Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Zinc-activated ligand-gated ion channel (Ligand-gated ion channel zinc-activated 1) (Ligand-gated ion-channel receptor L2)

 ZACN_HUMAN              Reviewed;         412 AA.
Q401N2; Q2TB29; Q6ZWK3; Q86YW4;
05-FEB-2008, integrated into UniProtKB/Swiss-Prot.
05-FEB-2008, sequence version 2.
25-OCT-2017, entry version 106.
RecName: Full=Zinc-activated ligand-gated ion channel;
AltName: Full=Ligand-gated ion channel zinc-activated 1;
AltName: Full=Ligand-gated ion-channel receptor L2;
Flags: Precursor;
Name=ZACN; Synonyms=L2, LGICZ, LGICZ1, ZAC;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, FUNCTION,
AND VARIANT THR-152.
PubMed=12381728; DOI=10.1074/jbc.M208814200;
Davies P.A., Wang W., Hales T.G., Kirkness E.F.;
"A novel class of ligand-gated ion channel is activated by Zn2+.";
J. Biol. Chem. 278:712-717(2003).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE
SPECIFICITY, AND GLYCOSYLATION.
TISSUE=Brain;
PubMed=16083862; DOI=10.1016/j.bbrc.2005.07.079;
Houtani T., Munemoto Y., Kase M., Sakuma S., Tsutsumi T., Sugimoto T.;
"Cloning and expression of ligand-gated ion-channel receptor L2 in
central nervous system.";
Biochem. Biophys. Res. Commun. 335:277-285(2005).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), AND VARIANT
THR-152.
TISSUE=Thymus;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16625196; DOI=10.1038/nature04689;
Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R.,
Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A.,
Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J.,
Chang J.L., Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J.,
DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R.,
Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N.,
Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B.,
Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J.,
Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E.,
Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J.,
Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C.,
Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D.,
Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A.,
Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.;
"DNA sequence of human chromosome 17 and analysis of rearrangement in
the human lineage.";
Nature 440:1045-1049(2006).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: Zinc-activated ligand-gated ion channel.
{ECO:0000269|PubMed:12381728}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:16083862};
Multi-pass membrane protein {ECO:0000269|PubMed:16083862}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1;
IsoId=Q401N2-1; Sequence=Displayed;
Name=2;
IsoId=Q401N2-2; Sequence=VSP_030911, VSP_030912;
Name=3;
IsoId=Q401N2-3; Sequence=VSP_030909, VSP_030910;
Note=No experimental confirmation available. May be produced at
very low levels due to a premature stop codon in the mRNA,
leading to nonsense-mediated mRNA decay.;
-!- TISSUE SPECIFICITY: Detected in pancreas, brain, liver, placenta,
trachea, kidney, spinal cord, stomach and fetal brain. In the
adult brain region expression is detected in the hippocampus,
striatum, amygdala and thalamus. {ECO:0000269|PubMed:12381728,
ECO:0000269|PubMed:16083862}.
-!- PTM: Glycosylated. {ECO:0000269|PubMed:16083862}.
-!- MISCELLANEOUS: The mouse and rat orthologous proteins do not
exist.
-!- SIMILARITY: Belongs to the ligand-gated ion channel (TC 1.A.9)
family. {ECO:0000305}.
-!- CAUTION: It is uncertain whether Met-1 or Met-2 is the initiator.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAI10598.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=AAO20969.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=EAW89365.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see http://www.uniprot.org/terms
Distributed under the Creative Commons Attribution-NoDerivs License
-----------------------------------------------------------------------
EMBL; AF512521; AAO20969.1; ALT_INIT; mRNA.
EMBL; AB223030; BAE19924.1; -; mRNA.
EMBL; AK122638; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AC018665; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471099; EAW89365.1; ALT_INIT; Genomic_DNA.
EMBL; CH471099; EAW89366.1; -; Genomic_DNA.
EMBL; BC110596; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; BC110597; AAI10598.1; ALT_INIT; mRNA.
CCDS; CCDS11740.2; -. [Q401N2-1]
RefSeq; NP_851321.2; NM_180990.3. [Q401N2-1]
UniGene; Hs.714919; -.
ProteinModelPortal; Q401N2; -.
BioGrid; 131658; 71.
STRING; 9606.ENSP00000334854; -.
GuidetoPHARMACOLOGY; 587; -.
TCDB; 1.A.9.11.1; the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family.
iPTMnet; Q401N2; -.
BioMuta; ZACN; -.
DMDM; 166991030; -.
PaxDb; Q401N2; -.
PRIDE; Q401N2; -.
TopDownProteomics; Q401N2-3; -. [Q401N2-3]
Ensembl; ENST00000334586; ENSP00000334854; ENSG00000186919. [Q401N2-1]
Ensembl; ENST00000421794; ENSP00000391936; ENSG00000186919. [Q401N2-3]
Ensembl; ENST00000425015; ENSP00000397489; ENSG00000186919. [Q401N2-2]
GeneID; 353174; -.
KEGG; hsa:353174; -.
UCSC; uc002jqn.3; human. [Q401N2-1]
CTD; 353174; -.
DisGeNET; 353174; -.
EuPathDB; HostDB:ENSG00000186919.12; -.
GeneCards; ZACN; -.
H-InvDB; HIX0027141; -.
HGNC; HGNC:29504; ZACN.
MIM; 610935; gene.
neXtProt; NX_Q401N2; -.
OpenTargets; ENSG00000186919; -.
PharmGKB; PA162409377; -.
eggNOG; ENOG410IKFM; Eukaryota.
eggNOG; ENOG4111421; LUCA.
GeneTree; ENSGT00790000122957; -.
HOGENOM; HOG000155757; -.
HOVERGEN; HBG108756; -.
InParanoid; Q401N2; -.
KO; K16888; -.
OMA; LVPCFQV; -.
OrthoDB; EOG091G0CPT; -.
PhylomeDB; Q401N2; -.
TreeFam; TF315605; -.
ChiTaRS; ZACN; human.
GeneWiki; Zinc-activated_ion_channel; -.
GenomeRNAi; 353174; -.
PRO; PR:Q401N2; -.
Proteomes; UP000005640; Chromosome 17.
Bgee; ENSG00000186919; -.
CleanEx; HS_ZACN; -.
Genevisible; Q401N2; HS.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; IDA:HGNC.
GO; GO:0015276; F:ligand-gated ion channel activity; IDA:BHF-UCL.
GO; GO:0022850; F:serotonin-gated cation-selective channel activity; IBA:GO_Central.
GO; GO:0008270; F:zinc ion binding; IC:HGNC.
GO; GO:0034220; P:ion transmembrane transport; IDA:BHF-UCL.
GO; GO:0010043; P:response to zinc ion; IDA:HGNC.
Gene3D; 1.20.58.390; -; 1.
Gene3D; 2.70.170.10; -; 1.
InterPro; IPR006202; Neur_chan_lig-bd.
InterPro; IPR036734; Neur_chan_lig-bd_sf.
InterPro; IPR006201; Neur_channel.
InterPro; IPR036719; Neuro-gated_channel_TM_sf.
InterPro; IPR018000; Neurotransmitter_ion_chnl_CS.
PANTHER; PTHR18945; PTHR18945; 1.
Pfam; PF02931; Neur_chan_LBD; 1.
SUPFAM; SSF63712; SSF63712; 1.
SUPFAM; SSF90112; SSF90112; 1.
PROSITE; PS00236; NEUROTR_ION_CHANNEL; 1.
1: Evidence at protein level;
Alternative splicing; Cell membrane; Complete proteome;
Disulfide bond; Glycoprotein; Ion channel; Ion transport;
Ligand-gated ion channel; Membrane; Polymorphism; Receptor;
Reference proteome; Signal; Transmembrane; Transmembrane helix;
Transport; Zinc.
SIGNAL 1 25 {ECO:0000255}.
CHAIN 26 412 Zinc-activated ligand-gated ion channel.
/FTId=PRO_0000317165.
TOPO_DOM 26 233 Extracellular. {ECO:0000255}.
TRANSMEM 234 254 Helical; Name=1. {ECO:0000255}.
TOPO_DOM 255 265 Cytoplasmic. {ECO:0000255}.
TRANSMEM 266 286 Helical; Name=2. {ECO:0000255}.
TOPO_DOM 287 298 Extracellular. {ECO:0000255}.
TRANSMEM 299 319 Helical; Name=3. {ECO:0000255}.
TOPO_DOM 320 368 Cytoplasmic. {ECO:0000255}.
TRANSMEM 369 389 Helical; Name=4. {ECO:0000255}.
TOPO_DOM 390 412 Extracellular. {ECO:0000255}.
COMPBIAS 224 318 Leu-rich.
CARBOHYD 41 41 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 55 55 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 99 99 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
CARBOHYD 170 170 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
/FTId=PRO_5000052473.
DISULFID 157 171 {ECO:0000250}.
VAR_SEQ 75 126 DILRYTMSSMLLLRLSWLDTRLAWNTSAHPRHAITLPWESL
WTPRLTILEAL -> SSVLPRATALHSHGDCSGSAPCSKAR
GSGCHGLTPGNHLKVQPPCINPSGDI (in isoform
3). {ECO:0000303|PubMed:15489334}.
/FTId=VSP_030909.
VAR_SEQ 127 412 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_030910.
VAR_SEQ 182 266 AMELEFQAHVVNEIVSVKREYVVYDLKTQVPPQQLVPCFQV
TLRLKNTALKSIIALLVPAEALLLADVCGGLLPLRAIERIG
YKV -> GADRAGAAGLRRGGGRWGRGTPRSVVQGQGAGQG
EGAKADRRRTPRSVFRAVYPRLRRAAPALPLRPPLEWQPIS
VLSGSLRAPL (in isoform 2).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_030911.
VAR_SEQ 267 412 Missing (in isoform 2).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_030912.
VARIANT 152 152 A -> T (in dbSNP:rs2257020).
{ECO:0000269|PubMed:12381728,
ECO:0000269|PubMed:14702039}.
/FTId=VAR_038483.
SEQUENCE 412 AA; 45816 MW; B894A28F5163723F CRC64;
MMALWSLLHL TFLGFSITLL LVHGQGFQGT AAIWPSLFNV NLSKKVQESI QIPNNGSAPL
LVDVRVFVSN VFNVDILRYT MSSMLLLRLS WLDTRLAWNT SAHPRHAITL PWESLWTPRL
TILEALWVDW RDQSPQARVD QDGHVKLNLA LATETNCNFE LLHFPRDHSN CSLSFYALSN
TAMELEFQAH VVNEIVSVKR EYVVYDLKTQ VPPQQLVPCF QVTLRLKNTA LKSIIALLVP
AEALLLADVC GGLLPLRAIE RIGYKVTLLL SYLVLHSSLV QALPSSSSCN PLLIYYFTIL
LLLLFLSTIE TVLLAGLLAR GNLGAKSGPS PAPRGEQREH GNPGPHPAEE PSRGVKGSQR
SWPETADRIF FLVYVVGVLC TQFVFAGIWM WAACKSDAAP GEAAPHGRRP RL


Related products :

Catalog number Product name Quantity
EIAAB46777 Homo sapiens,Human,L2,LGICZ,LGICZ1,Ligand-gated ion channel zinc-activated 1,Ligand-gated ion-channel receptor L2,ZAC,ZACN,Zinc-activated ligand-gated ion channel
EIAAB46776 Canis familiaris,Canis lupus familiaris,Dog,LGICZ,LGICZ1,Ligand-gated ion channel zinc-activated 1,ZACN,Zinc-activated ligand-gated ion channel
I4243 Zinc-activated ligand-gated ion channel (ZACN), Dog, ELISA Kit 96T
CSB-EL026300DO Dog Zinc-activated ligand-gated ion channel(ZACN) ELISA kit 96T
25-267 P2RX5 is the receptor for ATP that acts as a ligand gated ion channel.The product of this gene belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel. Se 0.05 mg
CSB-EL026300DO Dog Zinc-activated ligand-gated ion channel(ZACN) ELISA kit SpeciesDog 96T
I4244 Zinc-activated ligand-gated ion channel (ZACN), Human, ELISA Kit 96T
CSB-EL026300HU Human Zinc-activated ligand-gated ion channel(ZACN) ELISA kit 96T
CSB-EL026300HU Human Zinc-activated ligand-gated ion channel(ZACN) ELISA kit SpeciesHuman 96T
CSB-EL026300DO Dog zinc activated ligand-gated ion channel (ZACN) ELISA kit, Species Dog, Sample Type serum, plasma 96T
ZACN ZACN Gene zinc activated ligand-gated ion channel
CSB-EL026300HU Human zinc activated ligand-gated ion channel (ZACN) ELISA kit, Species Human, Sample Type serum, plasma 96T
28-275 GABRE belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitor 0.05 mg
EIAAB08177 Aorta CNG channel,CNCG2,CNG channel alpha-2,CNG2,CNG-2,CNGA2,Cyclic nucleotide-gated cation channel 2,Cyclic nucleotide-gated channel alpha-2,Cyclic nucleotide-gated olfactory channel,Oryctolagus cuni
EIAAB08181 CNCG3,CNG channel alpha-3,CNG3,CNG-3,CNGA3,Cone photoreceptor cGMP-gated channel subunit alpha,Cyclic nucleotide-gated cation channel alpha-3,Cyclic nucleotide-gated channel alpha-3,Homo sapiens,Human
EIAAB08179 Bos taurus,Bovine,CNCG3,CNG channel alpha-3,CNG3,CNG-3,CNGA3,Cone photoreceptor cGMP-gated channel subunit alpha,Cyclic nucleotide-gated cation channel alpha-3,Cyclic nucleotide-gated channel alpha-3
201-20-3994 P2RX5{purinergic receptor P2X, ligand-gated ion channel, 5}rabbit.pAb 0.2ml
P2RX3 P2RX1 Gene purinergic receptor P2X, ligand-gated ion channel, 1
201-20-3995 P2RX7{purinergic receptor P2X, ligand-gated ion channel, 7}rabbit.pAb 0.2ml
P2RY10 P2RX7 Gene purinergic receptor P2X, ligand-gated ion channel, 7
P2RY1 P2RX6 Gene purinergic receptor P2X, ligand-gated ion channel, 6
E96077Hu ELISA Kit for Purinergic Receptor P2X, Ligand Gated Ion Channel 7 (P2RX7) 96T/Kit
P2RX4 P2RX2 Gene purinergic receptor P2X, ligand-gated ion channel, 2
P2RX5 P2RX3 Gene purinergic receptor P2X, ligand-gated ion channel, 3
201-20-3993 P2RX4{purinergic receptor P2X, ligand-gated ion channel, 4}rabbit.pAb 0.2ml


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur