GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc 6017 Snell Ave, Ste 357, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, sales@genprice.com

Index / Reliatech / Human PDGF_AB Source E. coli / Product Detail : 200-054 Human PDGF_AB Source E. coli
Related keywords:

Dec
6th

#200-054 Human PDGF_AB Source E. coli

Ask technical file .

  Price : 341   EUR
387   USD
264   GBP
1433   Zloty
45661   JPY
2631   NOK
2819   SEK
385   CHF

Product name : Human PDGF_AB Source E. coli

Catalog number : 200-054

Quantity: 20 µg

Availability: Yes

Supplier name : Reliatech

ask pdf gentaur products Data sheet: Ask more or other datasheet now !

More Details about

Human PDGF-AB

Host:
E. coli
Size:
20 µg
Price:
 
Formulation:
lyophilized
Catalog Number:
200-054
Synonyms:
PDGFA; PDGF1; PDGF-A
Purity Confirmation:
> 95% by SDS-PAGE & visualized by silver stain
Biological activity:
The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
Stability:
The lyophilized PDGF-AB is stable for a few weeks at room temperature, but best stored at -20 °C. Reconstituted PDGF-AB is best stored at -20 °C to -70 °C. Avoid repeated freeze-thaw cycles.
Reconstitution:
Centrifuge vial prior to opening. The lyophilized PDGF-AB should be reconstituted in 50mM acetic acid to a concentration not lower than 100μg/ml. For long term storage of reconstituted protein addition of carrier protein (e.g. BSA or HSA; 0.1%) is recommended.
Protein Sequence:
Alpha chain: MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPP CVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLE EHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT Beta chai n: MSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEV QRCSGCCNNRNVQCRPTQVQLRPVQVRKIGIVRKKPIFKKATVTLGDHLA CKCETVAAARPVT
Description:
PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs; PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet α-granules and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-α and PDGFR-β. PDGFR-α is high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-β interacts with only PDGF-BB and PDGF-AB. Recombinant human PDGF-AB is a 25.5 kDa disulfide-linked dimer, consisting of one A chain and one B chains (234 total amino acids).
NCBI Gene ID:
5154/5155
Uniprot:
P04085/P01127

 

Contact us about this product :

Our team will respond you as soon as possible !

Email :
Skype :
Name :
Phone :
address :
Question, Comment ... :
arrow security gentaurPlease retype this code below:
Reliatech \ Human_PDGF_AB_Source__E._coli \ 200_054
Reload Image

 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur