Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Zinc finger protein ZFPM2 (Friend of GATA protein 2) (FOG-2) (Friend of GATA 2) (hFOG-2) (Zinc finger protein 89B) (Zinc finger protein multitype 2)

 FOG2_HUMAN              Reviewed;        1151 AA.
Q8WW38; Q32MA6; Q9NPL7; Q9NPS4; Q9UNI5;
15-MAR-2004, integrated into UniProtKB/Swiss-Prot.
20-FEB-2007, sequence version 3.
12-SEP-2018, entry version 140.
RecName: Full=Zinc finger protein ZFPM2;
AltName: Full=Friend of GATA protein 2;
Short=FOG-2;
Short=Friend of GATA 2;
Short=hFOG-2;
AltName: Full=Zinc finger protein 89B;
AltName: Full=Zinc finger protein multitype 2;
Name=ZFPM2; Synonyms=FOG2, ZNF89B;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY,
INTERACTION WITH CTBP2, AND POSSIBLE INTERACTION WITH GATA1.
TISSUE=Erythroleukemia;
PubMed=10438528; DOI=10.1074/jbc.274.33.23491;
Holmes M., Turner J., Fox A.H., Chisholm O., Crossley M., Chong B.;
"hFOG-2, a novel zinc finger protein, binds the co-repressor mCtBP2
and modulates GATA-mediated activation.";
J. Biol. Chem. 274:23491-23498(1999).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Prostate;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-287 (ISOFORM 2), AND
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 641-1151 (ISOFORM 1).
The European IMAGE consortium;
Submitted (JUL-2000) to the EMBL/GenBank/DDBJ databases.
[4]
SUMOYLATION AT LYS-324; LYS-471; LYS-915 AND LYS-955, AND SUBCELLULAR
LOCATION.
PubMed=23226341; DOI=10.1371/journal.pone.0050637;
Perdomo J., Jiang X.M., Carter D.R., Khachigian L.M., Chong B.H.;
"SUMOylation regulates the transcriptional repression activity of FOG-
2 and its association with GATA-4.";
PLoS ONE 7:E50637-E50637(2012).
[5]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-532; SER-581; SER-904
AND SER-1014, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[6]
INTERACTION WITH GATA4, INVOLVEMENT IN SRXY9, VARIANTS SRXY9 GLN-260;
ARG-402 AND ILE-544, VARIANTS GLY-403 AND ASP-782, AND
CHARACTERIZATION OF VARIANTS GLN-260 AND ARG-402.
PubMed=24549039; DOI=10.1093/hmg/ddu074;
Bashamboo A., Brauner R., Bignon-Topalovic J., Lortat-Jacob S.,
Karageorgou V., Lourenco D., Guffanti A., McElreavey K.;
"Mutations in the FOG2/ZFPM2 gene are associated with anomalies of
human testis determination.";
Hum. Mol. Genet. 23:3657-3665(2014).
[7]
SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-444, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=28112733; DOI=10.1038/nsmb.3366;
Hendriks I.A., Lyon D., Young C., Jensen L.J., Vertegaal A.C.,
Nielsen M.L.;
"Site-specific mapping of the human SUMO proteome reveals co-
modification with phosphorylation.";
Nat. Struct. Mol. Biol. 24:325-336(2017).
[8]
VARIANTS TOF GLY-30 AND GLY-657, AND CHARACTERIZATION OF VARIANTS TOF
GLY-30 AND GLY-657.
PubMed=14517948; DOI=10.1002/humu.10261;
Pizzuti A., Sarkozy A., Newton A.L., Conti E., Flex E., Digilio M.C.,
Amati F., Gianni D., Tandoi C., Marino B., Crossley M.,
Dallapiccola B.;
"Mutations of ZFPM2/FOG2 gene in sporadic cases of tetralogy of
Fallot.";
Hum. Mutat. 22:372-377(2003).
[9]
INVOLVEMENT IN DIH3.
PubMed=16103912; DOI=10.1371/journal.pgen.0010010;
Ackerman K.G., Herron B.J., Vargas S.O., Huang H., Tevosian S.G.,
Kochilas L., Rao C., Pober B.R., Babiuk R.P., Epstein J.A.,
Greer J.J., Beier D.R.;
"Fog2 is required for normal diaphragm and lung development in mice
and humans.";
PLoS Genet. 1:58-65(2005).
[10]
VARIANT TOF ILE-544, AND VARIANTS CTHM GLY-30 AND VAL-227.
PubMed=20807224; DOI=10.1111/j.1399-0004.2010.01523.x;
De Luca A., Sarkozy A., Ferese R., Consoli F., Lepri F., Dentici M.L.,
Vergara P., De Zorzi A., Versacci P., Digilio M.C., Marino B.,
Dallapiccola B.;
"New mutations in ZFPM2/FOG2 gene in tetralogy of Fallot and double
outlet right ventricle.";
Clin. Genet. 80:184-190(2011).
-!- FUNCTION: Transcription regulator that plays a central role in
heart morphogenesis and development of coronary vessels from
epicardium, by regulating genes that are essential during
cardiogenesis. Essential cofactor that acts via the formation of a
heterodimer with transcription factors of the GATA family GATA4,
GATA5 and GATA6. Such heterodimer can both activate or repress
transcriptional activity, depending on the cell and promoter
context. Also required in gonadal differentiation, possibly be
regulating expression of SRY. Probably acts a corepressor of NR2F2
(By similarity). {ECO:0000250, ECO:0000269|PubMed:10438528}.
-!- SUBUNIT: Interacts with the N-terminal zinc-finger of GATA4, GATA5
and probably GATA6. Interacts with retinoid nuclear receptor RXRA
when ligand bound (By similarity). Interacts with corepressor
CTBP2; this interaction is however not essential for corepressor
activity. Able to bind GATA1 in vitro. Interacts with NR2F2 and
NR2F6 (By similarity). Interacts with ATOH8; mediates indirect
interaction with GATA4 (By similarity).
{ECO:0000250|UniProtKB:Q8WW38, ECO:0000269|PubMed:10438528,
ECO:0000269|PubMed:24549039}.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:23226341}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q8WW38-1; Sequence=Displayed;
Name=2;
IsoId=Q8WW38-2; Sequence=VSP_009701, VSP_009702;
Note=Sequence incomplete. No experimental confirmation
available.;
-!- TISSUE SPECIFICITY: Widely expressed at low level.
{ECO:0000269|PubMed:10438528}.
-!- DOMAIN: The CCHC FOG-type zinc fingers 1, 2, 3 and 5 directly bind
to GATA-type zinc fingers. The Tyr residue adjacent to the last
Cys of the CCHC FOG-type zinc finger is essential for the
interaction with GATA-type zinc fingers (By similarity).
{ECO:0000250}.
-!- PTM: Sumoylation reduces transcriptional repression activity.
{ECO:0000269|PubMed:23226341}.
-!- DISEASE: Tetralogy of Fallot (TOF) [MIM:187500]: A congenital
heart anomaly which consists of pulmonary stenosis, ventricular
septal defect, dextroposition of the aorta (aorta is on the right
side instead of the left) and hypertrophy of the right ventricle.
In this condition, blood from both ventricles (oxygen-rich and
oxygen-poor) is pumped into the body often causing cyanosis.
{ECO:0000269|PubMed:14517948, ECO:0000269|PubMed:20807224}.
Note=The disease may be caused by mutations affecting the gene
represented in this entry.
-!- DISEASE: Diaphragmatic hernia 3 (DIH3) [MIM:610187]: Form of
congenital diaphragmatic hernia (CDH). CDH refers to a group of
congenital defects in the structural integrity of the diaphragm
associated with often lethal pulmonary hypoplasia and pulmonary
hypertension. {ECO:0000269|PubMed:16103912}. Note=The disease is
caused by mutations affecting the gene represented in this entry.
-!- DISEASE: 46,XY sex reversal 9 (SRXY9) [MIM:616067]: A disorder of
sex development. Affected individuals have a 46,XY karyotype but
present as phenotypically normal females or have ambiguous
external genitalia. {ECO:0000269|PubMed:24549039}. Note=The
disease is caused by mutations affecting the gene represented in
this entry.
-!- DISEASE: Conotruncal heart malformations (CTHM) [MIM:217095]: A
group of congenital heart defects involving the outflow tracts.
Examples include truncus arteriosus communis, double-outlet right
ventricle and transposition of great arteries. Truncus arteriosus
communis is characterized by a single outflow tract instead of a
separate aorta and pulmonary artery. In transposition of the great
arteries, the aorta arises from the right ventricle and the
pulmonary artery from the left ventricle. In double outlet of the
right ventricle, both the pulmonary artery and aorta arise from
the right ventricle. {ECO:0000269|PubMed:20807224}. Note=The
disease is caused by mutations affecting the gene represented in
this entry.
-!- SIMILARITY: Belongs to the FOG (Friend of GATA) family.
{ECO:0000255|PROSITE-ProRule:PRU01153}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF119334; AAD49558.1; -; mRNA.
EMBL; BC020928; AAH20928.1; -; mRNA.
EMBL; BC109222; AAI09223.1; -; mRNA.
EMBL; AL389987; CAB97539.1; -; mRNA.
EMBL; AL389989; CAB97541.1; -; mRNA.
CCDS; CCDS47908.1; -. [Q8WW38-1]
RefSeq; NP_036214.2; NM_012082.3. [Q8WW38-1]
UniGene; Hs.431009; -.
ProteinModelPortal; Q8WW38; -.
SMR; Q8WW38; -.
BioGrid; 116986; 15.
ELM; Q8WW38; -.
IntAct; Q8WW38; 4.
STRING; 9606.ENSP00000384179; -.
iPTMnet; Q8WW38; -.
PhosphoSitePlus; Q8WW38; -.
BioMuta; ZFPM2; -.
DMDM; 126302543; -.
MaxQB; Q8WW38; -.
PaxDb; Q8WW38; -.
PeptideAtlas; Q8WW38; -.
PRIDE; Q8WW38; -.
ProteomicsDB; 74858; -.
ProteomicsDB; 74859; -. [Q8WW38-2]
Ensembl; ENST00000407775; ENSP00000384179; ENSG00000169946. [Q8WW38-1]
GeneID; 23414; -.
KEGG; hsa:23414; -.
UCSC; uc003ymd.4; human. [Q8WW38-1]
CTD; 23414; -.
DisGeNET; 23414; -.
EuPathDB; HostDB:ENSG00000169946.13; -.
GeneCards; ZFPM2; -.
HGNC; HGNC:16700; ZFPM2.
HPA; HPA004094; -.
MalaCards; ZFPM2; -.
MIM; 187500; phenotype.
MIM; 217095; phenotype.
MIM; 603693; gene.
MIM; 610187; phenotype.
MIM; 616067; phenotype.
neXtProt; NX_Q8WW38; -.
OpenTargets; ENSG00000169946; -.
Orphanet; 251510; 46,XY partial gonadal dysgenesis.
Orphanet; 2140; Congenital diaphragmatic hernia.
Orphanet; 3303; Tetralogy of Fallot.
PharmGKB; PA134947303; -.
eggNOG; KOG1721; Eukaryota.
eggNOG; COG5048; LUCA.
GeneTree; ENSGT00530000063823; -.
HOGENOM; HOG000057275; -.
HOVERGEN; HBG048953; -.
InParanoid; Q8WW38; -.
KO; K17442; -.
OMA; HYCSSRW; -.
OrthoDB; EOG091G00RC; -.
PhylomeDB; Q8WW38; -.
TreeFam; TF331342; -.
Reactome; R-HSA-983231; Factors involved in megakaryocyte development and platelet production.
SIGNOR; Q8WW38; -.
ChiTaRS; ZFPM2; human.
GeneWiki; ZFPM2; -.
GenomeRNAi; 23414; -.
PRO; PR:Q8WW38; -.
Proteomes; UP000005640; Chromosome 8.
Bgee; ENSG00000169946; Expressed in 188 organ(s), highest expression level in cerebellum.
CleanEx; HS_ZFPM2; -.
ExpressionAtlas; Q8WW38; baseline and differential.
Genevisible; Q8WW38; HS.
GO; GO:0005737; C:cytoplasm; IEA:Ensembl.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0005634; C:nucleus; IBA:GO_Central.
GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW.
GO; GO:0000981; F:RNA polymerase II transcription factor activity, sequence-specific DNA binding; ISA:NTNU_SB.
GO; GO:0001085; F:RNA polymerase II transcription factor binding; IBA:GO_Central.
GO; GO:0003713; F:transcription coactivator activity; NAS:BHF-UCL.
GO; GO:0003714; F:transcription corepressor activity; IDA:BHF-UCL.
GO; GO:0008134; F:transcription factor binding; IPI:BHF-UCL.
GO; GO:0001078; F:transcriptional repressor activity, RNA polymerase II proximal promoter sequence-specific DNA binding; IBA:GO_Central.
GO; GO:0008270; F:zinc ion binding; NAS:BHF-UCL.
GO; GO:0007596; P:blood coagulation; TAS:Reactome.
GO; GO:0048568; P:embryonic organ development; IEA:Ensembl.
GO; GO:0007506; P:gonadal mesoderm development; IEA:UniProtKB-KW.
GO; GO:0001701; P:in utero embryonic development; IEA:Ensembl.
GO; GO:0030324; P:lung development; IEA:Ensembl.
GO; GO:0060548; P:negative regulation of cell death; IEA:Ensembl.
GO; GO:0045599; P:negative regulation of fat cell differentiation; IMP:UniProtKB.
GO; GO:2000195; P:negative regulation of female gonad development; IEA:Ensembl.
GO; GO:0045892; P:negative regulation of transcription, DNA-templated; IDA:UniProtKB.
GO; GO:0003148; P:outflow tract septum morphogenesis; IMP:BHF-UCL.
GO; GO:0060045; P:positive regulation of cardiac muscle cell proliferation; IEA:Ensembl.
GO; GO:2000020; P:positive regulation of male gonad development; IEA:Ensembl.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IDA:BHF-UCL.
GO; GO:0003221; P:right ventricular cardiac muscle tissue morphogenesis; IMP:BHF-UCL.
GO; GO:0006351; P:transcription, DNA-templated; IEA:UniProtKB-KW.
GO; GO:0001570; P:vasculogenesis; IEA:Ensembl.
GO; GO:0060412; P:ventricular septum morphogenesis; IMP:BHF-UCL.
InterPro; IPR034731; ZF_CCHC_FOG.
InterPro; IPR036236; Znf_C2H2_sf.
InterPro; IPR013087; Znf_C2H2_type.
SMART; SM00355; ZnF_C2H2; 8.
SUPFAM; SSF57667; SSF57667; 6.
PROSITE; PS51810; ZF_CCHC_FOG; 5.
PROSITE; PS00028; ZINC_FINGER_C2H2_1; 2.
PROSITE; PS50157; ZINC_FINGER_C2H2_2; 2.
1: Evidence at protein level;
Activator; Alternative splicing; Cardiomyopathy; Complete proteome;
Differentiation; Disease mutation; DNA-binding;
Gonadal differentiation; Isopeptide bond; Metal-binding; Nucleus;
Phosphoprotein; Polymorphism; Reference proteome; Repeat; Repressor;
Transcription; Transcription regulation; Ubl conjugation; Zinc;
Zinc-finger.
CHAIN 1 1151 Zinc finger protein ZFPM2.
/FTId=PRO_0000221043.
ZN_FING 244 277 CCHC FOG-type 1. {ECO:0000255|PROSITE-
ProRule:PRU01153}.
ZN_FING 296 320 C2H2-type 1. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 335 357 C2H2-type 2. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 363 385 C2H2-type 3. {ECO:0000255|PROSITE-
ProRule:PRU00042}.
ZN_FING 542 575 CCHC FOG-type 2. {ECO:0000255|PROSITE-
ProRule:PRU01153}.
ZN_FING 681 714 CCHC FOG-type 3. {ECO:0000255|PROSITE-
ProRule:PRU01153}.
ZN_FING 848 881 CCHC FOG-type 4. {ECO:0000255|PROSITE-
ProRule:PRU01153}.
ZN_FING 1113 1146 CCHC FOG-type 5. {ECO:0000255|PROSITE-
ProRule:PRU01153}.
REGION 829 835 Interaction with CTBP2. {ECO:0000305}.
MOTIF 736 740 Nuclear localization signal.
{ECO:0000250}.
MOD_RES 532 532 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 581 581 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 904 904 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 1014 1014 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
CROSSLNK 324 324 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO1).
{ECO:0000269|PubMed:23226341}.
CROSSLNK 444 444 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2).
{ECO:0000244|PubMed:28112733}.
CROSSLNK 471 471 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO1).
{ECO:0000269|PubMed:23226341}.
CROSSLNK 915 915 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO1).
{ECO:0000269|PubMed:23226341}.
CROSSLNK 955 955 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO1).
{ECO:0000269|PubMed:23226341}.
VAR_SEQ 1 132 Missing (in isoform 2).
{ECO:0000303|Ref.3}.
/FTId=VSP_009701.
VAR_SEQ 247 287 KDIFPCKSCGIWYRSERNLQAHLMYYCSGRQREAAPVSEEN
-> SKCSVLCSPALEVMGIYGRKKCLLTRNQEQTFFLQKKK
KKK (in isoform 2). {ECO:0000303|Ref.3}.
/FTId=VSP_009702.
VARIANT 30 30 E -> G (in TOF and CTHM; does not affect
its ability to interact with GATA4;
dbSNP:rs121908601).
{ECO:0000269|PubMed:14517948,
ECO:0000269|PubMed:20807224}.
/FTId=VAR_017942.
VARIANT 227 227 I -> V (in CTHM; dbSNP:rs202204708).
{ECO:0000269|PubMed:20807224}.
/FTId=VAR_072074.
VARIANT 260 260 R -> Q (in SRXY9; results in reduced
transactivation activity on the AMH
promoter; does not affect its ability to
interact with GATA4; dbSNP:rs200834568).
{ECO:0000269|PubMed:24549039}.
/FTId=VAR_071104.
VARIANT 402 402 S -> R (in SRXY9; results in reduced
transactivation activity on the AMH
promoter; abolished its ability to
interact with GATA4; dbSNP:rs606231252).
{ECO:0000269|PubMed:24549039}.
/FTId=VAR_071105.
VARIANT 403 403 A -> G (in dbSNP:rs11993776).
{ECO:0000269|PubMed:24549039}.
/FTId=VAR_024178.
VARIANT 544 544 M -> I (in SRXY9 and TOF; reduced its
ability to interact with GATA4;
dbSNP:rs187043152).
{ECO:0000269|PubMed:20807224,
ECO:0000269|PubMed:24549039}.
/FTId=VAR_072075.
VARIANT 657 657 S -> G (in TOF; slightly impairs its
ability to interact with GATA4;
dbSNP:rs28374544).
{ECO:0000269|PubMed:14517948}.
/FTId=VAR_017943.
VARIANT 782 782 E -> D (in dbSNP:rs2920048).
{ECO:0000269|PubMed:24549039}.
/FTId=VAR_017944.
VARIANT 1055 1055 A -> V (in dbSNP:rs16873741).
/FTId=VAR_030760.
CONFLICT 198 198 F -> L (in Ref. 3; CAB97541).
{ECO:0000305}.
CONFLICT 939 939 L -> P (in Ref. 1; AAD49558).
{ECO:0000305}.
SEQUENCE 1151 AA; 128159 MW; 680E31BA1D044C35 CRC64;
MSRRKQSKPR QIKRPLEDAI EDEEEECPSE ETDIISKGDF PLEESFSTEF GPENLSCEEV
EYFCNKGDDE GIQETAESDG DTQSEKPGQP GVETDDWDGP GELEVFQKDG ERKIQSRQQL
PVGTTWGPFP GKMDLNNNSL KTKAQVPMVL TAGPKWLLDV TWQGVEDNKN NCIVYSKGGQ
LWCTTTKAIS EGEELIAFVV DFDSRLQAAS QMTLTEGMYP ARLLDSIQLL PQQAAMASIL
PTAIVNKDIF PCKSCGIWYR SERNLQAHLM YYCSGRQREA APVSEENEDS AHQISSLCPF
PQCTKSFSNA RALEMHLNSH SGVKMEEFLP PGASLKCTVC SYTADSVINF HQHLFSHLTQ
AAFRCNHCHF GFQTQRELLQ HQELHVPSGK LPRESDMEHS PSATEDSLQP ATDLLTRSEL
PQSQKAMQTK DASSDTELDK CEKKTQLFLT NQRPEIQPTT NKQSFSYTKI KSEPSSPRLA
SSPVQPNIGP SFPVGPFLSQ FSFPQDITMV PQASEILAKM SELVHRRLRH GSSSYPPVIY
SPLMPKGATC FECNITFNNL DNYLVHKKHY CSSRWQQMAK SPEFPSVSEK MPEALSPNTG
QTSINLLNPA AHSADPENPL LQTSCINSST VLDLIGPNGK GHDKDFSTQT KKLSTSSNND
DKINGKPVDV KNPSVPLVDG ESDPNKTTCE ACNITFSRHE TYMVHKQYYC ATRHDPPLKR
SASNKVPAMQ RTMRTRKRRK MYEMCLPEQE QRPPLVQQRF LDVANLNNPC TSTQEPTEGL
GECYHPRCDI FPGIVSKHLE TSLTINKCVP VSKCDTTHSS VSCLEMDVPI DLSKKCLSQS
ERTTTSPKRL LDYHECTVCK ISFNKVENYL AHKQNFCPVT AHQRNDLGQL DGKVFPNPES
ERNSPDVSYE RSIIKCEKNG NLKQPSPNGN LFSSHLATLQ GLKVFSEAAQ LIATKEENRH
LFLPQCLYPG AIKKAKGADQ LSPYYGIKPS DYISGSLVIH NTDIEQSRNA ENESPKGQAS
SNGCAALKKD SLPLLPKNRG MVIVNGGLKQ DERPAANPQQ ENISQNPQHE DDHKSPSWIS
ENPLAANENV SPGIPSAEEQ LSSIAKGVNG SSQAPTSGKY CRLCDIQFNN LSNFITHKKF
YCSSHAAEHV K


Related products :

Catalog number Product name Quantity
18-003-43152 Zinc finger protein ZFPM1 - Zinc finger protein multitype 1; Friend of GATA protein 1; Friend of GATA-1; FOG-1 Polyclonal 0.05 mg Aff Pur
EIAAB47340 BMZF5,BMZF-5,Bone marrow zinc finger 5,HD-ZNF1,Hematopoietic cell-derived zinc finger protein 1,Homo sapiens,Human,Zinc finger protein 254,Zinc finger protein 539,Zinc finger protein 91-like,ZNF254,ZN
EIAAB47314 BMZF2,BMZF-2,Bone marrow zinc finger 2,Homo sapiens,Human,KOX22,Zinc finger protein 224,Zinc finger protein 233,Zinc finger protein 255,Zinc finger protein 27,Zinc finger protein KOX22,ZNF224,ZNF233,Z
EIAAB47352 CT-ZFP48,EBV-induced zinc finger protein,Epstein-Barr virus-induced zinc finger protein,Homo sapiens,Human,Zinc finger protein 271,Zinc finger protein dp,Zinc finger protein HZF7,Zinc finger protein Z
EIAAB47194 Homo sapiens,Human,Zf47,ZFP47,Zfp-47,Zinc finger and SCAN domain-containing protein 13,Zinc finger protein 306,Zinc finger protein 309,Zinc finger protein 47 homolog,Zinc finger protein with KRAB and
EIAAB46826 FANCC-interacting protein,Fanconi anemia zinc finger protein,FAZF,Homo sapiens,Human,Testis zinc finger protein,TZFP,ZBTB32,Zinc finger and BTB domain-containing protein 32,Zinc finger protein 538,ZNF
EIAAB47193 Mouse,Mus musculus,SCAN-KRAB-zinc finger protein,Skz1,Zf47,Zfp306,Zfp307,Zfp47,Zfp-47,Zinc finger protein 306,Zinc finger protein 307,Zinc finger protein 47 homolog,Zinc finger protein with KRAB and S
EIAAB47355 Homo sapiens,Human,Neurotrophin receptor-interacting factor homolog,SP2114,Zf2,Zinc finger protein 274,Zinc finger protein HFB101,Zinc finger protein with KRAB and SCAN domains 19,Zinc finger protein
EIAAB47395 C2H2-like zinc finger protein rearranged in thyroid adenomas,Homo sapiens,Human,RITA,Zinc finger protein 331,Zinc finger protein 361,Zinc finger protein 463,ZNF331,ZNF361,ZNF463
EIAAB14743 Fez family zinc finger protein 2,FEZF2,FEZL,FKSG36,Forebrain embryonic zinc finger-like protein 2,Homo sapiens,Human,Zinc finger protein 312,Zinc finger protein Fez-like,ZNF312
EIAAB47275 Homo sapiens,Human,Zinc finger protein 167,Zinc finger protein 448,Zinc finger protein 64,Zinc finger protein with KRAB and SCAN domains 7,ZKSCAN7,ZNF167,ZNF448,ZNF64
EIAAB47457 Early B-cell factor-associated zinc finger protein,Ebfaz,Kiaa0760,Mouse,Mus musculus,Nur12,Oaz,Olf1_EBF-associated zinc finger protein,Smad- and Olf-interacting zinc finger protein,Zfp423,Zinc finger
EIAAB46812 Homo sapiens,Human,MIZ1,Miz-1,Myc-interacting zinc finger protein 1,ZBTB17,Zinc finger and BTB domain-containing protein 17,Zinc finger protein 151,Zinc finger protein 60,ZNF151,ZNF60
EIAAB47878 HDSG1,Heart development-specific gene 1 protein,Homo sapiens,Human,KOX11,Zinc finger protein 18,Zinc finger protein 535,Zinc finger protein KOX11,Zinc finger protein with KRAB and SCAN domains 6,ZKSCA
EIAAB14742 Bos taurus,Bovine,Fez family zinc finger protein 2,FEZF2,FEZL,Forebrain embryonic zinc finger-like protein 2,Zinc finger protein 312,Zinc finger protein Fez-like,ZNF312
18-003-42276 Zinc finger and BTB domain-containing protein 7B - Zinc finger protein 67 homolog; Zfp-67; Zinc finger protein Th-POK; T-helper-inducing POZ_Krueppel-like factor; Krueppel-related zinc finger protein 0.1 mg Protein A
EIAAB47325 Homo sapiens,Human,ZFP93,Zfp-93,Zinc finger protein 235,Zinc finger protein 270,Zinc finger protein 93 homolog,Zinc finger protein HZF6,ZNF235,ZNF270
EIAAB47384 Homo sapiens,Human,Zinc finger protein 322,Zinc finger protein 322A,Zinc finger protein 388,Zinc finger protein 489,ZNF322,ZNF322A,ZNF388,ZNF489
EIAAB14741 Fez,Fez family zinc finger protein 2,Fezf2,Fezl,Forebrain embryonic zinc finger-like protein 2,Mouse,Mus musculus,Zfp312,Zinc finger protein 312,Zinc finger protein Fez-like
EIAAB47907 GIOT2,GIOT-2,Gonadotropin-inducible ovary transcription repressor 2,Homo sapiens,Human,KOX7,Zinc finger protein 44,Zinc finger protein 55,Zinc finger protein 58,Zinc finger protein KOX7,ZNF44,ZNF55,ZN
EIAAB47892 Homo sapiens,Human,KOX17,Retinoic acid suppression protein A,RSG-A,Zinc finger and SCAN domain-containing protein 3,Zinc finger protein 191,Zinc finger protein 24,Zinc finger protein KOX17,ZNF191,ZNF2
EIAAB46825 Mouse,Mus musculus,Repressor of GATA,Rog,Testis zinc finger protein,Tzfp,Zbtb32,Zinc finger and BTB domain-containing protein 32
EIAAB47401 Homo sapiens,Human,KIAA0065,KOX31,Zinc finger and ZAK-associated protein with KRAB domain,Zinc finger protein 11A,Zinc finger protein 33A,Zinc finger protein KOX31,ZNF11,ZNF11A,ZNF33,ZNF33A,ZZaPK
18-003-42388 Zinc finger protein 24 - Zinc finger protein 191; Zinc finger protein KOX17; Retinoic acid suppression protein A; RSG-A; Zinc finger and SCAN domain-containing protein 3 Polyclonal 0.05 mg Aff Pur
EIAAB47372 Homo sapiens,Human,Zinc finger protein 135-like,Zinc finger protein 140-like,Zinc finger protein 302,Zinc finger protein 327,ZNF135L,ZNF140L,ZNF302,ZNF327


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur