ENSMUSP00000038983; ENSMUSG00000024104. [Q6PGL7-1]
GeneID; 28006; -.
KEGG; mmu:28006; -.
UCSC; uc009djs.2; mouse. [Q6PGL7-1]
CTD; 28006; -.
MGI; MGI:106463; Washc2.
eggNOG; ENOG410IEJH; Eukaryota.
eggNOG; ENOG4110AMY; LUCA.
GeneTree; ENSGT00510000047694; -.
HOGENOM; HOG000112469; -.
HOVERGEN; HBG055529; -.
InParanoid; Q6PGL7; -.
KO; K18462; -.
OMA; RIHTIFY; -.
OrthoDB; EOG091G05P8; -.
PhylomeDB; Q6PGL7; -.
TreeFam; TF329309; -.
ChiTaRS; Fam21; mouse.
PRO; PR:Q6PGL7; -.
Proteomes; UP000000589; Chromosome 6.
Bgee; ENSMUSG00000024104; -.
ExpressionAtlas; Q6PGL7; baseline and differential.
Genevisible; Q6PGL7; MM.
GO; GO:0005829; C:cytosol; ISO:MGI.
GO; GO:0005769; C:early endosome; ISS:UniProtKB.
GO; GO:0031901; C:early endosome membrane; IEA:UniProtKB-SubCell.
GO; GO:0005768; C:endosome; ISO:MGI.
GO; GO:0043231; C:intracellular membrane-bounded organelle; ISO:MGI.
GO; GO:0005730; C:nucleolus; ISO:MGI.
GO; GO:0005886; C:plasma membrane; IEA:UniProtKB-SubCell.
GO; GO:0071203; C:WASH complex; ISS:UniProtKB.
GO; GO:0005547; F:phosphatidylinositol-3,4,5-trisphosphate binding; ISO:MGI.
GO; GO:0043325; F:phosphatidylinositol-3,4-bisphosphate binding; ISO:MGI.
GO; GO:0080025; F:phosphatidylinositol-3,5-bisphosphate binding; ISO:MGI.
GO; GO:0032266; F:phosphatidylinositol-3-phosphate binding; ISO:MGI.
GO; GO:0005546; F:phosphatidylinositol-4,5-bisphosphate binding; ISO:MGI.
GO; GO:0070273; F:phosphatidylinositol-4-phosphate binding; ISO:MGI.
GO; GO:0010314; F:phosphatidylinositol-5-phosphate binding; ISO:MGI.
GO; GO:1905394; F:retromer complex binding; ISO:MGI.
GO; GO:0015031; P:protein transport; IEA:UniProtKB-KW.
GO; GO:0042147; P:retrograde transport, endosome to Golgi; ISS:UniProtKB.
InterPro; IPR027308; FAM21.
InterPro; IPR029341; FAM21/CAPZIP.
PANTHER; PTHR21669:SF24; PTHR21669:SF24; 1.
Pfam; PF15255; CAP-ZIP_m; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome; Endosome;
Membrane; Phosphoprotein; Protein transport; Reference proteome;
Transport.
CHAIN 1 1334 WASH complex subunit 2.
/FTId=PRO_0000317433.
REGION 1 219 Sufficient for interaction with WASHC3,
WASHC4 and WASHC5; required for
interaction with WASHC1.
{ECO:0000250|UniProtKB:Q9Y4E1}.
REGION 347 594 Sufficient for interaction with CCDC93.
{ECO:0000250|UniProtKB:Q9Y4E1}.
REGION 348 1334 Interaction with VPS35.
{ECO:0000250|UniProtKB:Q9Y4E1}.
REGION 932 1334 Interaction with phospholipids.
{ECO:0000250|UniProtKB:Q9Y4E1}.
REGION 1024 1042 Required for interaction with F-actin-
capping protein subunit alpha (CAPZA1 or
CAPZA2 or CAPZA3).
{ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 358 368 LFa 1. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 441 457 LFa 2. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 476 485 LFa 3. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 531 542 LFa 4. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 566 577 LFa 5. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 658 670 LFa 6. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 686 698 LFa 7. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 835 843 LFa 8. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 852 858 LFa 9. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 874 884 LFa 10. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 1124 1131 LFa 11. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 1164 1178 LFa 12. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 1194 1202 LFa 13. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 1227 1233 LFa 14. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 1255 1263 LFa 15. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 1283 1292 LFa 16. {ECO:0000250|UniProtKB:Q9Y4E1}.
MOTIF 1323 1331 LFa 17. {ECO:0000250|UniProtKB:Q9Y4E1}.
COMPBIAS 221 228 Poly-Glu.
COMPBIAS 443 453 Poly-Asp.
COMPBIAS 661 665 Poly-Asp.
COMPBIAS 780 783 Poly-Ser.
MOD_RES 157 157 Phosphoserine.
{ECO:0000244|PubMed:19144319,
ECO:0000244|PubMed:21183079}.
MOD_RES 159 159 Phosphoserine.
{ECO:0000244|PubMed:19144319}.
MOD_RES 204 204 Phosphoserine.
{ECO:0000250|UniProtKB:Q80X08}.
MOD_RES 205 205 Phosphoserine.
{ECO:0000250|UniProtKB:Q80X08}.
MOD_RES 209 209 Phosphoserine.
{ECO:0000250|UniProtKB:Q80X08}.
MOD_RES 284 284 Phosphoserine.
{ECO:0000244|PubMed:19144319}.
MOD_RES 322 322 Phosphothreonine.
{ECO:0000244|PubMed:21183079}.
MOD_RES 388 388 Phosphoserine.
{ECO:0000244|PubMed:19144319}.
MOD_RES 533 533 Phosphoserine.
{ECO:0000244|PubMed:19144319,
ECO:0000244|PubMed:21183079}.
MOD_RES 538 538 Phosphoserine.
{ECO:0000250|UniProtKB:Q80X08}.
MOD_RES 613 613 Phosphoserine.
{ECO:0000244|PubMed:19144319,
ECO:0000244|PubMed:21183079}.
MOD_RES 614 614 Phosphoserine.
{ECO:0000244|PubMed:19131326,
ECO:0000244|PubMed:19144319,
ECO:0000244|PubMed:21183079}.
MOD_RES 723 723 Phosphoserine.
{ECO:0000244|PubMed:19144319,
ECO:0000244|PubMed:21183079}.
MOD_RES 747 747 Phosphoserine.
{ECO:0000244|PubMed:17242355,
ECO:0000244|PubMed:19131326,
ECO:0000244|PubMed:19144319,
ECO:0000244|PubMed:21183079}.
MOD_RES 752 752 Phosphoserine.
{ECO:0000244|PubMed:21183079}.
MOD_RES 783 783 Phosphoserine.
{ECO:0000250|UniProtKB:Q80X08}.
MOD_RES 798 798 Phosphoserine.
{ECO:0000244|PubMed:21183079}.
MOD_RES 870 870 Phosphoserine.
{ECO:0000244|PubMed:21183079}.
MOD_RES 873 873 Phosphoserine.
{ECO:0000244|PubMed:21183079}.
MOD_RES 1049 1049 Phosphoserine.
{ECO:0000250|UniProtKB:Q641Q2}.
MOD_RES 1067 1067 Phosphoserine.
{ECO:0000250|UniProtKB:Q80X08}.
MOD_RES 1084 1084 Phosphoserine.
{ECO:0000250|UniProtKB:Q641Q2}.
MOD_RES 1109 1109 Phosphoserine.
{ECO:0000250|UniProtKB:Q641Q2}.
MOD_RES 1169 1169 Phosphoserine.
{ECO:0000244|PubMed:19144319,
ECO:0000244|PubMed:21183079}.
MOD_RES 1172 1172 Phosphoserine.
{ECO:0000244|PubMed:19144319,
ECO:0000244|PubMed:21183079}.
MOD_RES 1173 1173 Phosphoserine.
{ECO:0000244|PubMed:19144319}.
MOD_RES 1333 1333 Phosphoserine.
{ECO:0000244|PubMed:19144319}.
VAR_SEQ 866 952 SSVPSGGSLFGDDEDDDLFSSAKTQPVVPEKKGTLKKDHPV
SLKNQDPLDSTQGSKEKSTWKTEPAQDSSGLTPFKSREPSS
RIGKI -> V (in isoform 2).
{ECO:0000303|PubMed:12693553}.
/FTId=VSP_030949.
CONFLICT 385 385 L -> S (in Ref. 3; AAH49979).
{ECO:0000305}.
CONFLICT 556 556 P -> S (in Ref. 3; AAH49979).
{ECO:0000305}.
CONFLICT 630 630 A -> V (in Ref. 1; BAC65602).
{ECO:0000305}.
CONFLICT 910 910 N -> S (in Ref. 2; BAC29966).
{ECO:0000305}.
SEQUENCE 1334 AA; 145311 MW; AD35C3FFAC27C159 CRC64;
MNRTSPDSER PPASEPVWER PWSVEEIRRS SQNWSLAADA GLLQFLQEFS QQTISRTHEI
KKQVDGLIQE TKATHCRLHN VFNDFLMLSN TQFIENRVYD EEVEEQVLKA EAEKAEQEKT
REQKEIDLIP KVQEAVNYGL QVLDSAFEQL DIKAGNSDSE EDDANERVDL ILEPKDLYID
RPLPYLIGSK LFMEQEDVGL GELSSEEGSV GSDRGSIVDS EDEKEEEESD EDFASHSDND
QNQHTTQISD EEEDDDGDLF ADSEKEGDDI EDIEESAKSK RPTSFADELA ARIKGDISNQ
RKEGQTDGKP QKTVKEKKER RTPADDEEDI LFPPPTLTDE DFSPFGSRGG LFSNGQGLFD
DEDESDLFKE APRARPAQAP VSEELPPSPK PGKKIPAGAV SVLLGHPDVS GSTSAPSLKE
LQKHGQPTPG KSSHLPTPAG LFDDDDNDND EDDNNFFMPS SSKPSKTDKV KSTAIIFDDD
EGDLFKEKAE ALPAASVSQT HESKTRADKT IALPSSKNLK LVSETKTQKG LFSDEEDSED
LFSSQSSSKP KSASLPSSQP PTSVSLFGDE DEEDSLFGSA AAKKQTSSLQ PQSQEKAKPS
EQPSKKTSAL LFSSDEEDQW NIADSHTKLA SDNKSKGELW DSGATQGQEA KAVKKTNLFE
DDDDDEVDLF AIAKDSQKKT QRTSLLFEDD AESGSSLFGL PPTSVPSATT KKESVPKVPL
LFSDEEDSEV PSGVKPEDLK VDNARVSPEV GSADVASIAQ KEGLLPASDQ EAGGPSDIFS
SSSPLDKGAK GRTRTVLSLF DEDEDKVEDE SSTCAPQDGR EKGLKTDSRP KSTGVFQDEE
LLFSHKLQKD NDPDVDLFAG TKKIRSSVPS GGSLFGDDED DDLFSSAKTQ PVVPEKKGTL
KKDHPVSLKN QDPLDSTQGS KEKSTWKTEP AQDSSGLTPF KSREPSSRIG KIQANLAINP
AALLPTVALQ IPGTKPVSSE LAFPSSEPGR SHILESVPTL PGSVEAGVSF DLPAQADTLH
SANKSRVKVR GKRRPQTRAA RRLAAQESSE AEDVTVDRGP VAQLSSSPVL PNGHQPLLQP
RMASGQTSSE TATAPPWEGG PVLSAADRSF FVKSRPQTGN EADLFDSGDI FPKSRGSQSV
EGAGVMAGEP PSHSSGGRKE KSLAFPDLSE GSSTEDLFQS VKPRAAKNRN PFPLLEDEED
LFADPRGKKN ERKPDSHQDS VSKTHDIFED DIFATEAIKP FPKKREKGRT LEPNLFDDNI
DIFADLTVKP KEKSKKKVAA KSMFDDDTDD IFSSGLQAKA SKPKSQSAEA ASEQRSEHKV
ASIFDDPLNA FGSQ


Related products :

Catalog number Product name Quantity
WASH7_MOUSE Mouse ELISA Kit FOR WASH complex subunit 7 96T
I2567 WASH complex subunit 7 (KIAA1033), Mouse, ELISA Kit 96T
I2566 WASH complex subunit 7 (KIAA1033), Human, ELISA Kit 96T
'AP55395SU-N WASH complex subunit-7 antibody Ab host: Rabbit 0.2 ml
EIAAB46061 Kiaa1033,Mouse,Mus musculus,WASH complex subunit 7
CSB-EL012225HU Human WASH complex subunit 7(KIAA1033) ELISA kit 96T
CSB-EL012225MO Mouse WASH complex subunit 7(KIAA1033) ELISA kit 96T
CSB-EL012174MO Mouse WASH complex subunit strumpellin(KIAA0196) ELISA kit 96T
CSB-EL012225HU Human WASH complex subunit 7(KIAA1033) ELISA kit SpeciesHuman 96T
CSB-EL012174HU Human WASH complex subunit strumpellin(KIAA0196) ELISA kit 96T
CSB-EL012225MO Mouse WASH complex subunit 7(KIAA1033) ELISA kit SpeciesMouse 96T
I2574 WASH complex subunit strumpellin (KIAA0196), Human, ELISA Kit 96T
I2575 WASH complex subunit strumpellin (KIAA0196), Mouse, ELISA Kit 96T
EIAAB46062 Homo sapiens,Human,KIAA1033,WASH complex subunit 7
EIAAB40428 Kiaa0196,Mouse,Mus musculus,WASH complex subunit strumpellin
EIAAB33312 Complex III subunit 8,Complex III subunit VIII,Cytochrome b-c1 complex subunit 8,Low molecular mass ubiquinone-binding protein,Qpc,Rat,Rattus norvegicus,Ubiquinol-cytochrome c reductase complex 9.5 kD
CSB-EL008178HU Human Putative WASH complex subunit FAM21(FAM21D) ELISA kit 96T
EIAAB40427 Homo sapiens,Human,KIAA0196,WASH complex subunit strumpellin
CSB-EL012174MO Mouse WASH complex subunit strumpellin(KIAA0196) ELISA kit SpeciesMouse 96T
CSB-EL012174HU Human WASH complex subunit strumpellin(KIAA0196) ELISA kit SpeciesHuman 96T
G5787 Putative WASH complex subunit FAM21 (FAM21D), Human, ELISA Kit 96T
EIAAB33299 Complex III subunit 10,Complex III subunit XI,Cytochrome b-c1 complex subunit 10,Homo sapiens,Human,Ubiquinol-cytochrome c reductase complex 6.4 kDa protein,UQCR,UQCR11
EIAAB33310 Complex III subunit 7,Complex III subunit VII,Cytochrome b-c1 complex subunit 7,Homo sapiens,Human,QP-C,Ubiquinol-cytochrome c reductase complex 14 kDa protein,UQBP,UQCRB
EIAAB14062 FAM21D,Homo sapiens,Human,Putative WASH complex subunit FAM21
CSB-EL008178HU Human Putative WASH complex subunit FAM21(FAM21D) ELISA kit SpeciesHuman 96T


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur