Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Zinc transporter ZIP8 (BCG-induced integral membrane protein in monocyte clone 103 protein) (LIV-1 subfamily of ZIP zinc transporter 6) (LZT-Hs6) (Solute carrier family 39 member 8) (Zrt- and Irt-like protein 8) (ZIP-8)

 S39A8_HUMAN             Reviewed;         460 AA.
Q9C0K1; B4E2H3; Q96SM9; Q9BVC0; Q9NSA4;
04-DEC-2007, integrated into UniProtKB/Swiss-Prot.
01-JUN-2001, sequence version 1.
20-JUN-2018, entry version 127.
RecName: Full=Zinc transporter ZIP8;
AltName: Full=BCG-induced integral membrane protein in monocyte clone 103 protein;
AltName: Full=LIV-1 subfamily of ZIP zinc transporter 6;
Short=LZT-Hs6;
AltName: Full=Solute carrier family 39 member 8;
AltName: Full=Zrt- and Irt-like protein 8;
Short=ZIP-8;
Name=SLC39A8; Synonyms=BIGM103, ZIP8; ORFNames=PP3105;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY,
SUBCELLULAR LOCATION, INDUCTION BY PHORBOL ESTER; TNFA AND
MYCOBACTERIUM BOVIS BCG CELL WALL, AND FUNCTION.
PubMed=12504855; DOI=10.1006/geno.2002.7000;
Begum N.A., Kobayashi M., Moriwaki Y., Matsumoto M., Toyoshima K.,
Seya T.;
"Mycobacterium bovis BCG cell wall and lipopolysaccharide induce a
novel gene, BIGM103, encoding a 7-TM protein: identification of a new
protein family having Zn-transporter and Zn-metalloprotease
signatures.";
Genomics 80:630-645(2002).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
TISSUE=Trachea;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=15498874; DOI=10.1073/pnas.0404089101;
Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H.,
Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y.,
Shu H., Chen X., Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S.,
Gu J.;
"Large-scale cDNA transfection screening for genes related to cancer
development and progression.";
Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Cervix, and Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
VARIANT CDG2N ARG-38, AND FUNCTION.
PubMed=26637978; DOI=10.1016/j.ajhg.2015.11.002;
Care4Rare Canada Consortium;
Boycott K.M., Beaulieu C.L., Kernohan K.D., Gebril O.H., Mhanni A.,
Chudley A.E., Redl D., Qin W., Hampson S., Kuery S., Tetreault M.,
Puffenberger E.G., Scott J.N., Bezieau S., Reis A., Uebe S.,
Schumacher J., Hegele R.A., McLeod D.R., Galvez-Peralta M.,
Majewski J., Ramaekers V.T., Nebert D.W., Innes A.M.,
Parboosingh J.S., Abou Jamra R.;
"Autosomal-recessive intellectual disability with cerebellar atrophy
syndrome caused by mutation of the manganese and zinc transporter gene
SLC39A8.";
Am. J. Hum. Genet. 97:886-893(2015).
[8]
VARIANTS CDG2N MET-33; ARG-38; CYS-204; THR-335 AND ASN-340.
PubMed=26637979; DOI=10.1016/j.ajhg.2015.11.003;
Park J.H., Hogrebe M., Grueneberg M., DuChesne I.,
von der Heiden A.L., Reunert J., Schlingmann K.P., Boycott K.M.,
Beaulieu C.L., Mhanni A.A., Innes A.M., Hoertnagel K., Biskup S.,
Gleixner E.M., Kurlemann G., Fiedler B., Omran H., Rutsch F., Wada Y.,
Tsiakas K., Santer R., Nebert D.W., Rust S., Marquardt T.;
"SLC39A8 deficiency: a disorder of manganese transport and
glycosylation.";
Am. J. Hum. Genet. 97:894-903(2015).
-!- FUNCTION: Acts as a manganese and zinc influx transporter
(PubMed:12504855, PubMed:26637978). Plays a role in manganese
reabsorption in the proximal tubule of the kidney and in manganese
uptake into the brain (PubMed:26637978).
{ECO:0000269|PubMed:12504855, ECO:0000305|PubMed:26637978}.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Multi-pass membrane
protein {ECO:0000305}. Note=Associated with the
lysosomal/endosomal compartment following transfection.
{ECO:0000269|PubMed:12504855}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q9C0K1-1; Sequence=Displayed;
Name=2;
IsoId=Q9C0K1-2; Sequence=VSP_029884, VSP_029885;
Note=No experimental confirmation available.;
Name=3;
IsoId=Q9C0K1-3; Sequence=VSP_043675;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed in thymus, placenta, lung, liver,
pancreas and, to a lower extent, in spleen, testis, ovary, small
intestine, colon, leukocyte, heart. Highest expression is observed
in pancreas. {ECO:0000269|PubMed:12504855}.
-!- INDUCTION: By live and heat-killed Mycobacterium bovis bacterial
cell wall and inflammatory cytokines like TNF. Down-regulated
following phorbol ester treatment. {ECO:0000269|PubMed:12504855}.
-!- DISEASE: Congenital disorder of glycosylation 2N (CDG2N)
[MIM:616721]: A form of congenital disorder of glycosylation, a
genetically heterogeneous group of autosomal recessive,
multisystem disorders caused by a defect in glycoprotein
biosynthesis and characterized by under-glycosylated serum
glycoproteins. Congenital disorders of glycosylation result in a
wide variety of clinical features, such as defects in the nervous
system development, psychomotor retardation, dysmorphic features,
hypotonia, coagulation disorders, and immunodeficiency. The broad
spectrum of features reflects the critical role of N-glycoproteins
during embryonic development, differentiation, and maintenance of
cell functions. {ECO:0000269|PubMed:26637978,
ECO:0000269|PubMed:26637979}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the ZIP transporter (TC 2.A.5) family.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AB020970; BAA96442.1; -; mRNA.
EMBL; AB040120; BAB21559.1; -; mRNA.
EMBL; AK027652; BAB55268.1; -; mRNA.
EMBL; AK304274; BAG65135.1; -; mRNA.
EMBL; AF193052; AAG22480.1; -; mRNA.
EMBL; AC098487; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AP002023; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471057; EAX06130.1; -; Genomic_DNA.
EMBL; BC001320; AAH01320.1; -; mRNA.
EMBL; BC012125; AAH12125.1; -; mRNA.
CCDS; CCDS3656.1; -. [Q9C0K1-1]
CCDS; CCDS47117.1; -. [Q9C0K1-3]
RefSeq; NP_001128618.1; NM_001135146.1. [Q9C0K1-1]
RefSeq; NP_001128619.1; NM_001135147.1. [Q9C0K1-3]
RefSeq; NP_001128620.1; NM_001135148.1. [Q9C0K1-2]
RefSeq; NP_071437.3; NM_022154.5. [Q9C0K1-1]
RefSeq; XP_005263234.1; XM_005263177.1. [Q9C0K1-1]
RefSeq; XP_016864029.1; XM_017008540.1. [Q9C0K1-1]
RefSeq; XP_016864030.1; XM_017008541.1. [Q9C0K1-2]
UniGene; Hs.288034; -.
ProteinModelPortal; Q9C0K1; -.
SMR; Q9C0K1; -.
BioGrid; 122072; 32.
STRING; 9606.ENSP00000349174; -.
TCDB; 2.A.5.4.15; the zinc (zn(2+))-iron (fe(2+)) permease (zip) family.
iPTMnet; Q9C0K1; -.
PhosphoSitePlus; Q9C0K1; -.
BioMuta; SLC39A8; -.
DMDM; 74733496; -.
EPD; Q9C0K1; -.
MaxQB; Q9C0K1; -.
PaxDb; Q9C0K1; -.
PeptideAtlas; Q9C0K1; -.
PRIDE; Q9C0K1; -.
ProteomicsDB; 80068; -.
ProteomicsDB; 80069; -. [Q9C0K1-2]
ProteomicsDB; 80070; -. [Q9C0K1-3]
DNASU; 64116; -.
Ensembl; ENST00000356736; ENSP00000349174; ENSG00000138821. [Q9C0K1-1]
Ensembl; ENST00000394833; ENSP00000378310; ENSG00000138821. [Q9C0K1-1]
Ensembl; ENST00000424970; ENSP00000394548; ENSG00000138821. [Q9C0K1-3]
GeneID; 64116; -.
KEGG; hsa:64116; -.
UCSC; uc003hwb.2; human. [Q9C0K1-1]
CTD; 64116; -.
DisGeNET; 64116; -.
EuPathDB; HostDB:ENSG00000138821.12; -.
GeneCards; SLC39A8; -.
HGNC; HGNC:20862; SLC39A8.
HPA; HPA038832; -.
HPA; HPA038833; -.
MalaCards; SLC39A8; -.
MIM; 608732; gene.
MIM; 616721; phenotype.
neXtProt; NX_Q9C0K1; -.
OpenTargets; ENSG00000138821; -.
PharmGKB; PA134931507; -.
eggNOG; KOG2693; Eukaryota.
eggNOG; COG0428; LUCA.
GeneTree; ENSGT00760000119115; -.
HOGENOM; HOG000070225; -.
HOVERGEN; HBG108450; -.
InParanoid; Q9C0K1; -.
KO; K14714; -.
OMA; LFFFERT; -.
OrthoDB; EOG091G064Y; -.
PhylomeDB; Q9C0K1; -.
TreeFam; TF318470; -.
Reactome; R-HSA-442380; Zinc influx into cells by the SLC39 gene family.
ChiTaRS; SLC39A8; human.
GenomeRNAi; 64116; -.
PRO; PR:Q9C0K1; -.
Proteomes; UP000005640; Chromosome 4.
Bgee; ENSG00000138821; -.
CleanEx; HS_SLC39A8; -.
ExpressionAtlas; Q9C0K1; baseline and differential.
Genevisible; Q9C0K1; HS.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0031090; C:organelle membrane; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0005385; F:zinc ion transmembrane transporter activity; IBA:GO_Central.
GO; GO:0070574; P:cadmium ion transmembrane transport; IEA:Ensembl.
GO; GO:0006882; P:cellular zinc ion homeostasis; IBA:GO_Central.
GO; GO:0071578; P:zinc ion import across plasma membrane; IBA:GO_Central.
GO; GO:0006829; P:zinc ion transport; IMP:UniProtKB.
InterPro; IPR003689; ZIP.
Pfam; PF02535; Zip; 1.
2: Evidence at transcript level;
Alternative splicing; Complete proteome;
Congenital disorder of glycosylation; Glycoprotein; Ion transport;
Membrane; Polymorphism; Reference proteome; Transmembrane;
Transmembrane helix; Transport; Zinc; Zinc transport.
CHAIN 1 460 Zinc transporter ZIP8.
/FTId=PRO_0000312707.
TOPO_DOM 1 8 Extracellular. {ECO:0000255}.
TRANSMEM 9 29 Helical. {ECO:0000255}.
TOPO_DOM 30 132 Cytoplasmic. {ECO:0000255}.
TRANSMEM 133 153 Helical. {ECO:0000255}.
TOPO_DOM 154 160 Extracellular. {ECO:0000255}.
TRANSMEM 161 181 Helical. {ECO:0000255}.
TOPO_DOM 182 191 Cytoplasmic. {ECO:0000255}.
TRANSMEM 192 212 Helical. {ECO:0000255}.
TOPO_DOM 213 302 Extracellular. {ECO:0000255}.
TRANSMEM 303 323 Helical. {ECO:0000255}.
TOPO_DOM 324 365 Cytoplasmic. {ECO:0000255}.
TRANSMEM 366 386 Helical. {ECO:0000255}.
TOPO_DOM 387 388 Extracellular. {ECO:0000255}.
TRANSMEM 389 409 Helical. {ECO:0000255}.
TOPO_DOM 410 429 Cytoplasmic. {ECO:0000255}.
TRANSMEM 430 450 Helical. {ECO:0000255}.
TOPO_DOM 451 460 Extracellular. {ECO:0000255}.
MOTIF 343 348 XEXPHE-motif.
CARBOHYD 273 273 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
VAR_SEQ 1 67 Missing (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_029884.
VAR_SEQ 68 72 QLHFN -> MHQHA (in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_029885.
VAR_SEQ 423 460 VTGRKTDFTFFMIQNAGMLTGFTAILLITLYAGEIELE ->
IIKWATDDIKSQLHLLWIYTAR (in isoform 3).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_043675.
VARIANT 33 33 V -> M (in CDG2N; dbSNP:rs373562040).
{ECO:0000269|PubMed:26637979}.
/FTId=VAR_076241.
VARIANT 38 38 G -> R (in CDG2N; lowered Mn and Zn blood
levels and increased Mn and Zn urine
levels in affected individuals;
dbSNP:rs778210210).
{ECO:0000269|PubMed:26637978,
ECO:0000269|PubMed:26637979}.
/FTId=VAR_076242.
VARIANT 204 204 G -> C (in CDG2N; dbSNP:rs779241085).
{ECO:0000269|PubMed:26637979}.
/FTId=VAR_076243.
VARIANT 335 335 S -> T (in CDG2N; dbSNP:rs864309660).
{ECO:0000269|PubMed:26637979}.
/FTId=VAR_076244.
VARIANT 340 340 I -> N (in CDG2N; no detectable serum or
urinary manganese levels in an affected
individual who also carries R-38
mutation; dbSNP:rs864309659).
{ECO:0000269|PubMed:26637979}.
/FTId=VAR_076245.
VARIANT 391 391 A -> T (in dbSNP:rs13107325).
/FTId=VAR_037551.
CONFLICT 241 241 K -> E (in Ref. 3; BAB55268).
{ECO:0000305}.
SEQUENCE 460 AA; 49631 MW; E5C03F4576E11E2F CRC64;
MAPGRAVAGL LLLAAAGLGG VAEGPGLAFS EDVLSVFGAN LSLSAAQLQH LLEQMGAASR
VGVPEPGQLH FNQCLTAEEI FSLHGFSNAT QITSSKFSVI CPAVLQQLNF HPCEDRPKHK
TRPSHSEVWG YGFLSVTIIN LASLLGLILT PLIKKSYFPK ILTFFVGLAI GTLFSNAIFQ
LIPEAFGFDP KVDSYVEKAV AVFGGFYLLF FFERMLKMLL KTYGQNGHTH FGNDNFGPQE
KTHQPKALPA INGVTCYANP AVTEANGHIH FDNVSVVSLQ DGKKEPSSCT CLKGPKLSEI
GTIAWMITLC DALHNFIDGL AIGASCTLSL LQGLSTSIAI LCEEFPHELG DFVILLNAGM
STRQALLFNF LSACSCYVGL AFGILVGNNF APNIIFALAG GMFLYISLAD MFPEMNDMLR
EKVTGRKTDF TFFMIQNAGM LTGFTAILLI TLYAGEIELE


Related products :

Catalog number Product name Quantity
EIAAB37023 BCG-induced integral membrane protein in monocyte clone 103 protein,BIGM103,Homo sapiens,Human,LIV-1 subfamily of ZIP zinc transporter 6,LZT-Hs6,PP3105,SLC39A8,Solute carrier family 39 member 8,Zinc t
EIAAB37024 Mouse,Mus musculus,Slc39a8,Solute carrier family 39 member 8,Zinc transporter ZIP8,Zip8,ZIP-8,Zrt- and Irt-like protein 8
EIAAB37022 Rat,Rattus norvegicus,Slc39a8,Solute carrier family 39 member 8,Zinc transporter ZIP8,Zip8,ZIP-8,Zrt- and Irt-like protein 8
EIAAB37039 Homo sapiens,Human,LIV-1 subfamily of ZIP zinc transporter 9,LZT-Hs9,SLC39A13,Solute carrier family 39 member 13,Zinc transporter ZIP13,ZIP13,ZIP-13,Zrt- and Irt-like protein 13
EIAAB37037 Homo sapiens,Human,LIV-1 subfamily of ZIP zinc transporter 8,LZT-Hs8,SLC39A12,Solute carrier family 39 member 12,Zinc transporter ZIP12,ZIP12,ZIP-12,Zrt- and Irt-like protein 12
EIAAB37045 Homo sapiens,Human,KIAA0062,LIV-1 subfamily of ZIP zinc transporter 4,LZT-Hs4,SLC39A14,Solute carrier family 39 member 14,Zinc transporter ZIP14,ZIP14,ZIP-14,Zrt- and Irt-like protein 14
EIAAB37003 Mouse,Mus musculus,mZIP1,Slc39a1,Solute carrier family 39 member 1,Zinc transporter ZIP1,Zinc-iron-regulated transporter-like,Zip1,ZIP-1,Zirtl,Zrt- and Irt-like protein 1
EIAAB37001 CGI-08,CGI-71,Homo sapiens,Human,hZIP1,IRT1,SLC39A1,Solute carrier family 39 member 1,Zinc transporter ZIP1,Zinc-iron-regulated transporter-like,ZIP1,ZIP-1,ZIRTL,Zrt- and Irt-like protein 1
EIAAB37016 Endoplasmic reticulum membrane-linked protein,Ermelin,Mouse,Mus musculus,Slc39a6,Solute carrier family 39 member 6,Zinc transporter ZIP6,Zip6,ZIP-6,Zrt- and Irt-like protein 6
EIAAB37018 Histidine-rich membrane protein Ke4,HKE4,Homo sapiens,Human,Really interesting new gene 5 protein,RING5,SLC39A7,Solute carrier family 39 member 7,Zinc transporter SLC39A7
EIAAB37021 Histidine-rich membrane protein Ke4,HKE4,Pig,SLC39A7,Solute carrier family 39 member 7,Sus scrofa,Zinc transporter SLC39A7
EIAAB37019 H2-Ke4,Histidine-rich membrane protein Ke4,Hke4,Mouse,Mus musculus,Slc39a7,Solute carrier family 39 member 7,Zinc transporter SLC39A7
EIAAB47969 Dri 27 protein,Rat,Rattus norvegicus,Slc30a4,Solute carrier family 30 member 4,Zinc transporter 4,Znt4,ZnT-4
EIAAB47970 Lethal milk protein,Lm,Mouse,Mus musculus,Slc30a4,Solute carrier family 30 member 4,Zinc transporter 4,Znt4,ZnT-4
EIAAB47983 Mouse,Mus musculus,Slc30a7,Solute carrier family 30 member 7,Zinc transporter 7,Znt7,ZnT-7,Zntl2,Znt-like transporter 2
EIAAB37015 Estrogen-regulated protein LIV-1,Homo sapiens,Human,LIV1,SLC39A6,Solute carrier family 39 member 6,Zinc transporter ZIP6,ZIP6,ZIP-6,Zrt- and Irt-like protein 6
EIAAB47980 Homo sapiens,Human,SLC30A7,Solute carrier family 30 member 7,Zinc transporter 7,ZNT7,ZnT-7,ZNTL2,Znt-like transporter 2
20-372-60281 solute carrier family 30 (zinc transporter). member 9 (SLC30A9) - Mouse monoclonal anti-human SLC30A9 antibody; ZnT-9; Solute carrier family 30 member 9; Human embryonic lung protein; HUEL Monoclonal 0.1 mg
EIAAB37035 Mouse,Mus musculus,Slc39a12,Solute carrier family 39 member 12,Zinc transporter ZIP12,Zip12,ZIP-12,Zrt- and Irt-like protein 12
EIAAB37042 Rat,Rattus norvegicus,Slc39a13,Solute carrier family 39 member 13,Zinc transporter ZIP13,Zip13,ZIP-13,Zrt- and Irt-like protein 13
EIAAB37002 Bos taurus,Bovine,SLC39A1,Solute carrier family 39 member 1,Zinc transporter ZIP1,ZIP1,ZIP-1,Zrt- and Irt-like protein 1
EIAAB37041 Bos taurus,Bovine,SLC39A13,Solute carrier family 39 member 13,Zinc transporter ZIP13,ZIP13,ZIP-13,Zrt- and Irt-like protein 13
EIAAB37040 Mouse,Mus musculus,Slc39a13,Solute carrier family 39 member 13,Zinc transporter ZIP13,Zip13,ZIP-13,Zrt- and Irt-like protein 13
EIAAB37034 Rat,Rattus norvegicus,Slc39a11,Solute carrier family 39 member 11,Zinc transporter ZIP11,Zip11,ZIP-11,Zrt- and Irt-like protein 11
EIAAB37036 Bos taurus,Bovine,SLC39A12,Solute carrier family 39 member 12,Zinc transporter ZIP12,ZIP12,ZIP-12,Zrt- and Irt-like protein 12


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur