GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc 6017 Snell Ave, Ste 357, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908,

Index / Ray Biotech / Goat Anti-Human CD284, N-terminus / Product Detail : 129-10142 Goat Anti-Human CD284, N-terminus
Related keywords:


#129-10142 Goat Anti-Human CD284, N-terminus

Ask technical file .

  Price : 736   EUR
835   USD
571   GBP
3091   Zloty
98480   JPY
5676   NOK
6081   SEK
832   CHF

Product name : Goat Anti-Human CD284, N-terminus

Catalog number : 129-10142

Quantity: 100

Availability: Yes

Supplier name : Ray Biotech

ask pdf gentaur products Data sheet: Ask more or other datasheet now !

About this Product :

Goat Anti-Human CD284, N-terminus antibody storage GENTAUR recommends for long therm storage to freeze at -24 C. For short time storage up to 30 days we suggest fridge storage at 1 to 10 C. Prevent multiple freeze taw cycles of Goat Anti-Human CD284, N-terminus.

Goat Anti-Human CD284, N-terminus storing antibdies for longer storage periods of the Goat Anti-Human CD284, N-terminus we recommend - 21C or lower and for short periods lees than 1 month we suggest +5C fridge temperatures.

Goat Anti-Human CD284, N-terminus Human samples 80 % of the research is conducted on human samples. GENTAUR suppliers human normal cells, cell lines, RNA extracts and lots of antibodies and ELISA kits to Human proteins as well as Goat Anti-Human CD284, N-terminus.

More Details about


Target Name


Target Species


Species Detected

Mouse, Rat

Application Notes

Recommended Applications
Immunohistology - Paraffin, Western Blotting


This product specifically recognizes an epitope within the N-terminal (NT) region of CD284, also known as Toll-like receptor 4 (TLR4), a highly conserved member of the toll-like receptor family, expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells, which plays a primary role in the activation of innate immunity. 

CD284 acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling. 

This product is reported as suitable for use in immunocytochemistry on acetone fixed cells.


Store at +4 °C or at -20 °C if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
If stored in this manner, this product is stable for 18 months after receipt.


Supplied as:
Purified IgG - liquid
Phosphate buffered saline
Format Type:


IgG concentration 1.0mg/ml


Antiserum to human CD284 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.

Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284.
0.1% Sodium Azide (NaN3
0.1% Bovine Serum Albumin


Purified IgG prepared by Immunoaffinity chromatography



This product is furnished for LABORATORY RESEARCH USE ONLY. Not for diagnostic or therapeutic use.


Contact us about this product :

Our team will respond you as soon as possible !

Email :
Skype :
Name :
Phone :
address :
Question, Comment ... :
arrow security gentaurPlease retype this code below:
Ray_Biotech \ Goat_Anti_Human_CD284,_N_terminus \ 129_10142
Reload Image


GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45 | Gentaur

Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411 | Gentaur



9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017


Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925 | Gentaur

Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123

GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897 | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U

tel:0911876558 | Gentaur

ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: | Gentaur
IBAN: BG11FINV91501014771636

GENTAUR Poland Sp. z o.o.

ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48       | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556


Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94 | Gentaur