Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, GENTAUR another in time delivery

Pubmed ID :874109
Publication Date : //

Estimation of serum gentamicin by quenching fluoroimmunoassay.


A new type of non-isotopic immunoassay, applied to the determination of serum gentamicin, is reported. The method is based on partial quenching of fluorescence observed when fluorescein-labelled gentamicin is bound by anti-gentamicin serum. The fluorescence intensity of the labelled gentamicin in an unseparated immunoassay incubation mixture therefore serves to indicate the extent of binding, which is related to the amount of competing unlabelled gentamicin present. Precision and accuracy are shown to be similar to those of the best existing methods for gentamicin, while the new assay is more rapid and technically simpler, and avoids the use of expensive radio-chemicals with their attendant health hazard. Assays of patient samples correlate with established bioassay and polarisation fluoroimmunoassay methods.

Authors : Shaw E J , Watson R A , Landon J , Smith D S ,

Related products :

Catalog number Product name Quantity
SCH-4630-0004 SHEEP ANTI GENTAMICIN, Product Type Polyclonal Antibody, Specificity GENTAMICIN, Target Species Chemical, Host Sheep, Format Serum, Isotypes Polyclonal IgG, Applications E, Clone 0.5 ml
4630-0004 SHEEP ANTI GENTAMICIN, Product Type Polyclonal Antibody, Specificity GENTAMICIN, Target Species Chemical, Host Sheep, Format Serum, Isotypes Polyclonal IgG, Applications E, Clone 0.5 ml
OBT1432 Theophylline, Sheep anti; Polarisation Fluoroimmunoassay 1 ml.
KP0750 FRETS - VWF73 (Fluorescence - Quenching Substrate for ADAMTS - 13)DRE - Dap(Nma) - APNLVYMVTG - Dpa - PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR 2 mg
KP0749 FRETS - VWF73 (Fluorescence - Quenching Substrate for ADAMTS - 13)DRE - Dap(Nma) - APNLVYMVTG - Dpa - PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR 1 mg
1248 GENTAMICIN, SERUM 1
3791 SPECIFIC IgE GENTAMICIN, SERUM 1
S-07890 SILVER ESTIMATION PAPER'S 200 lvs
S-07889 SILVER ESTIMATION PAPER'S 100 lvs
S89731 1ul Spot Protein Estimation 300 Assay
S89731 1ul Spot Protein Estimation 300 Assay
TM 572 PKU TEST AGAR BASE (for estimation of phenylal 500 gm
FIBROQUANT Reagent for quantitative estimation of fibrinogen 20 Test
TM 572 PKU TEST AGAR BASE (for estimation of phenylal 500 gm
BSP061 Phosphoprotein Phosphate Estimation Assay Kit 2000 Assays
0633400500 O-TOLIDINE (REAGENT) FOR CHLORINE ESTIMATION 10x500ML
TM 175 M_ENDO BROTH (for estimation of coliforms in water samp 500 gm
TM 175 M_ENDO BROTH (for estimation of coliforms in water samp 100 gm
TM 175 M_ENDO BROTH (for estimation of coliforms in water samp 500 gm
TM 175 M_ENDO BROTH (for estimation of coliforms in water samp 100 gm
FIBROSCREEN Thrombin Time reagent for qualitative estimation of fibrinogen 6x1 ml
B885 Luria Agar USE : For routine cultivation and estimation of not particularly fastidious microorganisms. 5x500gm
HEMOCORSTANDARD Liquid stable, Haemoglobin standard for quantitative estimation of Hb in whole blood 10 ml
B885 Luria Agar USE For routine cultivation and estimation of not particularly fastidious microorganisms. Qty per Litre of Medium: 35
TM 897 TRYPTONE YEAST EXTRACT AGAR (for estimation of microbial counts in water.) 500 gm


 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur