GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc 6017 Snell Ave, Ste 357, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908,

Full view Results
Gly_Amyloid b_Protein (15_25)_Gly_e_aminocaproyl(_Lys)6 Salt _ Binding _ Synonym H_Gly_Gln_Lys_Leu_Val_Phe_Phe_Ala_Glu_Asp_Val_Gly_Gly_eAhx_Lys_Lys_Lys_Lys_Lys_Lys_OH SumFormula C105H178N28O26

268 €
304 $
208 £

Catalog number: H-3978.0500
Product Quantity: 0.5 mg
Supplier: Bach
Gly_Amyloid b_Protein (15_25)_Gly_e_aminocaproyl(_Lys)6 Salt _ Binding _ Synonym H_Gly_Gln_Lys_Leu_Val_Phe_Phe_Ala_Glu_Asp_Val_Gly_Gly_eAhx_Lys_Lys_Lys_Lys_Lys_Lys_OH SumFormula C105H178N28O26

451 €
512 $
350 £

Catalog number: H-3978.1000
Product Quantity: 1.0 mg
Supplier: Bach
Gly-Amyloid β-Protein (15-25)-Gly-ε-aminocaproyl(-Lys)6 H-Gly-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Gly-εAhx-Lys-Lys-Lys-Lys-Lys-Lys-OH 98% C105H178N28O26 CAS: 184951-46-0

746 €
847 $
579 £

Catalog number: A-1435-2
Product Quantity: 5mg
Supplier: Other suppliers
SV40 Nuclear Transport Signal Peptide Analog (AA: Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly) (MW: 1377.68)

390 €
443 $
302 £

Catalog number: SP-88501-5
Product Quantity: 5 mg
Supplier: ADI
SV40 Nuclear Transport Signal Peptide Analog Formula C60H104N20O15S Sequence Cys_Gly_Tyr_Gly_Pro_Lys_Lys_Lys_Arg_Lys_Val_Gly_Gly

266 €
302 $
206 £

Catalog number: 88501
Product Quantity: 5mg
Supplier: GLSChina
Sequence Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly; MF C60H104N20O15S; MW 1377.68

355 €
403 $
275 £

Catalog number: 431-97389-1
Product Quantity: 5 mg
Sequence Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly; MF C60H104N20O15S; MW 1377.68

475 €
539 $
368 £

Catalog number: 431-97389-2
Product Quantity: 10 mg
Sequence Cys-Gly-Tyr-Gly-Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly-Gly; MF C60H104N20O15S; MW 1377.68

775 €
880 $
601 £

Catalog number: 431-97389-3
Product Quantity: 25 mg
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (33-40) (AA: ys-Gly-Lys-Lys-Gly-Gly-Leu-Met-Val-Gly-Gly-Val-Val) (MW: 1203.52)

390 €
443 $
302 £

Catalog number: SP-89308-5
Product Quantity: 5 mg
Supplier: ADI

224 €
255 $
174 £

Catalog number: 3058
Product Quantity: 0.1g
Supplier: Sceti K.K.
Cys_Gly_Lys_Lys_Gly_Amyloid ß _Protein (37_42) Formula C42H77N13O12S Sequence Cys_Gly_Lys_Lys_Gly_Gly_Gly_Val_Val_Ile_Ala

237 €
269 $
184 £

Catalog number: 89311
Product Quantity: 5mg
Supplier: GLSChina
Cys_Gly_Lys_Lys_Gly_Amyloid ß _Protein (33_40) Formula C51H92N15O14S2 Sequence Cys_Gly_Lys_Lys_Gly_Gly_Leu_Met_Val_Gly_Gly_Val_Val

266 €
302 $
206 £

Catalog number: 89308
Product Quantity: 5mg
Supplier: GLSChina
Ac-Gly-Lys-OMe・AcOH [AGLME]

Ask price

Catalog number: 3058
Product Quantity: EUR
Supplier: Sceti
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42) (AA:Cys-Gly-Lys-Lys-Gly-Gly-Gly-Val-Val-Ile-Ala) (MW: 988.22)

390 €
443 $
302 £

Catalog number: SP-89311-5
Product Quantity: 5 mg
Supplier: ADI
Cys_Gly_Lys_Lys_Gly_Amyloid ß _Protein (35_40) Formula C43H79N13O12S2 Sequence Cys_Gly_Lys_Lys_Gly_Met_Val_Gly_Gly_Val_Val

237 €
269 $
184 £

Catalog number: 89309
Product Quantity: 5mg
Supplier: GLSChina
Cys_Gly_Lys_Lys_Gly_Amyloid ß _Protein (36_42) Formula C47H85N14O13S Sequence Cys_Gly_Lys_Lys_Gly_Val_Gly_Gly_Val_Val_I le_Ala

252 €
286 $
195 £

Catalog number: 89310
Product Quantity: 5mg
Supplier: GLSChina
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (36-42) (AA: Cys-Gly-Lys-Lys-Gly-Val-Gly-Gly-Val-Val-Ile-Ala) (MW: 1087.35)

390 €
443 $
302 £

Catalog number: SP-89310-5
Product Quantity: 5 mg
Supplier: ADI
Lys-Lys-IRS-1 (891-902) (dephosphorylated) (human) (AA: Lys-Lys-Lys-Ser-Pro-Gly-Glu-Tyr-Val-Asn-Ile-Glu-Phe-Gly) (MW: 1595.83)

390 €
443 $
302 £

Catalog number: SP-63074-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Lys-Gly-Arg-Gly-Lys-Gln-Gly-Gly-Lys-Val-Arg-Ala-Lys-Ala-Lys-Thr-Arg-Ser-Ser; MF C82H154N34O24; MW 2000.36

576 €
654 $
447 £

Catalog number: 431-64053-3
Product Quantity: 2.5 mg
Sequence Lys-Gly-Arg-Gly-Lys-Gln-Gly-Gly-Lys-Val-Arg-Ala-Lys-Ala-Lys-Thr-Arg-Ser-Ser; MF C82H154N34O24; MW 2000.36

373 €
423 $
289 £

Catalog number: 431-64053-2
Product Quantity: 1mg
Sequence Lys-Gly-Arg-Gly-Lys-Gln-Gly-Gly-Lys-Val-Arg-Ala-Lys-Ala-Lys-Thr-Arg-Ser-Ser; MF C82H154N34O24; MW 2000.36

307 €
348 $
238 £

Catalog number: 431-64053-1
Product Quantity: 500
Parasin I Formula C82H154N34O24 Sequence Lys_Gly_Arg_Gly_Lys_Gln_Gly_Gly_Lys_Val_Arg_Ala_Lys_Ala_Lys_Thr_Arg_Ser_Ser

215 €
244 $
166 £

Catalog number: 55165
Product Quantity: 0.5mg
Supplier: GLSChina
Lys_Lys_IRS_1 (891_902) (dephosphorylated) (human) Formula C73H114N18O22 Sequence Lys_Lys_Lys_Ser_Pro_Gly_Glu_Tyr_Val_Asn_Ile_Glu_Phe_Gly

281 €
319 $
218 £

Catalog number: 63074
Product Quantity: 5mg
Supplier: GLSChina
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (35-40) (AA: Cys-Gly-Lys-Lys-Gly-Met-Val-Gly-Gly-Val-Val) (MW: 1034.31)

390 €
443 $
302 £

Catalog number: SP-89309-5
Product Quantity: 5 mg
Supplier: ADI
Magainin 1 Formula C112H177N29O28S Sequence Gly_Ile_Gly_Lys_Phe_Leu_His_Ser_Ala_Gly_Lys_Phe_Gly_Lys_Ala_Phe_Val_Gly_Glu_Ile_Met_Lys_Ser

194 €
221 $
151 £

Catalog number: 55220
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Gly-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Lys-Ser; MF C112H177N29O28S; MW 2409.9

509 €
578 $
395 £

Catalog number: 431-64108-2
Product Quantity: 5 mg
Sequence Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Gly-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Lys-Ser; MF C112H177N29O28S; MW 2409.9

727 €
825 $
564 £

Catalog number: 431-64108-3
Product Quantity: 10 mg
Sequence Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Gly-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Lys-Ser; MF C112H177N29O28S; MW 2409.9

307 €
348 $
238 £

Catalog number: 431-64108-1
Product Quantity: 1mg
Enkephalin_Lys_Lys _Methionine (Tyr_Gly_Gly_Phe_Met_Lys_Lys) _ 1mg

124 €
140 $
96 £

Catalog number: 024-53
Product Quantity: 1 mg
Supplier: Phoenix Peptide
Histone H1 _ derived peptide Formula C56H101N17O15 Sequence Gly_Gly_Gly_Pro_Ala_Thr_Pro_Lys_Lys_Ala_Lys_Lys_Leu

266 €
302 $
206 £

Catalog number: 86708
Product Quantity: 5mg
Supplier: GLSChina
Cecropin A Formula C184H313N53O46 Sequence Lys_Trp_Lys_Leu_Phe_Lys_Lys_Ile_Glu_Lys_Val_Gly_Gln_Asn_Ile_Arg_Asp_Gly_Ile_Ile_Lys_Ala_Gly_Pro_Ala_Val_Ala_Val_Val_Gly_Gln_Ala_Thr_Gln_Ile_Ala_Lys_NH2

318 €
361 $
247 £

Catalog number: 61318
Product Quantity: 1mg
Supplier: GLSChina
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2; MF C184H313N53O46; MW 4003.87

921 €
1045 $
714 £

Catalog number: 431-70206-2
Product Quantity: 5 mg
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2; MF C184H313N53O46; MW 4003.87

407 €
462 $
316 £

Catalog number: 431-70206-1
Product Quantity: 1mg
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2; MF C184H313N53O46; MW 4003.87

1277 €
1449 $
991 £

Catalog number: 431-70206-3
Product Quantity: 10 mg
mCRAMP, mouse Formula C178H302N50O46 Sequence Gly_Leu_Leu_Arg_Lys_Gly_Gly_Glu_Lys_Ile_Gly_Glu_Lys_Leu_Lys_Lys_Ile_Gly_Gln_Lys_Ile_Lys_Asn_Phe_Phe_Gln_Lys_Leu_Val_Pro_Gln_Pro_Glu_Gln

243 €
276 $
189 £

Catalog number: 88328
Product Quantity: 1mg
Supplier: GLSChina
Cecropin A (AA: Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2) (MW: 4003.87)

557 €
632 $
432 £

Catalog number: SP-61318-1
Product Quantity: 1 mg
Supplier: ADI
CAP _ 18, rabbit Formula C202H356N64O47 Sequence Gly_Leu_Arg_Lys_Arg_Leu_Arg_Lys_Phe_Arg_Asn_Lys_Ile_Lys_Glu_Lys_Leu_Lys_Lys_Ile_Gly_Gln_Lys_Ile_Gln_Gly_Leu_Leu_Pro_Lys_Leu_Ala_Pro_Arg_Thr_Asp_Tyr

315 €
358 $
244 £

Catalog number: 88322
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln; MF C178H302N50O46; MW 3878.70

970 €
1101 $
752 £

Catalog number: 431-97216-3
Product Quantity: 10 mg
Sequence Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln; MF C178H302N50O46; MW 3878.70

339 €
384 $
263 £

Catalog number: 431-97216-1
Product Quantity: 1mg
Sequence Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln; MF C178H302N50O46; MW 3878.70

679 €
771 $
527 £

Catalog number: 431-97216-2
Product Quantity: 5 mg
Sequence Gly-Gly-Gly-Pro-Ala-Thr-Pro-Lys-Lys-Ala-Lys-Lys-Leu; MF C56H101N17O15; MW 1252.53

775 €
880 $
601 £

Catalog number: 431-95596-3
Product Quantity: 25 mg
Histone H1 - derived peptide (AA: Gly-Gly-Gly-Pro-Ala-Thr-Pro-Lys-Lys-Ala-Lys-Lys-Leu) (MW: 1252.53)

390 €
443 $
302 £

Catalog number: SP-86708-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Gly-Gly-Gly-Pro-Ala-Thr-Pro-Lys-Lys-Ala-Lys-Lys-Leu; MF C56H101N17O15; MW 1252.53

475 €
539 $
368 £

Catalog number: 431-95596-2
Product Quantity: 10 mg
Sequence Gly-Gly-Gly-Pro-Ala-Thr-Pro-Lys-Lys-Ala-Lys-Lys-Leu; MF C56H101N17O15; MW 1252.53

355 €
403 $
275 £

Catalog number: 431-95596-1
Product Quantity: 5 mg
Magainin 1 [H-Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Gly-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Lys-Ser-OH; MW 249.9]

210 €
239 $
163 £

Catalog number: SP-55220-5
Product Quantity: 0.5 mg
Supplier: ADI
MF C178H302N50O46 ; MW 3878.63; GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ, Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu

407 €
462 $
316 £

Catalog number: RB-PP-1029
Product Quantity: 1 mg
Sequence Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Lys-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Asn-Ser; MF C114H180N30O29S; MW 2466.95

727 €
825 $
564 £

Catalog number: 431-64107-3
Product Quantity: 10 mg
Sequence Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Lys-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Asn-Ser; MF C114H180N30O29S; MW 2466.95

307 €
348 $
238 £

Catalog number: 431-64107-1
Product Quantity: 1mg
Sequence Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Lys-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Asn-Ser; MF C114H180N30O29S; MW 2466.95

509 €
578 $
395 £

Catalog number: 431-64107-2
Product Quantity: 5 mg
Magainin 2 Formula C114H180N30O29S Sequence Gly_Ile_Gly_Lys_Phe_Leu_His_Ser_Ala_Lys_Lys_Phe_Gly_Lys_Ala_Phe_Val_Gly_Glu_Ile_Met_Asn_Ser

194 €
221 $
151 £

Catalog number: 55219
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr; MF C202H356N64O47; MW 4433.49

1277 €
1449 $
991 £

Catalog number: 431-97210-3
Product Quantity: 10 mg
Sequence Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr; MF C202H356N64O47; MW 4433.49

373 €
423 $
289 £

Catalog number: 431-97210-1
Product Quantity: 1mg
Sequence Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr; MF C202H356N64O47; MW 4433.49

921 €
1045 $
714 £

Catalog number: 431-97210-2
Product Quantity: 5 mg
Sequence Arg-Trp-Lys-Ile-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Gly-Ser-Tyr-Cys-Asn-Arg-Arg-Thr-Gly-Lys-Cys-Gln-Arg-Met; MF C138H230N46O34S4; MW 3205.9

323 €
366 $
250 £

Catalog number: 431-60501-1
Product Quantity: 1mg
Sequence Arg-Trp-Lys-Ile-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Gly-Ser-Tyr-Cys-Asn-Arg-Arg-Thr-Gly-Lys-Cys-Gln-Arg-Met; MF C138H230N46O34S4; MW 3205.9

373 €
423 $
289 £

Catalog number: 431-60501-2
Product Quantity: 2mg
Sequence Arg-Trp-Lys-Ile-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Gly-Ser-Tyr-Cys-Asn-Arg-Arg-Thr-Gly-Lys-Cys-Gln-Arg-Met; MF C138H230N46O34S4; MW 3205.9

594 €
675 $
461 £

Catalog number: 431-60501-3
Product Quantity: 5 mg
MF C202H356N64O47 ; MW 4433.41 ; GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY, Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-

543 €
616 $
421 £

Catalog number: RB-PP-0427
Product Quantity: 1 mg
CAP - 18, rabbit (AA: Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr) (MW: 4433.49)

472 €
536 $
366 £

Catalog number: SP-88322-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Cys-Gly-Lys-Lys-Gly-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C51H92N15O14S2; MW 1203.52

775 €
880 $
601 £

Catalog number: 431-98196-3
Product Quantity: 25 mg
Sequence Cys-Gly-Lys-Lys-Gly-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C51H92N15O14S2; MW 1203.52

475 €
539 $
368 £

Catalog number: 431-98196-2
Product Quantity: 10 mg
Sequence Cys-Gly-Lys-Lys-Gly-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C51H92N15O14S2; MW 1203.52

355 €
403 $
275 £

Catalog number: 431-98196-1
Product Quantity: 5 mg
mCRAMP, mouse (AA: Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln) (MW: 3878.70)

390 €
443 $
302 £

Catalog number: SP-88328-1
Product Quantity: 1 mg
Supplier: ADI
CB_TH Formula C138H230N46O34S4 Sequence Arg_Trp_Lys_Ile_Phe_Lys_Lys_Ile_Glu_Lys_Met_Gly_Gly_Ser_Tyr_Cys_Asn_Arg_Arg_Thr_Gly_Lys_Cys_Gln_Arg_Met

218 €
247 $
169 £

Catalog number: 51613
Product Quantity: 1mg
Supplier: GLSChina
H_Lys(Boc)_OMe hydrochloride H_Lys(Boc)_OMe.HCl

Ask price

Catalog number: 2389-48-2
Product Quantity: 1g
Supplier: chemotra
MF C56H101N17O15 ; MW 1252.51 ; GGGPATPKKAKKL , Gly-Gly-Gly-Pro-Ala-Thr-Pro-Lys-Lys-Ala-Lys-Lys-Leu

323 €
366 $
250 £

Catalog number: RB-PP-0781
Product Quantity: 1 mg
Sequence Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu; MF C60H102N16O17; MW 1319.58

727 €
825 $
564 £

Catalog number: 431-95496-3
Product Quantity: 25 mg
Sequence Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu; MF C60H102N16O17; MW 1319.58

440 €
500 $
341 £

Catalog number: 431-95496-2
Product Quantity: 10 mg
MF C64H109N17O18 ; MW 1404.66 ; GKKVITAFNEGLK , Gly-Lys-Lys-Val-Ile-Thr-Ala-Phe-Asn-Glu-Gly-Leu-Lys

323 €
366 $
250 £

Catalog number: RB-PP-0769
Product Quantity: 1 mg
Sequence Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu; MF C60H102N16O17 ; MW 1319.56; GKVLSKIFGNKE ,

307 €
348 $
238 £

Catalog number: RB-PP-0173
Product Quantity: 1 mg
Sequence Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu; MF C60H102N16O17; MW 1319.58

339 €
384 $
263 £

Catalog number: 431-95496-1
Product Quantity: 5 mg
Sequence Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Me

1245 €
1413 $
966 £

Catalog number: 431-98437-3
Product Quantity: 2.5 mg
Sequence Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Me

576 €
654 $
447 £

Catalog number: 431-98437-1
Product Quantity: 500
Sequence Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Me

775 €
880 $
601 £

Catalog number: 431-98437-2
Product Quantity: 1mg
Parasin I [H-Lys-Gly-Arg-Gly-Lys-Gln-Gly-Gly-Lys-Val-Arg-Ala-Lys-Ala-Lys-Thr-Arg-Ser-Ser-OH; MW: 2.36]

318 €
361 $
247 £

Catalog number: SP-55165-1
Product Quantity: 0.5 mg
Supplier: ADI
Sequence Myristoyl -Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu; MF C74H128N16O18; MW 1529.95

355 €
403 $
275 £

Catalog number: 431-109711-1
Product Quantity: 5 mg
Sequence Myristoyl -Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu; MF C74H128N16O18; MW 1529.95

475 €
539 $
368 £

Catalog number: 431-109711-2
Product Quantity: 10 mg
Hemoglobin (Hb) (64 _ 76) Formula C64H109N17O18 Sequence Gly_Lys_Lys_Val_Ile_Thr_Ala_Phe_Asn_Glu_Gly_Leu_Lys

266 €
302 $
206 £

Catalog number: 86735
Product Quantity: 5mg
Supplier: GLSChina
Sequence Gly-Lys-Lys-Val-Ile-Thr-Ala-Phe-Asn-Glu-Gly-Leu-Lys; MF C64H109N17O18; MW 1404.69

475 €
539 $
368 £

Catalog number: 431-95623-2
Product Quantity: 10 mg
Sequence Myristoyl -Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu; MF C74H128N16O18; MW 1529.95

775 €
880 $
601 £

Catalog number: 431-109711-3
Product Quantity: 25 mg
Sequence Gly-Lys-Lys-Val-Ile-Thr-Ala-Phe-Asn-Glu-Gly-Leu-Lys; MF C64H109N17O18; MW 1404.69

775 €
880 $
601 £

Catalog number: 431-95623-3
Product Quantity: 25 mg
ADP - Ribosylation Factor 6, ARF6 (2 - 13) (AA: Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu) (MW: 1319.58)

390 €
443 $
302 £

Catalog number: SP-86608-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Gly-Lys-Lys-Val-Ile-Thr-Ala-Phe-Asn-Glu-Gly-Leu-Lys; MF C64H109N17O18; MW 1404.69

355 €
403 $
275 £

Catalog number: 431-95623-1
Product Quantity: 5 mg
C_TypeNatriureticPept(1_53)hum(AA Asp_Leu_Arg_Val_Asp_Thr_Lys_Ser_Arg_Ala_Ala_Trp_Ala_Arg_Leu_Leu_Gln_Glu_His_Pro_Asn_Ala_Arg_Lys_Tyr_Lys_Gly_Ala_Asn_Lys_Lys_Gly_Leu_Ser_Lys_Gly_Cys_Phe_Gly_Leu_Lys_Le

802 €
910 $
622 £

Catalog number: SP-89549-05
Product Quantity: 0.5 mg
Supplier: Alpha Dia
Sequence Cys-Gly-Lys-Lys-Gly-Gly-Gly-Val-Val-Ile-Ala; MF C42H77N13O12S; MW 988.22

407 €
462 $
316 £

Catalog number: 431-98199-2
Product Quantity: 10 mg
Sequence Cys-Gly-Lys-Lys-Gly-Gly-Gly-Val-Val-Ile-Ala; MF C42H77N13O12S; MW 988.22

695 €
789 $
539 £

Catalog number: 431-98199-3
Product Quantity: 25 mg
Sequence Cys-Gly-Lys-Lys-Gly-Gly-Gly-Val-Val-Ile-Ala; MF C42H77N13O12S; MW 988.22

323 €
366 $
250 £

Catalog number: 431-98199-1
Product Quantity: 5 mg
Magainin 2 [H-Gly-Ile-Gly-Lys-Phe-Leu-His-Ser-Ala-Lys-Lys-Phe-Gly-Lys-Ala-Phe-Val-Gly-Glu-Ile-Met-Asn-Ser-OH; MW 2466.95]

190 €
216 $
147 £

Catalog number: SP-55219-5
Product Quantity: 0.5 mg
Supplier: ADI
MARCKS Substrate (151_175) Formula C147H246N41O40P3 Sequence Lys_Lys_Lys_Lys_Lys_Arg_Phe_pSer_Phe_Lys_Lys_pSer_Phe_Lys_Leu_Ser_Gly_Phe_pSer_Phe_Lys_Lys_Asn_Lys_Lys

365 €
415 $
283 £

Catalog number: 101389
Product Quantity: 1mg
Supplier: GLSChina
Cecropin B, Free Acid Formula C176H302N52O41S Sequence Lys_Trp_Lys_Val_Phe_Lys_Lys_Ile_Glu_Lys_Met_Gly_Arg_Asn_Ile_Arg_Asn_Gly_Ile_Val_Lys_Ala_Gly_Pro_Ala_Ile_Ala_Val_Leu_Gly_Glu_Ala_Lys_Ala_Leu

300 €
341 $
233 £

Catalog number: 70679
Product Quantity: 1mg
Supplier: GLSChina
CB-TH [Arg-Trp-Lys-Ile-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Gly-Ser-Tyr-Cys-Asn-Arg-Arg-Thr-Gly-Lys-Cys-Gln-Arg-Met-OH; MW: 3205.9]

325 €
369 $
252 £

Catalog number: SP-51613-1
Product Quantity: 1 mg
Supplier: ADI
ADP _ Ribosylation Factor 6,ARF6 (2 _ 13) Formula C60H102N16O17 Sequence Gly_Lys_Val_Leu_Ser_Lys_Ile_Phe_Gly_Asn_Lys_Glu

252 €
286 $
195 £

Catalog number: 86608
Product Quantity: 5mg
Supplier: GLSChina
Myristoylated ADP - Ribosylation Factor 6, myr - ARF6 (2 - 13) (AA: Myristoyl -Gly-Lys-Val-Leu-Ser-Lys-Ile-Phe-Gly-Asn-Lys-Glu) (MW: 1529.95)

390 €
443 $
302 £

Catalog number: SP-100823-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2; MF C176H302N52O41S1; MW 3834.76

1245 €
1413 $
966 £

Catalog number: 431-64185-3
Product Quantity: 10 mg
Sequence Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2; MF C176H302N52O41S1; MW 3834.76

857 €
972 $
664 £

Catalog number: 431-64185-2
Product Quantity: 5 mg
Cecropin B Formula C176H302N52O41S1 Sequence Lys_Trp_Lys_Val_Phe_Lys_Lys_Ile_Glu_Lys_Met_Gly_Arg_Asn_Ile_Arg_Asn_Gly_Ile_Val_Lys_Ala_Gly_Pro_Ala_Ile_Ala_Val_Leu_Gly_Glu_Ala_Lys_Ala_Leu_NH2

307 €
348 $
238 £

Catalog number: 55297
Product Quantity: 1mg
Supplier: GLSChina
Sequence Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2; MF C176H302N52O41S1; MW 3834.76

373 €
423 $
289 £

Catalog number: 431-64185-1
Product Quantity: 1mg
Lytic Peptide, SB – 37 Formula C188H320N54O45S Sequence Met_Pro_Lys_Trp_Lys_Val_Phe_Lys_Lys_Ile_Glu_Lys_Val_Gly_Arg_Asn_Ile_Arg_Asn_Gly_Ile_Val_Lys_Ala_Gly_Pro_Ala_Ile_Ala_Val_Leu_Gly_Glu_Ala_Lys_Al

257 €
292 $
200 £

Catalog number: 88326
Product Quantity: 1mg
Supplier: GLSChina
C_Type Natriuretic Peptide (1_22), human Formula C93H157N27O28S3 Sequence Gly_Leu_Ser_Lys_Gly_Cys_Phe_Gly_Leu_Lys_Leu_Asp_Arg_Ile_Gly_Ser_Met_Ser_Gly_Leu_Gly_Cys(Disulfide bridge Cys6_Cys22)

207 €
235 $
161 £

Catalog number: 52233
Product Quantity: 0.5mg
Supplier: GLSChina
[Tyr0]_C_Type Natriuretic Peptide (32_53) (human, porcine, rat) Formula C102H166N28O30S3 Sequence Tyr_Gly_Leu_Ser_Lys_Gly_Cys_Phe_Gly_Leu_Lys_Leu_Asp_Arg_Ile_Gly_Ser_Met_Ser_Gly_Leu_Gly_Cys (Disulf

203 €
230 $
157 £

Catalog number: 89550
Product Quantity: 1mg
Supplier: GLSChina
[Tyr0]-C-Type Natriuretic Peptide (32-53) (human, porcine, rat) [Tyr-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge: Cys7-Cys23); MW 2360.8

306 €
347 $
237 £

Catalog number: SP-89550-1
Product Quantity: 1 mg
Supplier: ADI
MARCKS Substrate (151-175) (AA: Lys-Lys-Lys-Lys-Lys-Arg-Phe-pSer-Phe-Lys-Lys-pSer-Phe-Lys-Leu-Ser-Gly-Phe-pSer-Phe-Lys-Lys-Asn-Lys-Lys) (MW: 3320.78)

390 €
443 $
302 £

Catalog number: SP-101389-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Tyr-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge Cys7-Cys23); MF C102H166N28O30S3; MW 2360.82

594 €
675 $
461 £

Catalog number: 431-98438-2
Product Quantity: 5 mg
Sequence Tyr-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge Cys7-Cys23); MF C102H166N28O30S3; MW 2360.82

775 €
880 $
601 £

Catalog number: 431-98438-3
Product Quantity: 10 mg
Sequence Tyr-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge Cys7-Cys23); MF C102H166N28O30S3; MW 2360.82

307 €
348 $
238 £

Catalog number: 431-98438-1
Product Quantity: 1mg
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(Disulfide bridge Cys6-Cys22); MF C93H157N27O28S3; MW 2197.64

576 €
654 $
447 £

Catalog number: 431-61121-3
Product Quantity: 2.5 mg
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(Disulfide bridge Cys6-Cys22); MF C93H157N27O28S3; MW 2197.64

307 €
348 $
238 £

Catalog number: 431-61121-1
Product Quantity: 500
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(Disulfide bridge Cys6-Cys22); MF C93H157N27O28S3; MW 2197.64

355 €
403 $
275 £

Catalog number: 431-61121-2
Product Quantity: 1mg
Sequence Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu; MF C176H302N52O41S; MW 3834.73

1148 €
1303 $
890 £

Catalog number: 431-79567-3
Product Quantity: 10 mg
Sequence Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu; MF C176H302N52O41S; MW 3834.73

373 €
423 $
289 £

Catalog number: 431-79567-1
Product Quantity: 1mg
Sequence Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu; MF C176H302N52O41S; MW 3834.73

857 €
972 $
664 £

Catalog number: 431-79567-2
Product Quantity: 5 mg
Cecropin B, Free Acid (AA: Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu) (MW: 3834.73)

390 €
443 $
302 £

Catalog number: SP-70679-1
Product Quantity: 1 mg
Supplier: ADI
C-TypeNatriureticPept(1-53) human (AA:Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Ly

724 €
822 $
561 £

Catalog number: SP-89549-05
Product Quantity: 0.5 mg
Supplier: ADI
Sequence Met-Pro-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-Gly; MF C188H320N54O45S; MW 4089.05

727 €
825 $
564 £

Catalog number: 431-97214-2
Product Quantity: 5 mg
Sequence Met-Pro-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-Gly; MF C188H320N54O45S; MW 4089.05

339 €
384 $
263 £

Catalog number: 431-97214-1
Product Quantity: 1mg
Sequence Met-Pro-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-Gly; MF C188H320N54O45S; MW 4089.05

986 €
1119 $
765 £

Catalog number: 431-97214-3
Product Quantity: 10 mg
MARCKS Protein (151_175) Formula C147H243N41O31 Sequence Lys_Lys_Lys_Lys_Lys_Arg_Phe_Ser_Phe_Lys_Lys_Ser_Phe_Lys_Leu_Ser_Gly_Phe_Ser_Phe_Lys_Lys_Asn_Lys_Lys

203 €
230 $
157 £

Catalog number: 101467
Product Quantity: 1mg
Supplier: GLSChina
Cys_Gly_His_Gly_Asn_Lys_Ser_Amyloid ß _Protein (33_40) Formula C58H99N19O18S2 Sequence Cys_Gly_His_Gly_Asn_Lys_Ser_Gly_Leu_Met_Val_Gly_Gly_Val_Val

158 €
179 $
122 £

Catalog number: 89307
Product Quantity: 1mg
Supplier: GLSChina
Calcium_Calmodulin Dependent Protein Kinase II _ g(345 _ 358) Formula C58H107N21O22 Sequence Lys_Ser_Asp_Gly_Gly_Val_Lys_Lys_Arg_Lys_Ser_Ser_Ser_Ser

281 €
319 $
218 £

Catalog number: 86885
Product Quantity: 5mg
Supplier: GLSChina
Sequence Lys-Lys-Lys-Lys-Lys-Arg-Phe-pSer-Phe-Lys-Lys-pSer-Phe-Lys-Leu-Ser-Gly-Phe-pSer-Phe-Lys-Lys-Asn-Lys-Lys; MF C147H246N41O40P3; MW 3320.78

1520 €
1725 $
1179 £

Catalog number: 431-110277-3
Product Quantity: 10 mg
Sequence Lys-Lys-Lys-Lys-Lys-Arg-Phe-pSer-Phe-Lys-Lys-pSer-Phe-Lys-Leu-Ser-Gly-Phe-pSer-Phe-Lys-Lys-Asn-Lys-Lys; MF C147H246N41O40P3; MW 3320.78

986 €
1119 $
765 £

Catalog number: 431-110277-2
Product Quantity: 5 mg
Sequence Lys-Lys-Lys-Lys-Lys-Arg-Phe-pSer-Phe-Lys-Lys-pSer-Phe-Lys-Leu-Ser-Gly-Phe-pSer-Phe-Lys-Lys-Asn-Lys-Lys; MF C147H246N41O40P3; MW 3320.78

440 €
500 $
341 £

Catalog number: 431-110277-1
Product Quantity: 1mg
Sequence Cys-Gly-Lys-Lys-Gly-Val-Gly-Gly-Val-Val-Ile-Ala; MF C47H85N14O13S; MW 1087.35

727 €
825 $
564 £

Catalog number: 431-98198-3
Product Quantity: 25 mg
Sequence Cys-Gly-Lys-Lys-Gly-Val-Gly-Gly-Val-Val-Ile-Ala; MF C47H85N14O13S; MW 1087.35

339 €
384 $
263 £

Catalog number: 431-98198-1
Product Quantity: 5 mg
Sequence Cys-Gly-Lys-Lys-Gly-Val-Gly-Gly-Val-Val-Ile-Ala; MF C47H85N14O13S; MW 1087.35

440 €
500 $
341 £

Catalog number: 431-98198-2
Product Quantity: 10 mg
Calcium Calmodulin Dependent Protein Kinase II - g (345 - 358) (AA:Lys-Ser-Asp-Gly-Gly-Val-Lys-Lys-Arg-Lys-Ser-Ser-Ser-Ser) (MW: 1450.63)

390 €
443 $
302 £

Catalog number: SP-86885-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Tyr-Gly-Arg-Pro-Arg-Glu-Ser-Gly-Lys-Lys-Arg-Lys-Arg-Lys-Arg-Leu-Lys-Pro-Thr; MF C101H181N39O25; MW 2341.8

440 €
500 $
341 £

Catalog number: 431-110713-2
Product Quantity: 5 mg
Sequence Tyr-Gly-Arg-Pro-Arg-Glu-Ser-Gly-Lys-Lys-Arg-Lys-Arg-Lys-Arg-Leu-Lys-Pro-Thr; MF C101H181N39O25; MW 2341.8

257 €
292 $
200 £

Catalog number: 431-110713-1
Product Quantity: 1mg
Sequence Tyr-Gly-Arg-Pro-Arg-Glu-Ser-Gly-Lys-Lys-Arg-Lys-Arg-Lys-Arg-Leu-Lys-Pro-Thr; MF C101H181N39O25; MW 2341.8

662 €
751 $
513 £

Catalog number: 431-110713-3
Product Quantity: 10 mg
N-e-Cbz-D-Lys-OMe hydrochloride N-e-Cbz-D-Lys-OMe.H

Ask price

Catalog number: 145586-17-0
Product Quantity: 1g
Supplier: chemotra
Cecropin B [H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2; MW: 3834.76]

451 €
512 $
350 £

Catalog number: SP-55297-1
Product Quantity: 1 mg
Supplier: ADI
C-Type Natriuretic Peptide (1-22), Human [H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH; MW: 2197.64]

306 €
347 $
237 £

Catalog number: SP-52233-1
Product Quantity: 0.5 mg
Supplier: ADI
Sequence Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln; MF C181H302N50O48; MW 3946.73

970 €
1101 $
752 £

Catalog number: 431-97219-3
Product Quantity: 10 mg
Rcramp Formula C181H302N50O48 Sequence Gly_Leu_Val_Arg_Lys_Gly_Gly_Glu_Lys_Phe_Gly_Glu_Lys_Leu_Arg_Lys_Ile_Gly_Gln_Lys_Ile_Lys_Glu_Phe_Phe_Gln_Lys_Leu_Ala_Leu_Glu_Ile_Glu_Gln

243 €
276 $
189 £

Catalog number: 88331
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln; MF C181H302N50O48; MW 3946.73

679 €
771 $
527 £

Catalog number: 431-97219-2
Product Quantity: 5 mg
Sequence Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln; MF C181H302N50O48; MW 3946.73

339 €
384 $
263 £

Catalog number: 431-97219-1
Product Quantity: 1mg
Lytic Peptide, SB – 37 (AA: Met-Pro-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-Gly) (MW: 4089.05)

390 €
443 $
302 £

Catalog number: SP-88326-1
Product Quantity: 1 mg
Supplier: ADI
â_Endorphin (1_5) + (16_31),human Formula C112H173N27O29S Sequence Tyr_Gly_Gly_Phe_Met_Thr_Leu_Phe_Lys_Asn_Ala_Ile_Ile_Lys_Asn_Ala_Tyr_Lys_Lys_Gly_Glu

186 €
211 $
144 £

Catalog number: 87425
Product Quantity: 1mg
Supplier: GLSChina
Sequence Lys-Lys-Lys-Ser-Pro-Gly-Glu-Tyr-Val-Asn-Ile-Glu-Phe-Gly; MF C73H114N18O22; MW 1595.83

509 €
578 $
395 £

Catalog number: 431-71962-2
Product Quantity: 10 mg
Sequence Lys-Lys-Lys-Ser-Pro-Gly-Glu-Tyr-Val-Asn-Ile-Glu-Phe-Gly; MF C73H114N18O22; MW 1595.83

355 €
403 $
275 £

Catalog number: 431-71962-1
Product Quantity: 5 mg
Sequence Lys-Lys-Lys-Ser-Pro-Gly-Glu-Tyr-Val-Asn-Ile-Glu-Phe-Gly; MF C73H114N18O22; MW 1595.83

857 €
972 $
664 £

Catalog number: 431-71962-3
Product Quantity: 25 mg
MF C181H302N50O48 ; MW 3946.66 ; GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ, Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu

407 €
462 $
316 £

Catalog number: RB-PP-1379
Product Quantity: 1 mg
MF C73H114N18O22 ; MW 1595.80 ; KKKSPGEYVNIEFG, Lys-Lys-Lys-Ser-Pro-Gly-Glu-Tyr-Val-Asn-Ile-Glu-Phe-Gly

307 €
348 $
238 £

Catalog number: RB-PP-0945
Product Quantity: 1 mg
Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys; MF C89H133N25O22S; MW 1937.27

257 €
292 $
200 £

Catalog number: 431-64044-1
Product Quantity: 1mg
Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys; MF C89H133N25O22S; MW 1937.27

373 €
423 $
289 £

Catalog number: 431-64044-2
Product Quantity: 5 mg
Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys; MF C89H133N25O22S; MW 1937.27

576 €
654 $
447 £

Catalog number: 431-64044-3
Product Quantity: 10 mg
Cecropin A (1_8)_Melittin (1_18) amide Formula C136H233N33O29 Sequence Lys_Trp_Lys_Leu_Phe_Lys_Lys_Ile_Gly_Ile_Gly_Ala_Val_Leu_Lys_Val_Leu_Thr_Thr_Gly_Leu_Pro_Ala_Leu_Ile_Ser_NH2

212 €
241 $
165 £

Catalog number: 54694
Product Quantity: 1mg
Supplier: GLSChina
Sequence Cys-Gly-Lys-Lys-Gly-Met-Val-Gly-Gly-Val-Val; MF C43H79N13O12S2; MW 1034.31

323 €
366 $
250 £

Catalog number: 431-98197-1
Product Quantity: 5 mg
Sequence Cys-Gly-Lys-Lys-Gly-Met-Val-Gly-Gly-Val-Val; MF C43H79N13O12S2; MW 1034.31

695 €
789 $
539 £

Catalog number: 431-98197-3
Product Quantity: 25 mg
Sequence Cys-Gly-Lys-Lys-Gly-Met-Val-Gly-Gly-Val-Val; MF C43H79N13O12S2; MW 1034.31

407 €
462 $
316 £

Catalog number: 431-98197-2
Product Quantity: 10 mg
Kinase Domain of Insulin Receptor (1) (AA: Tyr-Glu-Thr-Asp-pTyr-Tyr-Arg-Lys-Gly-Gly-Lys-Gly-Leu) (MW: 1629.72)

390 €
443 $
302 £

Catalog number: SP-101379-5
Product Quantity: 5 mg
Supplier: ADI
ACTH (1_16), human Formula C89H133N25O22S Sequence Ser_Tyr_Ser_Met_Glu_His_Phe_Arg_Trp_Gly_Lys_Pro_Val_Gly_Lys_Lys

162 €
184 $
126 £

Catalog number: 55156
Product Quantity: 1mg
Supplier: GLSChina
MF C101H181N39O25 ; MW 2341.78 ; YGRPRESGKKRKRKRLKPT, Tyr-Gly-Arg-Pro-Arg-Glu-Ser-Gly-Lys-Lys-Arg-Lys-Arg-Lys-Arg-Leu-Lys-Pro-Thr

323 €
366 $
250 £

Catalog number: RB-PP-1559
Product Quantity: 1 mg
Sequence Tyr-Glu-Thr-Asp-pTyr-Tyr-Arg-Lys-Gly-Gly-Lys-Gly-Leu; MF C70H105N18O25P; MW 1629.72

475 €
539 $
368 £

Catalog number: 431-110267-2
Product Quantity: 10 mg
Sequence Tyr-Glu-Thr-Asp-pTyr-Tyr-Arg-Lys-Gly-Gly-Lys-Gly-Leu; MF C70H105N18O25P; MW 1629.72

775 €
880 $
601 £

Catalog number: 431-110267-3
Product Quantity: 25 mg
Sequence Tyr-Glu-Thr-Asp-pTyr-Tyr-Arg-Lys-Gly-Gly-Lys-Gly-Leu; MF C70H105N18O25P; MW 1629.72

339 €
384 $
263 £

Catalog number: 431-110267-1
Product Quantity: 5 mg
Kinase Domain of Insulin Receptor (1) Formula C70H105N18O25P Sequence Tyr_Glu_Thr_Asp_pTyr_Tyr_Arg_Lys_Gly_Gly_Lys_Gly_Leu

262 €
297 $
203 £

Catalog number: 101379
Product Quantity: 5mg
Supplier: GLSChina
RK9, p17 Gag (20 _ 28) Formula C45H86N18O10 Sequence Arg_Leu_Arg_Pro_Gly_Gly_Lys_Lys_Lys

212 €
241 $
165 £

Catalog number: 60866
Product Quantity: 5mg
Supplier: GLSChina
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C112H173N27O29S; MW 2393.86

274 €
312 $
213 £

Catalog number: 431-96313-1
Product Quantity: 1mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C112H173N27O29S; MW 2393.86

679 €
771 $
527 £

Catalog number: 431-96313-3
Product Quantity: 10 mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C112H173N27O29S; MW 2393.86

475 €
539 $
368 £

Catalog number: 431-96313-2
Product Quantity: 5 mg
MARCKS Protein (151-175) (AA: Lys-Lys-Lys-Lys-Lys-Arg-Phe-Ser-Phe-Lys-Lys-Ser-Phe-Lys-Leu-Ser-Gly-Phe-Ser-Phe-Lys-Lys-Asn-Lys-Lys) (MW: 3080.83)

306 €
347 $
237 £

Catalog number: SP-101467-1
Product Quantity: 1 mg
Supplier: ADI
Myristoylated ADP _Ribosylation Factor 6, myr _ARF6 (2 _ 13) Formula C74H128N16O18 Sequence myr_Gly_Lys_Val_Leu_Ser_Lys_Ile_Phe_Gly_Asn_Lys_Glu

266 €
302 $
206 £

Catalog number: 100823
Product Quantity: 5mg
Supplier: GLSChina
MSP_1 P2, Malaria Merozoite Surface Peptide – 1 Formula C116H190N32O35S Sequence Gly_Tyr_Arg_Lys_Pro_Leu_Asp_Asn_Ile_Lys_Asp_Asn_Val_Gly_Lys_Met_Glu_Asp_Tyr_Ile_Lys_Lys

190 €
216 $
147 £

Catalog number: 88358
Product Quantity: 1mg
Supplier: GLSChina
Peptide F, bovine Formula C172H259N41O53S3 Sequence Tyr_Gly_Gly_Phe_Met_Lys_Lys_Met_Asp_Glu_Leu_Tyr_Pro_Leu_Glu_Val_Glu_Glu_Glu_Ala_Asn_Gly_Gly_Glu_Val_Leu_Gly_Lys_Arg_Tyr_Gly_Gly_Phe_Met

243 €
276 $
189 £

Catalog number: 55289
Product Quantity: 1mg
Supplier: GLSChina
Myristoylated ADP - Ribosylation Factor 1, myr - ARF1 (2 - 17) (AA: Myristoyl -Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu) (MW: 1993.49)

223 €
253 $
173 £

Catalog number: SP-100822-1
Product Quantity: 1 mg
Supplier: ADI
Tyr_PDGF A_Chain (194_211) Formula C101H181N39O25 Sequence Tyr_Gly_Arg_Pro_Arg_Glu_Ser_Gly_Lys_Lys_Arg_Lys_Arg_Lys_Arg_Leu_Lys_Pro_Thr

177 €
201 $
137 £

Catalog number: 101825
Product Quantity: 1mg
Supplier: GLSChina
MSP-1 P2, Malaria Merozoite Surface Peptide – 1 (AA: Gly-Tyr-Arg-Lys-Pro-Leu-Asp-Asn-Ile-Lys-Asp-Asn-Val-Gly-Lys-Met-Glu-Asp-Tyr-Ile-Lys-Lys) (MW: 2625.07)

271 €
308 $
210 £

Catalog number: SP-88358-1
Product Quantity: 1 mg
Supplier: ADI
ADP_Ribosylation Factor 1,ARF1 (2 _ 17) Formula C85H131N21O21 Sequence Gly_Asn_Ile_Phe_Ala_Asn_Leu_Phe_Lys_Gly_Leu_Phe_Gly_Lys_Lys_Glu

162 €
184 $
126 £

Catalog number: 100821
Product Quantity: 1mg
Supplier: GLSChina
β-Endorphin (1-5), (16-31), human [Tyr-Gly-Gly-Phe-Met-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu (MW: 2393.86)]

223 €
253 $
173 £

Catalog number: SP-87425-1
Product Quantity: 1 mg
Supplier: ADI
Salt _ Binding _ Synonym Boc_Lys(retro_Glu(OMe)_H)_OMe · HCl SumFormula C18H33N3O7 · HCl

1291 €
1465 $
1001 £

Catalog number: A-4480.1000
Product Quantity: 1.0 g
Supplier: Bach
Salt _ Binding _ Synonym Boc_Lys(retro_Glu(OMe)_H)_OMe · HCl SumFormula C18H33N3O7 · HCl

451 €
512 $
350 £

Catalog number: A-4480.0250
Product Quantity: 250.0 mg
Supplier: Bach
Cys_Gly_His_Gly_Asn_Lys_Ser_Amyloid ß _Protein (33_40) (AA Cys_Gly_His_Gly_Asn_Lys_Ser_Gly_Leu_Met_Val_Gly_Gly_Val_Val) (MW 1414.67)

430 €
488 $
333 £

Catalog number: SP-89307-1
Product Quantity: 1 mg
Supplier: Alpha Dia
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-NH2; MF C136H233N33O29; MW 2794.58

307 €
348 $
238 £

Catalog number: 431-63582-1
Product Quantity: 1mg
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-NH2; MF C136H233N33O29; MW 2794.58

857 €
972 $
664 £

Catalog number: 431-63582-3
Product Quantity: 10 mg
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-NH2; MF C136H233N33O29; MW 2794.58

576 €
654 $
447 £

Catalog number: 431-63582-2
Product Quantity: 5 mg
Cecropin A (1-8)-Melittin (1-18) amide (AA: Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-NH2) (MW: 2794.58)

306 €
347 $
237 £

Catalog number: SP-54694-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Gly-Met-Ala-Ser-Lys-Ala-Gly-Ala-Ile-Ala-Gly-Lys-Ile-Ala-Lys-Val-Ala-Leu-Lys-Ala-Leu-NH2; MF C88H162N26O22S; MW 1968.5

257 €
292 $
200 £

Catalog number: 431-61187-2
Product Quantity:
Category: Peptides
PGLa Formula C88H162N26O22S Sequence Gly_Met_Ala_Ser_Lys_Ala_Gly_Ala_Ile_Ala_Gly_Lys_Ile_Ala_Lys_Val_Ala_Leu_Lys_Ala_Leu_NH2

302 €
343 $
234 £

Catalog number: 52299
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gly-Met-Ala-Ser-Lys-Ala-Gly-Ala-Ile-Ala-Gly-Lys-Ile-Ala-Lys-Val-Ala-Leu-Lys-Ala-Leu-NH2; MF C88H162N26O22S; MW 1968.5

373 €
423 $
289 £

Catalog number: 431-61187-1
Product Quantity: 1mg
Category: Peptides
Sequence Gly-Met-Ala-Ser-Lys-Ala-Gly-Ala-Ile-Ala-Gly-Lys-Ile-Ala-Lys-Val-Ala-Leu-Lys-Ala-Leu-NH2; MF C88H162N26O22S; MW 1968.5

257 €
292 $
200 £

Catalog number: 431-61187-3
Product Quantity:
Category: Peptides
Sequence Tyr-Gly-Gly-Phe-Met-Lys-Lys-Met-Asp-Glu-Leu-Tyr-Pro-Leu-Glu-Val-Glu-Glu-Glu-Ala-Asn-Gly-Gly-Glu-Val-Leu-Gly-Lys-Arg-Tyr-Gly-Gly-Phe-Met; MF C172H259N41O53S3; MW 3845.42

970 €
1101 $
752 £

Catalog number: 431-64177-3
Product Quantity: 10 mg
Sequence Tyr-Gly-Gly-Phe-Met-Lys-Lys-Met-Asp-Glu-Leu-Tyr-Pro-Leu-Glu-Val-Glu-Glu-Glu-Ala-Asn-Gly-Gly-Glu-Val-Leu-Gly-Lys-Arg-Tyr-Gly-Gly-Phe-Met; MF C172H259N41O53S3; MW 3845.42

339 €
384 $
263 £

Catalog number: 431-64177-1
Product Quantity: 1mg
Sequence Tyr-Gly-Gly-Phe-Met-Lys-Lys-Met-Asp-Glu-Leu-Tyr-Pro-Leu-Glu-Val-Glu-Glu-Glu-Ala-Asn-Gly-Gly-Glu-Val-Leu-Gly-Lys-Arg-Tyr-Gly-Gly-Phe-Met; MF C172H259N41O53S3; MW 3845.42

679 €
771 $
527 £

Catalog number: 431-64177-2
Product Quantity: 5 mg
Sequence Gly-Tyr-Arg-Lys-Pro-Leu-Asp-Asn-Ile-Lys-Asp-Asn-Val-Gly-Lys-Met-Glu-Asp-Tyr-Ile-Lys-Lys; MF C116H190N32O35S; MW 2625.07

274 €
312 $
213 £

Catalog number: 431-97246-1
Product Quantity: 1mg
Sequence Gly-Tyr-Arg-Lys-Pro-Leu-Asp-Asn-Ile-Lys-Asp-Asn-Val-Gly-Lys-Met-Glu-Asp-Tyr-Ile-Lys-Lys; MF C116H190N32O35S; MW 2625.07

695 €
789 $
539 £

Catalog number: 431-97246-3
Product Quantity: 10 mg
Sequence Gly-Tyr-Arg-Lys-Pro-Leu-Asp-Asn-Ile-Lys-Asp-Asn-Val-Gly-Lys-Met-Glu-Asp-Tyr-Ile-Lys-Lys; MF C116H190N32O35S; MW 2625.07

475 €
539 $
368 £

Catalog number: 431-97246-2
Product Quantity: 5 mg
RK9, p17 Gag (20 - 28) (AA: Arg-Leu-Arg-Pro-Gly-Gly-Lys-Lys-Lys) (MW: 1039.30)

306 €
347 $
237 £

Catalog number: SP-60866-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Arg-Leu-Arg-Pro-Gly-Gly-Lys-Lys-Lys; MF C45H86N18O10; MW 1039.30

613 €
695 $
475 £

Catalog number: 431-69754-3
Product Quantity: 25 mg
Sequence Arg-Leu-Arg-Pro-Gly-Gly-Lys-Lys-Lys; MF C45H86N18O10; MW 1039.30

307 €
348 $
238 £

Catalog number: 431-69754-1
Product Quantity: 5 mg
Sequence Arg-Leu-Arg-Pro-Gly-Gly-Lys-Lys-Lys; MF C45H86N18O10; MW 1039.30

373 €
423 $
289 £

Catalog number: 431-69754-2
Product Quantity: 10 mg
MF C43H79N13O12S2 ; MW 1034.30; CGKKGMVGGVV , Cys-Gly-Lys-Lys-Gly-Met-Val-Gly-Gly-Val-Val

274 €
312 $
213 £

Catalog number: RB-PP-0057
Product Quantity: 1 mg
Sequence Lys-Lys-Lys-Lys-Lys-Arg-Phe-Ser-Phe-Lys-Lys-Ser-Phe-Lys-Leu-Ser-Gly-Phe-Ser-Phe-Lys-Lys-Asn-Lys-Lys; MF C147H243N41O31; MW 3080.83

307 €
348 $
238 £

Catalog number: 431-110355-1
Product Quantity: 1mg
Sequence Lys-Lys-Lys-Lys-Lys-Arg-Phe-Ser-Phe-Lys-Lys-Ser-Phe-Lys-Leu-Ser-Gly-Phe-Ser-Phe-Lys-Lys-Asn-Lys-Lys; MF C147H243N41O31; MW 3080.83

775 €
880 $
601 £

Catalog number: 431-110355-3
Product Quantity: 10 mg
Sequence Lys-Lys-Lys-Lys-Lys-Arg-Phe-Ser-Phe-Lys-Lys-Ser-Phe-Lys-Leu-Ser-Gly-Phe-Ser-Phe-Lys-Lys-Asn-Lys-Lys; MF C147H243N41O31; MW 3080.83

543 €
616 $
421 £

Catalog number: 431-110355-2
Product Quantity: 5 mg
Tyr-PDGF A-Chain (194-211) (AA: Tyr-Gly-Arg-Pro-Arg-Glu-Ser-Gly-Lys-Lys-Arg-Lys-Arg-Lys-Arg-Leu-Lys-Pro-Thr) (MW: 2341.8)

223 €
253 $
173 £

Catalog number: SP-101825-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Lys-Ser-Asp-Gly-Gly-Val-Lys-Lys-Arg-Lys-Ser-Ser-Ser-Ser; MF C58H107N21O22; MW 1450.63

355 €
403 $
275 £

Catalog number: 431-95773-1
Product Quantity: 5 mg
Sequence Lys-Ser-Asp-Gly-Gly-Val-Lys-Lys-Arg-Lys-Ser-Ser-Ser-Ser; MF C58H107N21O22; MW 1450.63

857 €
972 $
664 £

Catalog number: 431-95773-3
Product Quantity: 25 mg
Sequence Lys-Ser-Asp-Gly-Gly-Val-Lys-Lys-Arg-Lys-Ser-Ser-Ser-Ser; MF C58H107N21O22; MW 1450.63

509 €
578 $
395 £

Catalog number: 431-95773-2
Product Quantity: 10 mg
Prion Peptide (106_126),Human Formula C80H138N26O24S2 Sequence Lys_Thr_Asn_Met_Lys_His_Met_Ala_Gly_Ala_Ala_Ala_Ala_Gly_Ala_Val_Val_Gly_Gly_Leu_Gly

186 €
211 $
144 £

Catalog number: 51715
Product Quantity: 1mg
Supplier: GLSChina
Sequence Phe-Gly-Gly-Phe-Met-Lys-Gly-Lys-Tyr-Gly-Tyr; MF C61H83N13O14S; MW 1254.48

323 €
366 $
250 £

Catalog number: 431-97944-1
Product Quantity: 5 mg
Sequence Phe-Gly-Gly-Phe-Met-Lys-Gly-Lys-Tyr-Gly-Tyr; MF C61H83N13O14S; MW 1254.48

695 €
789 $
539 £

Catalog number: 431-97944-3
Product Quantity: 25 mg
Sturgeon F Formula C61H83N13O14S Sequence Phe_Gly_Gly_Phe_Met_Lys_Gly_Lys_Tyr_Gly_Tyr

237 €
269 $
184 £

Catalog number: 89056
Product Quantity: 5mg
Supplier: GLSChina
Sequence Phe-Gly-Gly-Phe-Met-Lys-Gly-Lys-Tyr-Gly-Tyr; MF C61H83N13O14S; MW 1254.48

407 €
462 $
316 £

Catalog number: 431-97944-2
Product Quantity: 10 mg
Bombinin _ like Peptide (BLP _1) Formula C115H194N34O33 Sequence Gly_Ile_Gly_Ala_Ser_Ile_Leu_Ser_Ala_Gly_Lys_Ser_Ala_Leu_Lys_Gly_Leu_Ala_Lys_Gly_Leu_Ala_Glu_His_Phe_Ala_Asn_NH2

216 €
245 $
167 £

Catalog number: 88319
Product Quantity: 1mg
Supplier: GLSChina
Sequence Myristoyl -Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu; MF C99H157N21O22; MW 1993.49

373 €
423 $
289 £

Catalog number: 431-109710-2
Product Quantity: 5 mg
Sequence Biotin-Lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Val-Val-Tyr-Lys-NH2; MF C87H139N21O24S; MW 1895.27

594 €
675 $
461 £

Catalog number: 431-95771-3
Product Quantity: 10 mg
Sequence Myristoyl -Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu; MF C99H157N21O22; MW 1993.49

543 €
616 $
421 £

Catalog number: 431-109710-3
Product Quantity: 10 mg
ADP-Ribosylation Factor 1, ARF1 (2 - 17) (AA: Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu) (MW: 1783.12)

223 €
253 $
173 £

Catalog number: SP-100821-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Myristoyl -Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu; MF C99H157N21O22; MW 1993.49

257 €
292 $
200 £

Catalog number: 431-109710-1
Product Quantity: 1mg
Sequence Biotin-Lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Val-Val-Tyr-Lys-NH2; MF C87H139N21O24S; MW 1895.27

257 €
292 $
200 £

Catalog number: 431-95771-1
Product Quantity: 1mg
Sequence Biotin-Lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Val-Val-Tyr-Lys-NH2; MF C87H139N21O24S; MW 1895.27

407 €
462 $
316 £

Catalog number: 431-95771-2
Product Quantity: 5 mg
[Des_Tyr1]_â_Endorphin, human Formula C149H242N38O44S Sequence Gly_Gly_Phe_Met_Thr_Ser_Glu_Lys_Ser_Gln_Thr_Pro_Leu_Val_Thr_Leu_Phe_Lys_Asn_Ala_Ile_Ile_Lys_Asn_Ala_Tyr_Lys_Lys_Gly_Glu

225 €
256 $
175 £

Catalog number: 87439
Product Quantity: 1mg
Supplier: GLSChina
Ac_â_ Endorphin, bovine,camel, ovine Formula C157H252N42O45S1 Sequence Ac_Tyr_Gly_Gly_Phe_Met_Thr_Ser_Glu_Lys_Ser_Gln_Thr_Pro_Leu_Val_Thr_Leu_Phe_Lys_Asn_Ala_Ile_Ile_Lys_Asn_Ala_His_Lys_Lys_Gly_Gln

236 €
268 $
183 £

Catalog number: 100526
Product Quantity: 1mg
Supplier: GLSChina
[Tyr0]-BNP-32 (human) [Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His (Disulfide bridge: Cys11-Cys27); MW 3627.28]

390 €
443 $
302 £

Catalog number: SP-89384-1
Product Quantity: 1 mg
Supplier: ADI
MF C45H86N18O10 ; MW 1039.28 ; RLRPGGKKK , Arg-Leu-Arg-Pro-Gly-Gly-Lys-Lys-Lys

274 €
312 $
213 £

Catalog number: RB-PP-1397
Product Quantity: 1 mg
[Tyr0]_BNP_32 (human) Formula C152H253N51O44S4 Sequence Tyr_Ser_Pro_Lys_Met_Val_Gln_Gly_Ser_Gly_Cys_Phe_Gly_Arg_Lys_Met_Asp_Arg_Ile_Ser_Ser_Ser_Ser_Gly_Leu_Gly_Cys_Lys_Val_Leu_Arg_Arg_His (Disulfide

219 €
248 $
170 £

Catalog number: 89384
Product Quantity: 1mg
Supplier: GLSChina
Sequence Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His(Disulfide bridge Cys11-Cys27); MF C152H253N51O44S4; MW

323 €
366 $
250 £

Catalog number: 431-98272-1
Product Quantity: 1mg
Sequence Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg- Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys- Val-Leu-Arg-Arg-His(Disulfide bridge Cys10-Cys26); MF C143H244N50O42S4; MW 346

662 €
751 $
513 £

Catalog number: 431-65474-3
Product Quantity: 2.5 mg
Sequence Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His(Disulfide bridge Cys11-Cys27); MF C152H253N51O44S4; MW

857 €
972 $
664 £

Catalog number: 431-98272-3
Product Quantity: 10 mg
BNP_32, human Formula C143H244N50O42S4 Sequence Ser_Pro_Lys_Met_Val_Gln_Gly_Ser_Gly_Cys_Phe_Gly_Arg_Lys_Met_Asp_Arg_Ile_Ser_Ser_Ser_Ser_Gly_Leu_Gly_Cys_Lys_Val_Leu_Arg_Arg_His(Disulfide bridge Cys10

240 €
273 $
186 £

Catalog number: 56586
Product Quantity: 0.5mg
Supplier: GLSChina
Sequence Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg- Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys- Val-Leu-Arg-Arg-His(Disulfide bridge Cys10-Cys26); MF C143H244N50O42S4; MW 346

440 €
500 $
341 £

Catalog number: 431-65474-2
Product Quantity: 1mg
Sequence Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His(Disulfide bridge Cys11-Cys27); MF C152H253N51O44S4; MW

594 €
675 $
461 £

Catalog number: 431-98272-2
Product Quantity: 5 mg
Sequence Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg- Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys- Val-Leu-Arg-Arg-His(Disulfide bridge Cys10-Cys26); MF C143H244N50O42S4; MW 346

323 €
366 $
250 £

Catalog number: 431-65474-1
Product Quantity: 500
â_Endorphin, equine Formula C154H248N42O44S Sequence Tyr_Gly_Gly_Phe_Met_Ser_Ser_Glu_Lys_Ser_Gln_Thr_Pro_Leu_Val_Thr_Leu_Phe_Lys_Asn_Ala_Ile_Ile_Lys_Asn_Ala_His_Lys_Lys_Gly_Gln

231 €
262 $
179 £

Catalog number: 85195
Product Quantity: 1mg
Supplier: GLSChina
â_Endorphin, rat Formula C157H254N42O44S1 Sequence H_Tyr_Gly_Gly_Phe_Met_Thr_Ser_Glu_Lys_Ser_Gln_Thr_Pro_Leu_Val_Thr_Leu_Phe_Lys_Asn_Ala_Ile_Ile_Lys_Asn_Val_His_Lys_Lys_Gly_Gln

231 €
262 $
179 £

Catalog number: 55283
Product Quantity: 1mg
Supplier: GLSChina
â_Endorphin, porcine Formula C154H248N42O44S Sequence Tyr_Gly_Gly_Phe_Met_Thr_Ser_Glu_Lys_Ser_Gln_Thr_Pro_Leu_Val_Thr_Leu_Phe_Lys_Asn_Ala_Ile_Val_Lys_Asn_Ala_His_Lys_Lys_Gly_Gln

231 €
262 $
179 £

Catalog number: 87423
Product Quantity: 1mg
Supplier: GLSChina
Ac-β- Endorphin, bovine, camel, ovine [Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln (MW: 3480.1)]

306 €
347 $
237 £

Catalog number: SP-100526-1
Product Quantity: 1 mg
Supplier: ADI
â_Endorphin, camel Formula C155H250N42O44S1 Sequence H_Tyr_Gly_Gly_Phe_Met_Thr_Ser_Glu_Lys_Ser_Gln_Thr_Pro_Leu_Val_Thr_Leu_Phe_Lys_Asn_Ala_Ile_Ile_Lys_Asn_Ala_His_Lys_Lys_Gly_Gln

231 €
262 $
179 £

Catalog number: 55281
Product Quantity: 1mg
Supplier: GLSChina
MF C85H131N21O21 ; MW 1783.09; GNIFANLFKGLFGKKE, Myr-Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu

307 €
348 $
238 £

Catalog number: RB-PP-1083
Product Quantity: 1 mg
Sequence Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu; MF C85H131N21O21; MW 1783.12

576 €
654 $
447 £

Catalog number: 431-109709-3
Product Quantity: 10 mg
Sequence Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu; MF C85H131N21O21; MW 1783.12

257 €
292 $
200 £

Catalog number: 431-109709-1
Product Quantity: 1mg
Sequence Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu; MF C85H131N21O21; MW 1783.12

373 €
423 $
289 £

Catalog number: 431-109709-2
Product Quantity: 5 mg
Galanin_Lys(Biotin), human Formula C155H237N46O46S1 Sequence Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_His_Ala_Val_Gly_Asn_His_Arg_Ser_Phe_Ser_Asp_Lys_Asn_Gly_Leu_Thr_Ser_Lys(Biotin)

298 €
338 $
231 £

Catalog number: 101032
Product Quantity: 1mg
Supplier: GLSChina
Vasonatrin Peptide (VNP) Formula C124H198N36O36S3 Sequence Gly_Leu_Ser_Lys_Gly_Cys_Phe_Gly_Leu_Lys_Leu_Asp_Arg_Ile_Gly_Ser_Met_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr ((Disulfide bridge Cys6_Cys22)

247 €
280 $
191 £

Catalog number: 89551
Product Quantity: 1mg
Supplier: GLSChina
SV40 NLS Formula C42H81N15O9 Sequence Pro_Lys_Lys_Lys_Arg_Lys_Val_Gly

199 €
225 $
154 £

Catalog number: 86612
Product Quantity: 5mg
Supplier: GLSChina
Prion Peptide (106-126), Human (AA: Lys-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala-Val-Val-Gly-Gly-Leu-Gly) (MW: 1912.28)

223 €
253 $
173 £

Catalog number: SP-51715-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly; MF C42H81N15O9; MW 940.21

576 €
654 $
447 £

Catalog number: 431-95500-3
Product Quantity: 25 mg
Sequence Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly; MF C42H81N15O9; MW 940.21

307 €
348 $
238 £

Catalog number: 431-95500-1
Product Quantity: 5 mg
Sequence Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly; MF C42H81N15O9; MW 940.21

355 €
403 $
275 £

Catalog number: 431-95500-2
Product Quantity: 10 mg
SMAP 29, Sheep Myeloid Antimicrobial Peptide 29 Formula C146H260N52O32 Sequence Arg_Gly_Leu_Arg_Arg_Leu_Gly_Arg_Lys_Ile_Ala_His_Gly_Val_Lys_Lys_Tyr_Gly_Pro_Thr_Val_Leu_Arg_Ile_Ile_Arg_Ile_Ala_Gly

220 €
250 $
170 £

Catalog number: 85560
Product Quantity: 1mg
Supplier: GLSChina
Myristoylated ADP _Ribosylation Factor 1, myr _ARF1 (2 _ 17) Formula C99H157N21O22 Sequence myr_Gly_Asn_Ile_Phe_Ala_Asn_Leu_Phe_Lys_Gly_Leu_Phe_Gly_Lys_Lys_Glu

159 €
180 $
123 £

Catalog number: 100822
Product Quantity: 1mg
Supplier: GLSChina
MF C58H107N21O22 ; MW 1450.60 ; KSDGGVKKRKSSSS, Lys-Ser-Asp-Gly-Gly-Val-Lys-Lys-Arg-Lys-Ser-Ser-Ser-Ser

339 €
384 $
263 £

Catalog number: RB-PP-0411
Product Quantity: 1 mg
p3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54–68) Formula C59H97N17O19 Sequence Phe_Glu_Ala_Lys_Gly_Ala_Lys_Ala_Asn_Lys_Ala_Val_Asp

266 €
302 $
206 £

Catalog number: 88003
Product Quantity: 5mg
Supplier: GLSChina
ACTH (1_17), human Formula C95H145N29O23S Sequence Ser_Tyr_Ser_Met_Glu_His_Phe_Arg_Trp_Gly_Lys_Pro_Val_Gly_Lys_Lys_Arg

167 €
190 $
130 £

Catalog number: 55159
Product Quantity: 1mg
Supplier: GLSChina
Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg; MF C95H145N29O23S; MW 2093.5

594 €
675 $
461 £

Catalog number: 431-64047-3
Product Quantity: 10 mg
Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg; MF C95H145N29O23S; MW 2093.5

257 €
292 $
200 £

Catalog number: 431-64047-1
Product Quantity: 1mg
Sequence Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg; MF C97H147N29O24S; MW 2135.50

613 €
695 $
475 £

Catalog number: 431-95381-3
Product Quantity: 10 mg
Sequence Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg; MF C97H147N29O24S; MW 2135.50

257 €
292 $
200 £

Catalog number: 431-95381-1
Product Quantity: 1mg
Ac_ACTH (1_17) Formula C97H147N29O24S Sequence Ac_Ser_Tyr_Ser_Met_Glu_His_Phe_Arg_Trp_Gly_Lys_Pro_Val_Gly_Lys_Lys_Arg

173 €
196 $
134 £

Catalog number: 86493
Product Quantity: 1mg
Supplier: GLSChina
Sequence Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg; MF C97H147N29O24S; MW 2135.50

407 €
462 $
316 £

Catalog number: 431-95381-2
Product Quantity: 5 mg
Sequence Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg; MF C95H145N29O23S; MW 2093.5

407 €
462 $
316 £

Catalog number: 431-64047-2
Product Quantity: 5 mg
Sequence Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C157H252N42O45S; MW 3480.1

662 €
751 $
513 £

Catalog number: 431-109414-2
Product Quantity: 5 mg
Sequence Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C149H242N38O44S; MW 3301.88

921 €
1045 $
714 £

Catalog number: 431-96327-3
Product Quantity: 10 mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln; MF C157H254N42O44S; MW 3466.09

921 €
1045 $
714 £

Catalog number: 431-64171-3
Product Quantity: 10 mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C155H250N42O44S; MW 3438.04

613 €
695 $
475 £

Catalog number: 431-64169-2
Product Quantity: 5 mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C155H250N42O44S; MW 3438.04

921 €
1045 $
714 £

Catalog number: 431-64169-3
Product Quantity: 10 mg
Sequence Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C157H252N42O45S; MW 3480.1

954 €
1083 $
740 £

Catalog number: 431-109414-3
Product Quantity: 10 mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln; MF C157H254N42O44S; MW 3466.09

613 €
695 $
475 £

Catalog number: 431-64171-2
Product Quantity: 5 mg
Sequence Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C149H242N38O44S; MW 3301.88

323 €
366 $
250 £

Catalog number: 431-96327-1
Product Quantity: 1mg
Sequence Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C154H248N42O44S; MW 3424.01

613 €
695 $
475 £

Catalog number: 431-94083-2
Product Quantity: 5 mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Val-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C154H248N42O44S; MW 3424.01

921 €
1045 $
714 £

Catalog number: 431-96311-3
Product Quantity: 10 mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Val-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C154H248N42O44S; MW 3424.01

323 €
366 $
250 £

Catalog number: 431-96311-1
Product Quantity: 1mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Val-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C154H248N42O44S; MW 3424.01

613 €
695 $
475 £

Catalog number: 431-96311-2
Product Quantity: 5 mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln; MF C157H254N42O44S; MW 3466.09

323 €
366 $
250 £

Catalog number: 431-64171-1
Product Quantity: 1mg
[Des-Tyr1]-β-Endorphin, human [Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu]

306 €
347 $
237 £

Catalog number: SP-87439-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C154H248N42O44S; MW 3424.01

921 €
1045 $
714 £

Catalog number: 431-94083-3
Product Quantity: 10 mg
Sequence Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C157H252N42O45S; MW 3480.1

323 €
366 $
250 £

Catalog number: 431-109414-1
Product Quantity: 1mg
Sequence Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C149H242N38O44S; MW 3301.88

613 €
695 $
475 £

Catalog number: 431-96327-2
Product Quantity: 5 mg
Sequence Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C154H248N42O44S; MW 3424.01

323 €
366 $
250 £

Catalog number: 431-94083-1
Product Quantity: 1mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln; MF C155H250N42O44S; MW 3438.04

323 €
366 $
250 £

Catalog number: 431-64169-1
Product Quantity: 1mg
MF C147H243N41O31 ; MW 3080.77; KKKKKRFSFKKSFKLSGFSFKKNKK, Lys-Lys-Lys-Lys-Lys-Arg-Phe-Ser-Phe-Lys-Lys-Ser-Phe-Lys-Leu-Ser-Gly-Phe-Ser-Phe-Lys-Lys-Asn-Lys-Lys

339 €
384 $
263 £

Catalog number: RB-PP-1015
Product Quantity: 1 mg
ACTH (1-16), Human [H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH; MW: 1937.27]

190 €
216 $
147 £

Catalog number: SP-55156-1
Product Quantity: 0.5 mg
Supplier: ADI
ACTH (1-17), Human [H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-OH; MW: 2093.5]

190 €
216 $
147 £

Catalog number: SP-55159-1
Product Quantity: 0.5 mg
Supplier: ADI
Gastrin Releasing Peptide_Lys(Biotin), human Formula C130H204N38O31S2 Sequence Val_Pro_Leu_Pro_Ala_Gly_Gly_Gly_Thr_Val_Leu_Thr_Lys_Met_Tyr_Pro_Arg_Gly_Asn_His_Trp_Ala_Val_Gly_His_Leu_Met_Lys(Biotin)

281 €
319 $
218 £

Catalog number: 101041
Product Quantity: 1mg
Supplier: GLSChina
MF C42H81N15O9 ; MW 940.19 ; PKKKRKVG , Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly

274 €
312 $
213 £

Catalog number: RB-PP-1483
Product Quantity: 1 mg
SV40 NLS (AA: Pro-Lys-Lys-Lys-Arg-Lys-Val-Gly) (MW: 940.21)

306 €
347 $
237 £

Catalog number: SP-86612-5
Product Quantity: 5 mg
Supplier: ADI
Rcramp (AA: Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln) (MW: 3946.73)

390 €
443 $
302 £

Catalog number: SP-88331-1
Product Quantity: 1 mg
Supplier: ADI
Vasonatrin Peptide (VNP) (AA: Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr ((Disulfide bridge: Cys6-Cys22)) (MW: 2865.37)

390 €
443 $
302 £

Catalog number: SP-89551-1
Product Quantity: 1 mg
Supplier: ADI
[Met5, Lys6,7] a-Neo-Endorphin (1-7) [Tyr-Gly-Gly-Phe-Met-Lys-Lys; MW 830.02]

223 €
253 $
173 £

Catalog number: SP-87445-5
Product Quantity: 5 mg
Supplier: ADI
[Gly30,Cys31]- -Amyloid(13-31) [His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Gly-Cys; MW: 2073.33]

223 €
253 $
173 £

Catalog number: SP-87937-1
Product Quantity: 1 mg
Supplier: ADI
Sequence His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Gly-Cys; MF C91H137N27O27S; MW 2073.33

662 €
751 $
513 £

Catalog number: 431-96825-3
Product Quantity: 10 mg
Sequence His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Gly-Cys; MF C91H137N27O27S; MW 2073.33

440 €
500 $
341 £

Catalog number: 431-96825-2
Product Quantity: 5 mg
Sequence His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Gly-Cys; MF C91H137N27O27S; MW 2073.33

257 €
292 $
200 £

Catalog number: 431-96825-1
Product Quantity: 1mg
α-Defensin-1, human [Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys (Disulfide bridge: Cys5- Cys34, Cy

1225 €
1390 $
950 £

Catalog number: SP-88391-1
Product Quantity: 1 mg
Supplier: ADI
Cys_Gly_Lys_Lys_Gly_Amyloid b_Protein (33_40) Salt _ Binding _ Synonym SumFormula C51H93N15O14S2

702 €
797 $
545 £

Catalog number: H-6372.0005
Product Quantity: 5.0 mg
Supplier: Bach
Cys_Gly_Lys_Lys_Gly_Amyloid b_Protein (35_40) Salt _ Binding _ Synonym SumFormula C43H79N13O12S2

702 €
797 $
545 £

Catalog number: H-6378.0005
Product Quantity: 5.0 mg
Supplier: Bach
Cys_Gly_Lys_Lys_Gly_Amyloid b_Protein (33_40) Salt _ Binding _ Synonym SumFormula C51H93N15O14S2

200 €
227 $
155 £

Catalog number: H-6372.0001
Product Quantity: 1.0 mg
Supplier: Bach
Cys_Gly_Lys_Lys_Gly_Amyloid b_Protein (36_42) Salt _ Binding _ Synonym SumFormula C47H86N14O13S

200 €
227 $
155 £

Catalog number: H-6376.0001
Product Quantity: 1.0 mg
Supplier: Bach
Cys_Gly_Lys_Lys_Gly_Amyloid b_Protein (36_42) Salt _ Binding _ Synonym SumFormula C47H86N14O13S

702 €
797 $
545 £

Catalog number: H-6376.0005
Product Quantity: 5.0 mg
Supplier: Bach
Cys_Gly_Lys_Lys_Gly_Amyloid b_Protein (35_40) Salt _ Binding _ Synonym SumFormula C43H79N13O12S2

200 €
227 $
155 £

Catalog number: H-6378.0001
Product Quantity: 1.0 mg
Supplier: Bach
Biotin_Tyrosine Kinase Peptide 1, amide Formula C87H139N21O24S Sequence Biotin_Lys_Val_Glu_Lys_Ile_Gly_Glu_Gly_Thr_Tyr_Gly_Val_Val_Tyr_Lys_NH2

167 €
190 $
130 £

Catalog number: 86883
Product Quantity: 1mg
Supplier: GLSChina
Sequence Tyr-Gly-Gly-Phe-Met-Lys-Lys; MF C39H59N9O9S; MW 830.02

509 €
578 $
395 £

Catalog number: 431-96333-3
Product Quantity: 25 mg
Sequence Tyr-Gly-Gly-Phe-Met-Lys-Lys; MF C39H59N9O9S; MW 830.02

339 €
384 $
263 £

Catalog number: 431-96333-2
Product Quantity: 10 mg
Sequence Tyr-Gly-Gly-Phe-Met-Lys-Lys; MF C39H59N9O9S; MW 830.02

274 €
312 $
213 £

Catalog number: 431-96333-1
Product Quantity: 5 mg
y-Neuropeptide, Rabbit [H-Asp-Ala-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2; MW 232.64]

271 €
308 $
210 £

Catalog number: SP-55218-5
Product Quantity: 0.5 mg
Supplier: ADI
Ac-ACTH (1-17) [Ac-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg (MW: 2135.50)]

223 €
253 $
173 £

Catalog number: SP-86493-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Asp-Ala-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2; MF C99H158N34O29S; MW 2320.64

274 €
312 $
213 £

Catalog number: 431-64106-1
Product Quantity: 1mg
Sequence Asp-Ala-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2; MF C99H158N34O29S; MW 2320.64

475 €
539 $
368 £

Catalog number: 431-64106-2
Product Quantity: 5 mg
[Gly30,Cys31]_ â_Amyloid (13_31) Formula C91H137N27O27S Sequence His_His_Gln_Lys_Leu_Val_Phe_Phe_Ala_Glu_Asp_Val_Gly_Ser_Asn_Lys_Gly_Gly_Cys

177 €
201 $
137 £

Catalog number: 87937
Product Quantity: 1mg
Supplier: GLSChina
Sequence Asp-Ala-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2; MF C99H158N34O29S; MW 2320.64

695 €
789 $
539 £

Catalog number: 431-64106-3
Product Quantity: 10 mg
[Met5, Lys6,7] a_Neo_Endorphin (1_7) Formula C39H59N9O9S Sequence Tyr_Gly_Gly_Phe_Met_Lys_Lys

184 €
208 $
142 £

Catalog number: 87445
Product Quantity: 5mg
Supplier: GLSChina
Enkephalin_Lys _Methionine (Tyr_Gly_Gly_Phe_Met_Lys) _ 1mg

112 €
127 $
87 £

Catalog number: 024-51
Product Quantity: 1 mg
Supplier: Phoenix Peptide
β-Endorphin, porcine [Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Val-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln (MW: 3424.01)]

390 €
443 $
302 £

Catalog number: SP-87423-1
Product Quantity: 1 mg
Supplier: ADI
B-Endorphin, Camel [H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln-OH; MW: 3438.04]

371 €
421 $
288 £

Catalog number: SP-55281-1
Product Quantity: 1 mg
Supplier: ADI
β-Endorphin, equine [Tyr-Gly-Gly-Phe-Met-Ser-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-His-Lys-Lys-Gly-Gln (MW: 3424.01)]

390 €
443 $
302 £

Catalog number: SP-85195-1
Product Quantity: 1 mg
Supplier: ADI
B-Endorphin, Rat [H-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Val-His-Lys-Lys-Gly-Gln-OH; MW: 3466.09]

398 €
451 $
308 £

Catalog number: SP-55283-1
Product Quantity: 1 mg
Supplier: ADI
B-Endorphinm Human [h-Tyr-Gly-Gly-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu-OH; MW: 3465.06]

264 €
299 $
205 £

Catalog number: SP-55282-1
Product Quantity: 1 mg
Supplier: ADI
á_Defensin_1, human Formula C167H256N48O50S6 Sequence Asp_His_Tyr_Asn_Cys_Val_Ser_Ser_Gly_Gly_Gln_Cys_Leu_Tyr_Ser_Ala_Cys_Pro_Ile_Phe_Thr_Lys_Ile_Gln_Gly_Thr_Cys_Tyr_Arg_Gly_Lys_Ala_Lys_Cys_Cys_Lys

781 €
886 $
605 £

Catalog number: 88391
Product Quantity: 1mg
Supplier: GLSChina
ã_Neuropeptide, rabbit Formula C99H158N34O29S Sequence Asp_Ala_Gly_His_Gly_Gln_Ile_Ser_His_Lys_Arg_His_Lys_Thr_Asp_Ser_Phe_Val_Gly_Leu_Met_NH2

190 €
216 $
147 £

Catalog number: 55218
Product Quantity: 1mg
Supplier: GLSChina
PGLa [Gly-Met-Ala-Ser-Lys-Ala-Gly-Ala-Ile-Ala-Gly-Lys-Ile-Ala-Lys-Val-Ala-Leu-Lys-Ala-Leu-NH2; MW: 1968.5]

498 €
565 $
386 £

Catalog number: SP-52299-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Asp-Ser-His-Ala-Lys-Arg-His-His-Gly-Tyr-Lys-Arg-Lys-Phe-His-Glu-Lys-His-His-Ser-His-Arg-Gly-Tyr; MF C133H195N51O33; MW 3036.36

509 €
578 $
395 £

Catalog number: 431-64112-2
Product Quantity: 5 mg
Histatin 5 Formula C133H195N51O33 Sequence Asp_Ser_His_Ala_Lys_Arg_His_His_Gly_Tyr_Lys_Arg_Lys_Phe_His_Glu_Lys_His_His_Ser_His_Arg_Gly_Tyr

199 €
225 $
154 £

Catalog number: 55224
Product Quantity: 1mg
Supplier: GLSChina
Sequence Asp-Ser-His-Ala-Lys-Arg-His-His-Gly-Tyr-Lys-Arg-Lys-Phe-His-Glu-Lys-His-His-Ser-His-Arg-Gly-Tyr; MF C133H195N51O33; MW 3036.36

727 €
825 $
564 £

Catalog number: 431-64112-3
Product Quantity: 10 mg
Sequence Asp-Ser-His-Ala-Lys-Arg-His-His-Gly-Tyr-Lys-Arg-Lys-Phe-His-Glu-Lys-His-His-Ser-His-Arg-Gly-Tyr; MF C133H195N51O33; MW 3036.36

307 €
348 $
238 £

Catalog number: 431-64112-1
Product Quantity: 1mg
Sequence Gly-Asn-Ile-Phe-Ala-Asn-Leu-Phe-Lys-Gly-Leu-Phe-Gly-Lys-Lys-Glu; MF C85H131N21O21 ; MW 1783.09 ;

323 €
366 $
250 £

Catalog number: RB-PP-0171
Product Quantity: 1 mg
Sequence Gly-Ile-Gly-Ala-Ser-Ile-Leu-Ser-Ala-Gly-Lys-Ser-Ala-Leu-Lys-Gly-Leu-Ala-Lys-Gly-Leu-Ala-Glu-His-Phe-Ala-Asn-NH2; MF C115H194N34O33; MW 2581.04

594 €
675 $
461 £

Catalog number: 431-97207-2
Product Quantity: 5 mg
Bombinin-like Peptide (BLP - 1) (AA:Gly-Ile-Gly-Ala-Ser-Ile-Leu-Ser-Ala-Gly-Lys-Ser-Ala-Leu-Lys-Gly-Leu-Ala-Lys-Gly-Leu-Ala-Glu-His-Phe-Ala-Asn-NH2) (MW: 2581.04)

306 €
347 $
237 £

Catalog number: SP-88319-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Gly-Ile-Gly-Ala-Ser-Ile-Leu-Ser-Ala-Gly-Lys-Ser-Ala-Leu-Lys-Gly-Leu-Ala-Lys-Gly-Leu-Ala-Glu-His-Phe-Ala-Asn-NH2; MF C115H194N34O33; MW 2581.04

857 €
972 $
664 £

Catalog number: 431-97207-3
Product Quantity: 10 mg
Sequence Gly-Ile-Gly-Ala-Ser-Ile-Leu-Ser-Ala-Gly-Lys-Ser-Ala-Leu-Lys-Gly-Leu-Ala-Lys-Gly-Leu-Ala-Glu-His-Phe-Ala-Asn-NH2; MF C115H194N34O33; MW 2581.04

307 €
348 $
238 £

Catalog number: 431-97207-1
Product Quantity: 1mg
Galanin-Lys(Biotin), human (AA: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin)) (MW: 3511.95)

390 €
443 $
302 £

Catalog number: SP-101032-1
Product Quantity: 1 mg
Supplier: ADI
BNP (1-32), Human [H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH(Cys10-Cys26); MW: 3464.1]

390 €
443 $
302 £

Catalog number: SP-56586-1
Product Quantity: 0.5 mg
Supplier: ADI
p3K truncated, (Lys 58 Lys 60 Lys 63) Ea(54–68) (AA: Phe-Glu-Ala-Lys-Gly-Ala-Lys-Ala-Asn-Lys-Ala-Val-Asp) (MW: 1348.53)

390 €
443 $
302 £

Catalog number: SP-88003-5
Product Quantity: 5 mg
Supplier: ADI
Preprogalanin 28_67, rat Formula C198H312N62O58 Sequence Thr_Lys_Glu_Lys_Arg_Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_His_Ala_Ile_Asp_Asn_His_Arg_Ser_Phe_Ser_Asp_Lys_His_Gly_Leu_Thr_Gly_L

331 €
376 $
257 £

Catalog number: 88484
Product Quantity: 1mg
Supplier: GLSChina
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (33-40) 98% C51H93N15O14S2 CAS:

323 €
366 $
250 £

Catalog number: A-1445
Product Quantity: 5mg
Supplier: Other suppliers
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (35-40) 98% C43H79N13O12S2 CAS:

294 €
333 $
228 £

Catalog number: A-1447
Product Quantity: 5mg
Supplier: Other suppliers
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (36-42) 98% C47H86N14O13S CAS:

308 €
349 $
239 £

Catalog number: A-1444
Product Quantity: 5mg
Supplier: Other suppliers
Gastrin Releasing Peptide-Lys(Biotin), human (AA:Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-Lys(Biotin)) (MW: 2859.3)

390 €
443 $
302 £

Catalog number: SP-101041-1
Product Quantity: 1 mg
Supplier: ADI
SMAP 29, Sheep Myeloid Antimicrobial Peptide 29 (AA: Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-Arg-Ile-Ala-Gly) (MW: 3256.03)

390 €
443 $
302 £

Catalog number: SP-85560-1
Product Quantity: 1 mg
Supplier: ADI
Biotin-Tyrosine Kinase Peptide 1, amide (AA: Biotin-Lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Val-Val-Tyr-Lys-NH2) (MW: 1895.27)

223 €
253 $
173 £

Catalog number: SP-86883-1
Product Quantity: 1 mg
Supplier: ADI
Cecropin P1 (porcine) Formula C147H253N46O43 Sequence Ser_Trp_Leu_Ser_Lys_Thr_Ala_Lys_Lys_Leu_Glu_Asn_Ser_Ala_Lys_Lys_Arg_Ile_Ser_Glu_Gly_Ile_Ala_Ile_Ala_Ile_Gln_Gly_Gly_Pro_Arg

231 €
262 $
179 £

Catalog number: 89425
Product Quantity: 1mg
Supplier: GLSChina
Ac_â_Endorphin (human) Formula C160H253N39O47S Sequence Ac_Tyr_Gly_Gly_Phe_Met_Thr_Ser_Glu_Lys_Ser_Gln_Thr_Pro_Leu_Val_Thr_Leu_Phe_Lys_Asn_Ala_Ile_Ile_Lys_Asn_Ala_Tyr_Lys_Lys_Gly_Glu

231 €
262 $
179 £

Catalog number: 89895
Product Quantity: 1mg
Supplier: GLSChina
Sequence Biotin-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C168H265N41O48S; MW 3691.36

613 €
695 $
475 £

Catalog number: 431-109409-2
Product Quantity: 5 mg
Sequence Biotin-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C168H265N41O48S; MW 3691.36

921 €
1045 $
714 £

Catalog number: 431-109409-3
Product Quantity: 10 mg
â_Endorphin, human Formula C158H251N39O46S1 Sequence H_Tyr_Gly_Gly_Phe_Met_Thr_Ser_Glu_Lys_Ser_Gln_Thr_Pro_Leu_Val_Thr_Leu_Phe_Lys_Asn_Ala_Ile_Ile_Lys_Asn_Ala_Tyr_Lys_Lys_Gly_Glu

231 €
262 $
179 £

Catalog number: 55282
Product Quantity: 1mg
Supplier: GLSChina
Sequence Biotin-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C168H265N41O48S; MW 3691.36

323 €
366 $
250 £

Catalog number: 431-109409-1
Product Quantity: 1mg
Sequence Lys-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala-Val-Val-Gly-Gly-Leu-Gly; MF C80H138N26O24S2; MW 1912.28

475 €
539 $
368 £

Catalog number: 431-60603-2
Product Quantity: 5 mg
Sequence Lys-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala-Val-Val-Gly-Gly-Leu-Gly; MF C80H138N26O24S2; MW 1912.28

274 €
312 $
213 £

Catalog number: 431-60603-1
Product Quantity: 1mg
Sequence Lys-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Ala-Ala-Gly-Ala-Val-Val-Gly-Gly-Leu-Gly; MF C80H138N26O24S2; MW 1912.28

679 €
771 $
527 £

Catalog number: 431-60603-3
Product Quantity: 10 mg
Sequence Gly-Ile-Ala-Gly-His-Thr-Tyr-Leu-Gln-Ala-Ser-Glu-Lys-Phe-Lys-Nle-Trp-Gly-Ala-Glu; MF C102H152N26O29; MW 2206.51

257 €
292 $
200 £

Catalog number: 431-98015-1
Product Quantity: 1mg
Sequence Gly-Ile-Ala-Gly-His-Thr-Tyr-Leu-Gln-Ala-Ser-Glu-Lys-Phe-Lys-Nle-Trp-Gly-Ala-Glu; MF C102H152N26O29; MW 2206.51

440 €
500 $
341 £

Catalog number: 431-98015-2
Product Quantity: 5 mg
Sequence Gly-Ile-Ala-Gly-His-Thr-Tyr-Leu-Gln-Ala-Ser-Glu-Lys-Phe-Lys-Nle-Trp-Gly-Ala-Glu; MF C102H152N26O29; MW 2206.51

662 €
751 $
513 £

Catalog number: 431-98015-3
Product Quantity: 10 mg
Histone H3 (116–136), N15–39 Formula C112H197N39O30 Sequence Ala_Pro_Arg_Lys_Gln_Leu_Ala_Thr_Lys_Ala_Ala_Arg_Lys_Ser_Ala_Pro_Ala_Thr_Gly_Gly_Val_Lys_Lys_Pro_His

203 €
230 $
157 £

Catalog number: 86705
Product Quantity: 1mg
Supplier: GLSChina
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (33-40) peptide

554 €
629 $
429 £

Catalog number: kb2610
Product Quantity: USD
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (36-42) peptide

512 €
581 $
397 £

Catalog number: kb2616
Product Quantity: USD
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42) peptide

262 €
297 $
203 £

Catalog number: kb2618
Product Quantity: USD
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (35-40) peptide

470 €
534 $
365 £

Catalog number: kb2613
Product Quantity: USD
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (35-40) peptide

178 €
202 $
138 £

Catalog number: kb2611
Product Quantity: USD
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (35-40) peptide

262 €
297 $
203 £

Catalog number: kb2612
Product Quantity: USD
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42) peptide

178 €
202 $
138 £

Catalog number: kb2617
Product Quantity: USD
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (36-42) peptide

283 €
321 $
219 £

Catalog number: kb2615
Product Quantity: USD
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (36-42) peptide

191 €
217 $
148 £

Catalog number: kb2614
Product Quantity: USD
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (33-40) peptide

203 €
230 $
157 £

Catalog number: kb2608
Product Quantity: USD
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (37-42) peptide

470 €
534 $
365 £

Catalog number: kb2619
Product Quantity: USD
Cys-Gly-Lys-Lys-Gly-Amyloid β-Protein (33-40) peptide

303 €
344 $
235 £

Catalog number: kb2609
Product Quantity: USD
Sequence Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C160H253N39O47S; MW 3507.10

613 €
695 $
475 £

Catalog number: 431-98783-2
Product Quantity: 5 mg
Sequence Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C160H253N39O47S; MW 3507.10

921 €
1045 $
714 £

Catalog number: 431-98783-3
Product Quantity: 10 mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C158H251N39O46S; MW 3465.06

323 €
366 $
250 £

Catalog number: 431-64170-1
Product Quantity: 1mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C158H251N39O46S; MW 3465.06

613 €
695 $
475 £

Catalog number: 431-64170-2
Product Quantity: 5 mg
Sequence Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C160H253N39O47S; MW 3507.10

323 €
366 $
250 £

Catalog number: 431-98783-1
Product Quantity: 1mg
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu; MF C158H251N39O46S; MW 3465.06

921 €
1045 $
714 £

Catalog number: 431-64170-3
Product Quantity: 10 mg
Z-Leu-Gly-OMe Z-Leu-Gly-OMe

Ask price

Catalog number: 5084-98-0
Product Quantity: 1g
Supplier: chemotra
Z-Ala-Gly-OMe Z-Ala-Gly-OMe

Ask price

Catalog number: 4840-29-3
Product Quantity: 1g
Supplier: chemotra
Z-D-A-Vinyl-gly-ome Z-D-A-Vinyl-gly-ome

Ask price

Catalog number: 98854-91-2
Product Quantity: 1g
Supplier: chemotra
Sequence Ser-Trp-Leu-Ser-Lys-Thr-Ala-Lys-Lys-Leu-Glu-Asn-Ser-Ala-Lys-Lys-Arg-Ile-Ser-Glu-Gly-Ile-Ala-Ile-Ala-Ile-Gln-Gly-Gly-Pro-Arg; MF C147H253N46O43; MW 3338.93

323 €
366 $
250 £

Catalog number: 431-98313-1
Product Quantity: 1mg
Sequence Ser-Trp-Leu-Ser-Lys-Thr-Ala-Lys-Lys-Leu-Glu-Asn-Ser-Ala-Lys-Lys-Arg-Ile-Ser-Glu-Gly-Ile-Ala-Ile-Ala-Ile-Gln-Gly-Gly-Pro-Arg; MF C147H253N46O43; MW 3338.93

613 €
695 $
475 £

Catalog number: 431-98313-2
Product Quantity: 5 mg
Sequence Ser-Trp-Leu-Ser-Lys-Thr-Ala-Lys-Lys-Leu-Glu-Asn-Ser-Ala-Lys-Lys-Arg-Ile-Ser-Glu-Gly-Ile-Ala-Ile-Ala-Ile-Gln-Gly-Gly-Pro-Arg; MF C147H253N46O43; MW 3338.93

921 €
1045 $
714 £

Catalog number: 431-98313-3
Product Quantity: 10 mg
Sequence Lys-Lys-Gly-Ser-Val-Val-Ile-Val-Gly-Arg-Ile-Val-Leu-Ser-Gly-Lys; MF C74H138N22O19; MW 1640.06

257 €
292 $
200 £

Catalog number: 431-92090-1
Product Quantity: 1mg
KK4A Formula C74H138N22O19 Sequence Lys_Lys_Gly_Ser_Val_Val_Ile_Val_Gly_Arg_Ile_Val_Leu_Ser_Gly_Lys

162 €
184 $
126 £

Catalog number: 83202
Product Quantity: 1mg
Supplier: GLSChina
Sequence Lys-Lys-Gly-Ser-Val-Val-Ile-Val-Gly-Arg-Ile-Val-Leu-Ser-Gly-Lys; MF C74H138N22O19; MW 1640.06

576 €
654 $
447 £

Catalog number: 431-92090-3
Product Quantity: 10 mg
Sequence Lys-Lys-Gly-Ser-Val-Val-Ile-Val-Gly-Arg-Ile-Val-Leu-Ser-Gly-Lys; MF C74H138N22O19; MW 1640.06

373 €
423 $
289 £

Catalog number: 431-92090-2
Product Quantity: 5 mg
Sequence Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys

3464 €
3932 $
2687 £

Catalog number: 431-97279-3
Product Quantity: 10 mg
Sequence Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys

921 €
1045 $
714 £

Catalog number: 431-97279-1
Product Quantity: 1mg
Sequence Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys

2409 €
2734 $
1869 £

Catalog number: 431-97279-2
Product Quantity: 5 mg
p34cdc2 _ derived peptide Formula C62H104N16O19 Sequence Lys_Val_Glu_Lys_Ile_Gly_Glu_Gly_Thr_Tyr_Gly_Val_Val_NH2

281 €
319 $
218 £

Catalog number: 86700
Product Quantity: 5mg
Supplier: GLSChina
[Pyr11]_Amyloid b_Protein (11_40) Formula C143H226N38O39S Sequence Pyr_Val_His_His_Gln_Lys_Leu_Val_Phe_Phe_Ala_Glu_Asp_Val_Gly_Ser_Asn_Lys_Gly_Ala_Ile_Ile_Gly_Leu_Met_Val_Gly_Gly_Val_Val

378 €
429 $
293 £

Catalog number: 89300
Product Quantity: 1mg
Supplier: GLSChina
Histatin 5 [H-Asp-Ser-His-Ala-Lys-Arg-His-His-gly-Tyr-Lys-Arg-Lys-Phe-His-Glu-Lys-His-His-Ser-His-Arg-Gly-Tyr-OH; MW: 3036.66]

318 €
361 $
247 £

Catalog number: SP-55224-1
Product Quantity: 0.5 mg
Supplier: ADI
Sturgeon F (AA: Phe-Gly-Gly-Phe-Met-Lys-Gly-Lys-Tyr-Gly-Tyr) (MW: 1254.48)

390 €
443 $
302 £

Catalog number: SP-89056-5
Product Quantity: 5 mg
Supplier: ADI
[Nle253]-HSV-1 UL 26 Open Reading Frame (238-257) [Gly-Ile-Ala-Gly-His-Thr-Tyr-Leu-Gln-Ala-Ser-Glu-Lys-Phe-Lys-Nle-Trp-Gly-Ala-Glu; MW 2206.51]

223 €
253 $
173 £

Catalog number: SP-89127-1
Product Quantity: 1 mg
Supplier: ADI
ACTH (3_24), human Formula C124H196N38O27S Sequence Ser_Met_Glu_His_Phe_Arg_Trp_Gly_Lys_Pro_Val_Gly_Lys_Lys_Arg_Arg_Pro_Val_Lys_Val_Tyr_Pro

190 €
216 $
147 £

Catalog number: 86498
Product Quantity: 1mg
Category: Peptides
Supplier: GLSChina
Substance P-methyl ester (AA: Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-Ome) (MW: 1362.67)

390 €
443 $
302 £

Catalog number: SP-89810-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-OMe; MF C64H99N17O14S; MW 1362.67

339 €
384 $
263 £

Catalog number: 431-98698-1
Product Quantity: 5 mg
Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-OMe; MF C64H99N17O14S; MW 1362.67

475 €
539 $
368 £

Catalog number: 431-98698-2
Product Quantity: 10 mg
Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-OMe; MF C64H99N17O14S; MW 1362.67

775 €
880 $
601 £

Catalog number: 431-98698-3
Product Quantity: 25 mg
Dermaseptin I [Ala-Leu-Trp-Lys-Thr-Met-Ley-Lys-Lys-Leu-Gly-Thr-Met-Ala-Leu-His0Ala-Gly-lys-Ala-Leu-Gly-Ala-Ala-Ala-Ala-Asp-Thr-Ile-Ser-Gln-Gly-Thr-Gln-OH; MW: 3455.08]

306 €
347 $
237 £

Catalog number: SP-52239-1
Product Quantity: 0.5 mg
Supplier: ADI
Ac-β-Endorphin (human) [Ac-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu (MW: 3507.10)]

306 €
347 $
237 £

Catalog number: SP-89895-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-Gly-Lys-Arg-Glu-Leu-Pro; MF C198H312N62O58; MW 4489.

1407 €
1596 $
1091 £

Catalog number: 431-97372-3
Product Quantity: 10 mg
Sequence Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-Gly-Lys-Arg-Glu-Leu-Pro; MF C198H312N62O58; MW 4489.

954 €
1083 $
740 £

Catalog number: 431-97372-2
Product Quantity: 5 mg
Sequence Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-Gly-Lys-Arg-Glu-Leu-Pro; MF C198H312N62O58; MW 4489.

407 €
462 $
316 £

Catalog number: 431-97372-1
Product Quantity: 1mg
Sequence Pyr-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C143H226N38O39S; MW 3133.71

1018 €
1156 $
790 £

Catalog number: 431-98188-2
Product Quantity: 5 mg
Sequence Pyr-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C143H226N38O39S; MW 3133.71

1665 €
1890 $
1292 £

Catalog number: 431-98188-3
Product Quantity: 10 mg
Sequence Pyr-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C143H226N38O39S; MW 3133.71

475 €
539 $
368 £

Catalog number: 431-98188-1
Product Quantity: 1mg
[Pyr11]-Amyloid β-Protein (11-40) [Pyr-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MW 3133.71]

472 €
536 $
366 £

Catalog number: SP-89300-1
Product Quantity: 1 mg
Supplier: ADI
Substance P_methyl ester Formula C64H99N17O14S Sequence Arg_Pro_Lys_Pro_Gln_Gln_Phe_Phe_Gly_Leu_Met_Ome

256 €
291 $
199 £

Catalog number: 89810
Product Quantity: 5mg
Supplier: GLSChina
Sequence Cys-Gly-His-Gly-Asn-Lys-Ser-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C58H99N19O18S2; MW 1414.67

355 €
403 $
275 £

Catalog number: 431-98195-2
Product Quantity: 5 mg
Sequence Cys-Gly-His-Gly-Asn-Lys-Ser-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C58H99N19O18S2; MW 1414.67

257 €
292 $
200 £

Catalog number: 431-98195-1
Product Quantity: 1mg
Sequence Cys-Gly-His-Gly-Asn-Lys-Ser-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C58H99N19O18S2; MW 1414.67

543 €
616 $
421 £

Catalog number: 431-98195-3
Product Quantity: 10 mg
Sequence Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro; MF C124H196N38O27S; MW 2683.25

274 €
312 $
213 £

Catalog number: 431-95386-1
Product Quantity: 1mg
Category: Peptides
Sequence Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro; MF C124H196N38O27S; MW 2683.25

695 €
789 $
539 £

Catalog number: 431-95386-3
Product Quantity: 10 mg
Category: Peptides
Sequence Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro; MF C124H196N38O27S; MW 2683.25

475 €
539 $
368 £

Catalog number: 431-95386-2
Product Quantity: 5 mg
Category: Peptides
Cecropin P1 (porcine) (AA: Ser-Trp-Leu-Ser-Lys-Thr-Ala-Lys-Lys-Leu-Glu-Asn-Ser-Ala-Lys-Lys-Arg-Ile-Ser-Glu-Gly-Ile-Ala-Ile-Ala-Ile-Gln-Gly-Gly-Pro-Arg) (MW: 3338.93)

306 €
347 $
237 £

Catalog number: SP-89425-1
Product Quantity: 1 mg
Supplier: ADI
Substance P_Gly_Lys_Arg Formula C77H124N24O17S Sequence Arg_Pro_Lys_Pro_Gln_Gln_Phe_Phe_Gly_Leu_Met_Gly_Lys_Arg

155 €
176 $
120 £

Catalog number: 87369
Product Quantity: 1mg
Supplier: GLSChina
Sequence Lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Val-Val-NH2; MF C62H104N16O19; MW 1377.62

857 €
972 $
664 £

Catalog number: 431-95588-3
Product Quantity: 25 mg
p34cdc2 - derived peptide (AA: Lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Val-Val-NH2) (MW: 1377.62)

390 €
443 $
302 £

Catalog number: SP-86700-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Val-Val-NH2; MF C62H104N16O19; MW 1377.62

355 €
403 $
275 £

Catalog number: 431-95588-1
Product Quantity: 5 mg
Sequence Lys-Val-Glu-Lys-Ile-Gly-Glu-Gly-Thr-Tyr-Gly-Val-Val-NH2; MF C62H104N16O19; MW 1377.62

509 €
578 $
395 £

Catalog number: 431-95588-2
Product Quantity: 10 mg
Biotin_â_Endomorphin, human Formula C168H265N41O48S Sequence Biotin_Tyr_Gly_Gly_Phe_Met_Thr_Ser_Glu_Lys_Ser_Gln_Thr_Pro_Leu_Val_Thr_Leu_Phe_Lys_Asn_Ala_Ile_Ile_Lys_Asn_Ala_Tyr_Lys_Lys_Gly_Glu

228 €
259 $
177 £

Catalog number: 100521
Product Quantity: 1mg
Supplier: GLSChina
[Nle253]_HSV_1 UL 26 Open Reading Frame (238_257) Formula C102H152N26O29 Sequence Gly_Ile_Ala_Gly_His_Thr_Tyr_Leu_Gln_Ala_Ser_Glu_Lys_Phe_Lys_Nle_Trp_Gly_Ala_Glu

177 €
201 $
137 £

Catalog number: 89127
Product Quantity: 1mg
Supplier: GLSChina
Cys-Gly-Lys-Lys-Gly-Amyloid-Protein (37-42) peptide This is Cys-Gly-Lys-Lys-Gly-Amyloid-Protein (37-42) peptide. For research use only.

197 €
224 $
153 £

Catalog number: orb70590
Product Quantity: 1 mg
Supplier: Biorb
Cys-Gly-Lys-Lys-Gly-Amyloid-Protein (33-40) peptide This is Cys-Gly-Lys-Lys-Gly-Amyloid-Protein (33-40) peptide. For research use only.

197 €
224 $
153 £

Catalog number: orb70587
Product Quantity: 1 mg
Supplier: Biorb
Cys-Gly-Lys-Lys-Gly-Amyloid-Protein (35-40) peptide This is Cys-Gly-Lys-Lys-Gly-Amyloid-Protein (35-40) peptide. For research use only.

197 €
224 $
153 £

Catalog number: orb70588
Product Quantity: 1 mg
Supplier: Biorb
Cys-Gly-Lys-Lys-Gly-Amyloid-Protein (36-42) peptide This is Cys-Gly-Lys-Lys-Gly-Amyloid-Protein (36-42) peptide. For research use only.

197 €
224 $
153 £

Catalog number: orb70589
Product Quantity: 1 mg
Supplier: Biorb
Histone H3 (116–136), N15–39 (AA: Ala-Pro-Arg-Lys-Gln-Leu-Ala-Thr-Lys-Ala-Ala-Arg-Lys-Ser-Ala-Pro-Ala-Thr-Gly-Gly-Val-Lys-Lys-Pro-His) (MW: 2570.06)

306 €
347 $
237 £

Catalog number: SP-86705-1
Product Quantity: 1 mg
Supplier: ADI
â_ Amyloid (8_38) Formula C147H227N39O43S Sequence Ser_Gly_Tyr_Glu_Val_His_His_Gln_Lys_Leu_Val_Phe_Phe_Ala_Glu_Asp_Val_Gly_Ser_Asn_Lys_Gly_Ala_Ile_Ile_Gly_Leu_Met_Val_Gly_Gly

231 €
262 $
179 £

Catalog number: 87990
Product Quantity: 1mg
Supplier: GLSChina
Sequence Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly; MF C147H227N39O43S; MW 3260.75

921 €
1045 $
714 £

Catalog number: 431-96878-3
Product Quantity: 10 mg
Sequence Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly; MF C147H227N39O43S; MW 3260.75

613 €
695 $
475 £

Catalog number: 431-96878-2
Product Quantity: 5 mg
Sequence Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly; MF C147H227N39O43S; MW 3260.75

323 €
366 $
250 £

Catalog number: 431-96878-1
Product Quantity: 1mg
Prepro VIP (81_122) (human) Formula C202H325N53O64S Sequence His_Ala_Asp_Gly_Val_Phe_Thr_Ser_Asp_Phe_Ser_Lys_Leu_Leu_Gly_Gln_Leu_Ser_Ala_Lys_Lys_Tyr_Leu_Glu_Ser_Leu_Met_Gly_Lys_Arg_Val_Ser_Ser_Asn_I

342 €
388 $
265 £

Catalog number: 89585
Product Quantity: 1mg
Supplier: GLSChina
MF C58H99N19O18S2 ; MW 1414.66; CGHGNKSGLMVGGVV, Cys-Gly-His-Gly-Asn-Lys-Ser-Gly-Leu-Met-Val-Gly-Gly-Val-Val

307 €
348 $
238 £

Catalog number: RB-PP-0055
Product Quantity: 1 mg
Sequence Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-Arg-Ile-Ala-Gly; MF C146H260N52O32; MW 3256.03

323 €
366 $
250 £

Catalog number: 431-94448-1
Product Quantity: 1mg
Sequence Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-Arg-Ile-Ala-Gly; MF C146H260N52O32; MW 3256.03

857 €
972 $
664 £

Catalog number: 431-94448-3
Product Quantity: 10 mg
Sequence Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-Arg-Ile-Ala-Gly; MF C146H260N52O32; MW 3256.03

594 €
675 $
461 £

Catalog number: 431-94448-2
Product Quantity: 5 mg
Sequence Ser-Lys-Gly-Lys-Ser-Lys-Arg-Lys-Lys-Asp-Leu-Arg-Ile-Ser-Cys-Asn-Ser-Lys; MF C85H158N31O26S1; MW 2063.5

257 €
292 $
200 £

Catalog number: 431-109433-1
Product Quantity: 1mg
Sequence Ser-Lys-Gly-Lys-Ser-Lys-Arg-Lys-Lys-Asp-Leu-Arg-Ile-Ser-Cys-Asn-Ser-Lys; MF C85H158N31O26S1; MW 2063.5

613 €
695 $
475 £

Catalog number: 431-109433-3
Product Quantity: 10 mg
MKKp2 Formula C85H158N31O26S1 Sequence Ser_Lys_Gly_Lys_Ser_Lys_Arg_Lys_Lys_Asp_Leu_Arg_Ile_Ser_Cys_Asn_Ser_Lys

173 €
196 $
134 £

Catalog number: 100545
Product Quantity: 1mg
Supplier: GLSChina
Sequence Ser-Lys-Gly-Lys-Ser-Lys-Arg-Lys-Lys-Asp-Leu-Arg-Ile-Ser-Cys-Asn-Ser-Lys; MF C85H158N31O26S1; MW 2063.5

407 €
462 $
316 £

Catalog number: 431-109433-2
Product Quantity: 5 mg
Sequence Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly; MF C132H240N66O29; MW 3215.81

509 €
578 $
395 £

Catalog number: 431-64113-2
Product Quantity: 5 mg
TAT 2_4 Formula C132H240N66O29 Sequence Tyr_Gly_Arg_Lys_Lys_Arg_Arg_Gln_Arg_Arg_Arg_Gly_Tyr_Gly_Arg_Lys_Lys_Arg_Arg_Gln_Arg_Arg_Arg_Gly

199 €
225 $
154 £

Catalog number: 55225
Product Quantity: 1mg
Supplier: GLSChina
Sequence Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly; MF C132H240N66O29; MW 3215.81

727 €
825 $
564 £

Catalog number: 431-64113-3
Product Quantity: 10 mg
Sequence Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly; MF C132H240N66O29; MW 3215.81

307 €
348 $
238 £

Catalog number: 431-64113-1
Product Quantity: 1mg
MF C74H138N22O19 ; MW 1640.03; KKGSVVIVGRIVLSGK, Lys-Lys-Gly-Ser-Val-Val-Ile-Val-Gly-Arg-Ile-Val-Leu-Ser-Gly-Lys

307 €
348 $
238 £

Catalog number: RB-PP-0971
Product Quantity: 1 mg
ACTH (3-24), human (AA: Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro) (MW: 2683.25)

271 €
308 $
210 £

Catalog number: SP-86498-1
Product Quantity: 1 mg
Supplier: ADI
Preprogalanin 28-67, rat (AA: Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-Gly-Lys-Arg-Glu-Leu-Pro) (MW: 4489

390 €
443 $
302 £

Catalog number: SP-88484-1
Product Quantity: 1 mg
Supplier: ADI
HIV Nef(90 _ 100) Formula C55H91N13O16 Sequence Phe_Leu_Lys_Glu_Lys_Gly_Gly_Leu_Glu_Gly_Leu

237 €
269 $
184 £

Catalog number: 86623
Product Quantity: 5mg
Supplier: GLSChina
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

970 €
1101 $
752 £

Catalog number: 431-98439-3
Product Quantity: 10 mg
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

339 €
384 $
263 £

Catalog number: 431-98439-1
Product Quantity: 1mg
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

679 €
771 $
527 £

Catalog number: 431-98439-2
Product Quantity: 5 mg
Pep 4AK Formula C81H153N27O19 Sequence Lys_Lys_Lys_Gly_Ser_Val_Val_Ile_Val_Gly_Arg_Ile_Ile_Leu_Ser_Gly_Arg_NH2

173 €
196 $
134 £

Catalog number: 51608
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys

970 €
1101 $
752 £

Catalog number: 431-109399-1
Product Quantity: 1mg
Sequence Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys

2655 €
3014 $
2060 £

Catalog number: 431-109399-2
Product Quantity: 5 mg
Sequence Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys

3950 €
4483 $
3064 £

Catalog number: 431-109399-3
Product Quantity: 10 mg
Sequence Ala-Pro-Arg-Lys-Gln-Leu-Ala-Thr-Lys-Ala-Ala-Arg-Lys-Ser-Ala-Pro-Ala-Thr-Gly-Gly-Val-Lys-Lys-Pro-His; MF C112H197N39O30; MW 2570.06

307 €
348 $
238 £

Catalog number: 431-95593-1
Product Quantity: 1mg
Sequence Ala-Pro-Arg-Lys-Gln-Leu-Ala-Thr-Lys-Ala-Ala-Arg-Lys-Ser-Ala-Pro-Ala-Thr-Gly-Gly-Val-Lys-Lys-Pro-His; MF C112H197N39O30; MW 2570.06

775 €
880 $
601 £

Catalog number: 431-95593-3
Product Quantity: 10 mg
Sequence Ala-Pro-Arg-Lys-Gln-Leu-Ala-Thr-Lys-Ala-Ala-Arg-Lys-Ser-Ala-Pro-Ala-Thr-Gly-Gly-Val-Lys-Lys-Pro-His; MF C112H197N39O30; MW 2570.06

543 €
616 $
421 £

Catalog number: 431-95593-2
Product Quantity: 5 mg
Nociceptin (1_13) amide Formula C61H100N22O15 Sequence Phe_Gly_Gly_Phe_Thr_Gly_Ala_Arg_Lys_Ser_Ala_Arg_Lys_NH2

281 €
319 $
218 £

Catalog number: 61970
Product Quantity: 5mg
Supplier: GLSChina
Sequence Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; MF C61H110N24O14; MW 1403.71

440 €
500 $
341 £

Catalog number: 431-109345-2
Product Quantity: 10 mg
Sequence Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; MF C61H110N24O14; MW 1403.71

339 €
384 $
263 £

Catalog number: 431-109345-1
Product Quantity: 5 mg
Sequence Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2; MF C61H110N24O14; MW 1403.71

727 €
825 $
564 £

Catalog number: 431-109345-3
Product Quantity: 25 mg
Biotin-β-Endomorphin, human (AA: Biotin-Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu) (MW: 3691.36)

390 €
443 $
302 £

Catalog number: SP-100521-1
Product Quantity: 1 mg
Supplier: ADI
Z-Lys(Boc)-Leu-OMe Z-Lys(Boc)-Leu-OMe

Ask price

Catalog number: 37178-11-3
Product Quantity: 1g
Supplier: chemotra
[Gln22] _ 25359 _ Amyloid (6 _40) Formula C167H258N46O48S Sequence His_Asp_Ser_Gly_Tyr_Glu_Val_His_His_Gln_Lys_Leu_Val_Phe_Phe_Ala_Gln_Asp_Val_Gly_Ser_Asn_Lys_Gly_Ala_Ile_Ile_Gly_Leu_Met_Val_Gly_Gly

353 €
400 $
273 £

Catalog number: 87936
Product Quantity: 1mg
Supplier: GLSChina
ACTH (6_24), human Formula C111H175N35O21 Sequence His_Phe_Arg_Trp_Gly_Lys_Pro_Val_Gly_Lys_Lys_Arg_Arg_Pro_Val_Lys_Val_Tyr_Pro

177 €
201 $
137 £

Catalog number: 62195
Product Quantity: 1mg
Supplier: GLSChina
β- Amyloid (8-38) [Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly (MW: 3260.75)]

390 €
443 $
302 £

Catalog number: SP-87990-1
Product Quantity: 1 mg
Supplier: ADI
Sequence His-Ser-Leu-Gly-Lys-Ala-Leu-Gly-His-Pro-Asp-Lys-Phe; MF C64H99N19O17; MW 1406.62

355 €
403 $
275 £

Catalog number: 431-95765-1
Product Quantity: 5 mg
Sequence His-Ser-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe; MF C72H104N20O17; MW 1521.7

475 €
539 $
368 £

Catalog number: 431-61186-2
Product Quantity: 10 mg
Sequence His-Ser-Leu-Gly-Lys-Gln-Leu-Gly-His-Pro-Asp-Lys-Phe; MF C66H102N20O18; MW 1463.67

355 €
403 $
275 £

Catalog number: 431-95764-1
Product Quantity: 5 mg
Levitide [pGlu-Gly-Met-Ile-Gly-Thr-Ser-Lys-Arg-Ile-Lys-gln-NH2; MW 1542.88]

190 €
216 $
147 £

Catalog number: SP-55152-1
Product Quantity: 1 mg
Supplier: ADI
Sequence His-Ser-Leu-Gly-Lys-Gln-Leu-Gly-His-Pro-Asp-Lys-Phe; MF C66H102N20O18; MW 1463.67

475 €
539 $
368 £

Catalog number: 431-95764-2
Product Quantity: 10 mg
Sequence His-Ser-Leu-Gly-Lys-Ala-Leu-Gly-His-Pro-Asp-Lys-Phe; MF C64H99N19O17; MW 1406.62

775 €
880 $
601 £

Catalog number: 431-95765-3
Product Quantity: 25 mg
Sequence His-Ser-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe; MF C72H104N20O17; MW 1521.7

355 €
403 $
275 £

Catalog number: 431-61186-1
Product Quantity: 5 mg
Sequence His-Ser-Leu-Gly-Lys-Gln-Leu-Gly-His-Pro-Asp-Lys-Phe; MF C66H102N20O18; MW 1463.67

775 €
880 $
601 £

Catalog number: 431-95764-3
Product Quantity: 25 mg
Sequence His-Ser-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe; MF C72H104N20O17; MW 1521.7

775 €
880 $
601 £

Catalog number: 431-61186-3
Product Quantity: 25 mg
Sequence His-Ser-Leu-Gly-Lys-Ala-Leu-Gly-His-Pro-Asp-Lys-Phe; MF C64H99N19O17; MW 1406.62

475 €
539 $
368 £

Catalog number: 431-95765-2
Product Quantity: 10 mg
PLP (139-151) [His-Ser-Leu-Gly-Lys-Trp-Leu-Gly-His-Pro-Asp-Lys-Phe-OH; MW: 1521.7]

264 €
299 $
205 £

Catalog number: SP-52298-1
Product Quantity: 1 mg
Supplier: ADI
á_Neo_Endorphin, porcine Formula C60H89N15O13 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Lys_Tyr_Pro_Lys

227 €
258 $
176 £

Catalog number: 87431
Product Quantity: 5mg
Supplier: GLSChina
Sequence Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg-Lys-NH2; MF C61H100N22O15; MW 1381.62

509 €
578 $
395 £

Catalog number: 431-70858-2
Product Quantity: 10 mg
Sequence Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg-Lys-NH2; MF C61H100N22O15; MW 1381.62

355 €
403 $
275 £

Catalog number: 431-70858-1
Product Quantity: 5 mg
Sequence Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg-Lys-NH2; MF C61H100N22O15; MW 1381.62

857 €
972 $
664 £

Catalog number: 431-70858-3
Product Quantity: 25 mg
Sequence His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-Lys(Bio)-NH2; MF C219H357N67O56S2; MW

727 €
825 $
564 £

Catalog number: 431-110151-2
Product Quantity: 1mg
Sequence His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-Lys(Bio)-NH2; MF C219H357N67O56S2; MW

1018 €
1156 $
790 £

Catalog number: 431-110151-3
Product Quantity: 2.5 mg
Sequence His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-Lys(Bio)-NH2; MF C219H357N67O56S2; MW

475 €
539 $
368 £

Catalog number: 431-110151-1
Product Quantity: 500

2550 €
2895 $
1978 £

Catalog number: AF8009
Product Quantity: 5mg
Supplier: Affi
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Pro-Lys; MF C60H89N15O13; MW 1228.47

323 €
366 $
250 £

Catalog number: 431-96319-1
Product Quantity: 5 mg
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Pro-Lys; MF C60H89N15O13; MW 1228.47

679 €
771 $
527 £

Catalog number: 431-96319-3
Product Quantity: 25 mg
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Pro-Lys; MF C60H89N15O13; MW 1228.47

407 €
462 $
316 £

Catalog number: 431-96319-2
Product Quantity: 10 mg
α-Neo-Endorphin, porcine [Tyr-Gly-Gly-Phe-Leu-Arg-Lys-Tyr-Pro-Lys (MW: 1228.47)]

390 €
443 $
302 £

Catalog number: SP-87431-5
Product Quantity: 5 mg
Supplier: ADI
PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) (AA: Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2) (MW: 1403.71)

390 €
443 $
302 £

Catalog number: SP-100457-5
Product Quantity: 5 mg
Supplier: ADI
MF C146H260N52O32 ; MW 3255.97 ; RGLRRLGRKIAHGVKKYGPTVLRIIRIAG, Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-Arg-Ile-Ala-Gly

355 €
403 $
275 £

Catalog number: RB-PP-1451
Product Quantity: 1 mg
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin); MF C155H237N46O46S; MW 3511.95

373 €
423 $
289 £

Catalog number: 431-109920-1
Product Quantity: 1mg
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin); MF C155H237N46O46S; MW 3511.95

857 €
972 $
664 £

Catalog number: 431-109920-2
Product Quantity: 5 mg
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin); MF C155H237N46O46S; MW 3511.95

1148 €
1303 $
890 £

Catalog number: 431-109920-3
Product Quantity: 10 mg
MKKp2 (AA: Ser-Lys-Gly-Lys-Ser-Lys-Arg-Lys-Lys-Asp-Leu-Arg-Ile-Ser-Cys-Asn-Ser-Lys) (MW: 2063.5)

223 €
253 $
173 £

Catalog number: SP-100545-1
Product Quantity: 1 mg
Supplier: ADI
26Rfa, Hypothalamic Peptide, human Formula C127H195N37O37 Sequence Thr_Ser_Gly_Pro_Leu_Gly_Asn_Leu_Ala_Glu_Glu_Leu_Asn_Gly_Tyr_Ser_Arg_Lys_Lys_Gly_Gly_Phe_Ser_Phe_Arg_Phe_NH2

212 €
241 $
165 £

Catalog number: 67811
Product Quantity: 1mg
Supplier: GLSChina
Sequence Lys-Lys-Ser-Arg-Gly-Asp-Tyr-Met-Thr-Met-Gln-Ile-Gly-NH2; MF C63H108N20O19S2; MW 1513.81

355 €
403 $
275 £

Catalog number: 431-95591-1
Product Quantity: 5 mg
IRS1 - derived peptide (AA: Lys-Lys-Ser-Arg-Gly-Asp-Tyr-Met-Thr-Met-Gln-Ile-Gly-NH2) (MW: 1513.81)

390 €
443 $
302 £

Catalog number: SP-86703-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Lys-Lys-Ser-Arg-Gly-Asp-Tyr-Met-Thr-Met-Gln-Ile-Gly-NH2; MF C63H108N20O19S2; MW 1513.81

857 €
972 $
664 £

Catalog number: 431-95591-3
Product Quantity: 25 mg
Sequence Lys-Lys-Ser-Arg-Gly-Asp-Tyr-Met-Thr-Met-Gln-Ile-Gly-NH2; MF C63H108N20O19S2; MW 1513.81

509 €
578 $
395 £

Catalog number: 431-95591-2
Product Quantity: 10 mg
HIV_gp120_ Fragment (308_331) Formula C114H199N41O31 Sequence Asn_Asn_Thr_Arg_Lys_Ser_Ile_Arg_Ile_Gln_Arg_Gly_Pro_Gly_Arg_Ala_Phe_Val_Thr_Ile_Gly_Lys_Ile_Gly

199 €
225 $
154 £

Catalog number: 89134
Product Quantity: 1mg
Supplier: GLSChina
Sequence Lys-Lys-Lys-Gly-Ser-Val-Val-Ile-Val-Gly-Arg-Ile-Ile-Leu-Ser-Gly-Arg-NH2; MF C81H153N27O19; MW 1809.29

407 €
462 $
316 £

Catalog number: 431-60496-2
Product Quantity: 5 mg
Sequence Lys-Lys-Lys-Gly-Ser-Val-Val-Ile-Val-Gly-Arg-Ile-Ile-Leu-Ser-Gly-Arg-NH2; MF C81H153N27O19; MW 1809.29

257 €
292 $
200 £

Catalog number: 431-60496-1
Product Quantity: 1mg
Sequence Lys-Lys-Lys-Gly-Ser-Val-Val-Ile-Val-Gly-Arg-Ile-Ile-Leu-Ser-Gly-Arg-NH2; MF C81H153N27O19; MW 1809.29

613 €
695 $
475 £

Catalog number: 431-60496-3
Product Quantity: 10 mg
MF C112H197N39O30 ; MW 2570.02; APRKQLATKAARKSAPATGGVKKPH, Ala-Pro-Arg-Lys-Gln-Leu-Ala-Thr-Lys-Ala-Ala-Arg-Lys-Ser-Ala-Pro-Ala-Thr-Gly-Gly-Val-Lys-Lys-Pro-His

339 €
384 $
263 £

Catalog number: RB-PP-0785
Product Quantity: 1 mg
Cecropin A (1_7)_Melittin A (2_9) amide Formula C89H152N22O15 Sequence Lys_Trp_Lys_Leu_Phe_Lys_Lys_Ile_Gly_Ala_Val_Leu_Lys_Val_Leu_NH2

162 €
184 $
126 £

Catalog number: 89424
Product Quantity: 1mg
Supplier: GLSChina
Peptide F, Bovine [H-Tyr-Gly-Gly-Phe-Met-Lys-Lys-Met-Asp-Glu-Leu-Tyr-Pro-Leu-Glu-Val-Glu-Glu-Glu-Ala-Asn-Gly-Gly-Glu-Val-Leu-Glu-Lys-Arg-Tyr-Gly-Glu-Phe-Met-OH; MW: 3845.42]

505 €
573 $
391 £

Catalog number: SP-55289-1
Product Quantity: 1 mg
Supplier: ADI
Cys-Gly-Lys-Arg-Amyloid - β Protein (1-42) (AA: Cys-Gly-Lys-Arg-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-

724 €
822 $
561 £

Catalog number: SP-89296-1
Product Quantity: 1 mg
Supplier: ADI
Orphanin FQ, (Nociceptin) Formula C79H129N27O22 Sequence Phe_Gly_Gly_Phe_Thr_Gly_Ala_Arg_Lys_Ser_Ala_Arg_Lys_Leu_Ala_Asn_Gln

167 €
190 $
130 £

Catalog number: 52285
Product Quantity: 1mg
Supplier: GLSChina
H-Glu(EDANS)-Val-Tyr-Leu-Lys-Ala-Ser-Gln-Phe-Pro-Ala-Gly-Ile-Lys(DABCYL)-Gly-OH CAS №: 400746-50-1

2550 €
2895 $
1978 £

Catalog number: AF8009
Product Quantity: 5mg
Supplier: Affi
Nociceptin (1-13) amide (AA: Phe-Gly-Gly-Phe-Thr-Gly-Ala-Arg-Lys-Ser-Ala-Arg-Lys-NH2) (MW: 1381.62)

390 €
443 $
302 £

Catalog number: SP-61970-5
Product Quantity: 5 mg
Supplier: ADI
PACAP_38 (28_38) (human,chicken, mouse, ovine,porcine, rat) Formula C61H110N24O14 Sequence Gly_Lys_Arg_Tyr_Lys_Gln_Arg_Val_Lys_Asn_Lys_NH2

252 €
286 $
195 £

Catalog number: 100457
Product Quantity: 5mg
Supplier: GLSChina
HIV-gp120- Fragment (308-331) (AA: Asn-Asn-Thr-Arg-Lys-Ser-Ile-Arg-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Val-Thr-Ile-Gly-Lys-Ile-Gly) (MW: 2640.11)

306 €
347 $
237 £

Catalog number: SP-89134-1
Product Quantity: 1 mg
Supplier: ADI
Sequence His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro; MF C111H175N35O21; MW 2335.9

257 €
292 $
200 £

Catalog number: 431-71083-1
Product Quantity: 1mg

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45 | Gentaur

Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411 | Gentaur



9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017


Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925 | Gentaur

Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123

GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897 | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U

tel:0911876558 | Gentaur

ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: | Gentaur
IBAN: BG11FINV91501014771636

GENTAUR Poland Sp. z o.o.

ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48       | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556


Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94 | Gentaur