GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc 6017 Snell Ave, Ste 357, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, sales@genprice.com

Index / BPS Bioscience / VEGF165, Active Human Recombinant Protein / Product Detail : 91001-2 VEGF165, Active Human Recombinant Protein
Related keywords:

Jul
30th

#91001-2 VEGF165, Active Human Recombinant Protein

Ask technical file .

  Price : 1226   EUR
1391   USD
951   GBP
5150   Zloty
164038   JPY
9454   NOK
10130   SEK
1386   CHF

Product name : VEGF165, Active Human Recombinant Protein

Catalog number : 91001-2

Quantity: 100

Availability: Yes

Supplier name : BPS Bioscience

ask pdf gentaur products Data sheet: Ask more or other datasheet now !

About this Product :

VEGF165, Active Human Recombinant Protein recombinant proteins Most stable storage is at - 81 C or lower but some lyophilised proteins can be stored at +4C. Please read carefully the data sheet of the VEGF165, Active Human Recombinant Protein.
http://mybiofast.com/ver.php?search=rec.&submit=Search

VEGF165, Active Human Recombinant Protein Human samples 80 % of the research is conducted on human samples. GENTAUR suppliers human normal cells, cell lines, RNA extracts and lots of antibodies and ELISA kits to Human proteins as well as VEGF165, Active Human Recombinant Protein.
http://mybiofast.com/ver.php?search=human+&submit=Search

More Details about

Description: Recombinant human VEGF165 (GenBank Accession No. NM_001025368) is a 38.2
kDa disulfide-linked homodimeric protein (a.a. 207-371), consisting of two 165 amino acid
polypeptide.

Source: E.coli

Stability: The lyophilized protein is stable for at least 2 years from date of receipt at -20°C.

Purity: >98% by SDS-PAGE and HPLC analysis.

Endotoxin Level: < 1EU per µg of VEGF as determined by the LAL method.

Biological Activity: ED50 is less than 3 ng/ml as determined by the dose-dependent stimulation
of the proliferation of human umbilical vein endothelial cells (HUVEC).

STORAGE/HANDLING:
The lyophilized powder, though stable at room temperature, is best
stored at -20°C. After a quick spin, reconstitute with sterile 4 mM
HCl to a concentration of 0.1-1.0 mg/mL. This solution can be
diluted into water or other buffered solutions and stored at 4°C for
one week or at -20°C for future use. Reconstituted human VEGF
should be stored in undiluted aliquots at -20°C for up to six months.

AA SEQUENCE:
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPD
EIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKP
HQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKH
LFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

References:
1. VEGF serum levels are not associated with Parkinson's disease Eur. J. Neurol. 14 (8), E6
(2007)
2. Association between vascular endothelial growth factor gene polymorphisms and
survival in hepatocellular carcinoma patients Hepatology 46 (2), 446-455 (2007)

Contact us about this product :

Our team will respond you as soon as possible !

Email :
Skype :
Name :
Phone :
address :
Question, Comment ... :
arrow security gentaurPlease retype this code below:
BPS_Bioscience \ VEGF165,_Active_Human_Recombinant_Protein \ 91001_2
Reload Image

 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur