GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc 6017 Snell Ave, Ste 357, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908,

Index / Ray Biotech / Goat Anti-Human TLR5 / Product Detail : 129-10647 Goat Anti-Human TLR5
Related keywords:


#129-10647 Goat Anti-Human TLR5

Ask technical file .

  Price : 736   EUR
835   USD
571   GBP
3091   Zloty
98480   JPY
5676   NOK
6081   SEK
832   CHF

Product name : Goat Anti-Human TLR5

Catalog number : 129-10647

Quantity: 100

Availability: Yes

Supplier name : Ray Biotech

ask pdf gentaur products Data sheet: Ask more or other datasheet now !

About this Product :

Goat Anti-Human TLR5 antibody storage GENTAUR recommends for long therm storage to freeze at -24 C. For short time storage up to 30 days we suggest fridge storage at 1 to 10 C. Prevent multiple freeze taw cycles of Goat Anti-Human TLR5.

Goat Anti-Human TLR5 storing antibdies for longer storage periods of the Goat Anti-Human TLR5 we recommend - 21C or lower and for short periods lees than 1 month we suggest +5C fridge temperatures.

Goat Anti-Human TLR5 Human samples 80 % of the research is conducted on human samples. GENTAUR suppliers human normal cells, cell lines, RNA extracts and lots of antibodies and ELISA kits to Human proteins as well as Goat Anti-Human TLR5.

More Details about


Target Name


Target Species


Application Notes

Recommended Applications
ELISA (dilution: , 1/100), Flow Cytometry, Immunohistology - Paraffin, Western Blotting


This product specifically recognizes human Toll-like receptor 5 (TLR5), a member of the evolutionarily conserved Toll-like receptor family, highly expressed by peripheral blood leukocytes, and in particular monocytes, which signals through the adaptor proteins MyD88 and TRAF6, inducing the activation of the transcription factor NF-kappaB.

TLR5 plays an important role in the innate immune response to pathogenic bacteria, through the recognition of the protein monomer flagellin, which upregulates TLR5 expression.

This product is reported as suitable for use in immunocytochemistry.


Store at -20 °C only.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
If stored in this manner, this product is stable for 18 months after receipt.


Supplied as:
Purified IgG - liquid
Phosphate buffered saline
Format Type:


IgG concentration 1.0mg/ml


Antiserum to human TLRS was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.

Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to amino acids 151-181 of human TLR5.
0.09% Sodium Azide (NaN3
0.1% Bovine Serum Albumin


Purified IgG prepared by Immunoaffinity chromatography



This product is furnished for LABORATORY RESEARCH USE ONLY. Not for diagnostic or therapeutic use.


Contact us about this product :

Our team will respond you as soon as possible !

Email :
Skype :
Name :
Phone :
address :
Question, Comment ... :
arrow security gentaurPlease retype this code below:
Ray_Biotech \ Goat_Anti_Human_TLR5 \ 129_10647
Reload Image


GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45 | Gentaur

Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411 | Gentaur



9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017


Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925 | Gentaur

Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123

GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897 | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U

tel:0911876558 | Gentaur

ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: | Gentaur
IBAN: BG11FINV91501014771636

GENTAUR Poland Sp. z o.o.

ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48       | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556


Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94 | Gentaur