GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc 6017 Snell Ave, Ste 357, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, sales@genprice.com

Full view Results
Dnp_Pro_Gln_Gly_Ile_Ala_Gly_Gln_D_Arg

324 €
367 $
251 £

Catalog number: 3087-v
Product Quantity: 2.5mg
Category:
Supplier: Sceti K.K.
[Ala11,D_Leu15]_Orexin B (human) Formula C120H206N44O35S Sequence Arg_Ser_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Ala_Gln_Arg_Leu_D_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

247 €
280 $
191 £

Catalog number: 100439
Product Quantity: 1mg
Category:
Supplier: GLSChina
Dnp_Gln_Gly_Ile_Ala_Gly_Gln_D_Arg

308 €
349 $
239 £

Catalog number: 3088-v
Product Quantity: 2.5mg
Category:
Supplier: Sceti K.K.
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2; MF C184H313N53O46; MW 4003.87

407 €
462 $
316 £

Catalog number: 431-70206-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2; MF C184H313N53O46; MW 4003.87

921 €
1045 $
714 £

Catalog number: 431-70206-2
Product Quantity: 5 mg
Category:
Supplier:
Cecropin A Formula C184H313N53O46 Sequence Lys_Trp_Lys_Leu_Phe_Lys_Lys_Ile_Glu_Lys_Val_Gly_Gln_Asn_Ile_Arg_Asp_Gly_Ile_Ile_Lys_Ala_Gly_Pro_Ala_Val_Ala_Val_Val_Gly_Gln_Ala_Thr_Gln_Ile_Ala_Lys_NH2

318 €
361 $
247 £

Catalog number: 61318
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2; MF C184H313N53O46; MW 4003.87

1277 €
1449 $
991 £

Catalog number: 431-70206-3
Product Quantity: 10 mg
Category:
Supplier:
[Ala11, D-Leu15]-Orexin B (human) [Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 2857.28]

390 €
443 $
302 £

Catalog number: SP-100439-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Cecropin A (AA: Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2) (MW: 4003.87)

557 €
632 $
432 £

Catalog number: SP-61318-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Orexin B, canine Formula C125H214N44O34S1 Sequence Arg_Pro_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

215 €
244 $
166 £

Catalog number: 55233
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C120H206N44O35S; MW 2857.28

339 €
384 $
263 £

Catalog number: 431-109327-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C120H206N44O35S; MW 2857.28

679 €
771 $
527 £

Catalog number: 431-109327-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C120H206N44O35S; MW 2857.28

970 €
1101 $
752 £

Catalog number: 431-109327-3
Product Quantity: 10 mg
Category:
Supplier:
Hypocretin (70_98) (human) Formula C125H214N44O37S1 Sequence Arg_Ser_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_Gly

220 €
250 $
170 £

Catalog number: 100438
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C125H214N44O34S; MW 2909.44

576 €
654 $
447 £

Catalog number: 431-64121-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C125H214N44O34S; MW 2909.44

373 €
423 $
289 £

Catalog number: 431-64121-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C125H214N44O34S; MW 2909.44

307 €
348 $
238 £

Catalog number: 431-64121-1
Product Quantity: 500
Category:
Supplier:
Orexin B, human Formula C123H212N44O35S1 Sequence Arg_Ser_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

215 €
244 $
166 £

Catalog number: 54422
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly; MF C125H214N44O37S; MW 2957.4

594 €
675 $
461 £

Catalog number: 431-109326-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly; MF C125H214N44O37S; MW 2957.4

323 €
366 $
250 £

Catalog number: 431-109326-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly; MF C125H214N44O37S; MW 2957.4

857 €
972 $
664 £

Catalog number: 431-109326-3
Product Quantity: 10 mg
Category:
Supplier:
Orexin B, Canine [H-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 299.44]

318 €
361 $
247 £

Catalog number: SP-55233-5
Product Quantity: 0.5 mg
Category:
Supplier: ADI
GHRF, Rat [H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gl-Gln-Leu-Tyr0Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MW: 523

505 €
573 $
391 £

Catalog number: SP-54418-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C123H212N44O35S; MW 2899.4

307 €
348 $
238 £

Catalog number: 431-63310-1
Product Quantity: 500
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C123H212N44O35S; MW 2899.4

576 €
654 $
447 £

Catalog number: 431-63310-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C123H212N44O35S; MW 2899.4

373 €
423 $
289 £

Catalog number: 431-63310-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C221H

986 €
1119 $
765 £

Catalog number: 431-64309-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C221H

1520 €
1725 $
1179 £

Catalog number: 431-64309-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C221H

440 €
500 $
341 £

Catalog number: 431-64309-1
Product Quantity: 1mg
Category:
Supplier:
GHRF, rat Formula C225H361N77O66S1 Sequence His_Ala_Asp_Ala_Ile_Phe_Thr_Ser_Ser_Tyr_Arg_Arg_Ile_Leu_Gly_Gln_Leu_Tyr_Ala_Arg_Lys_Leu_Leu_His_Glu_Ile_Met_Asn_Arg_Gln_Gln_Gly_Glu_Arg_Asn_Gln_Glu_Gln_Ar

354 €
401 $
274 £

Catalog number: 54418
Product Quantity: 1mg
Category:
Supplier: GLSChina
Hypocretin (70-98) (human) (AA: Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly) (MW: 2957.4)

390 €
443 $
302 £

Catalog number: SP-100438-1
Product Quantity: 1 mg
Category:
Supplier: ADI
GHRF, (1-44), Human [H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lus-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-N

451 €
512 $
350 £

Catalog number: SP-52557-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C145H238N48O38S2; MW 3325.9

679 €
771 $
527 £

Catalog number: 431-110016-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C145H238N48O38S2; MW 3325.9

339 €
384 $
263 £

Catalog number: 431-110016-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C145H238N48O38S2; MW 3325.9

970 €
1101 $
752 £

Catalog number: 431-110016-3
Product Quantity: 10 mg
Category:
Supplier:
Orexin B, rat, mouse Formula C126H215N45O34S1 Sequence Arg_Pro_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Asn_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

215 €
244 $
166 £

Catalog number: 55234
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C114H174N34O31; MW 2516.87

727 €
825 $
564 £

Catalog number: 431-63953-3
Product Quantity: 10 mg
Category:
Supplier:
Obestatin, rat, mouse (AA: Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2) (MW: 2516.87)

306 €
347 $
237 £

Catalog number: SP-55065-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C114H174N34O31; MW 2516.87

509 €
578 $
395 £

Catalog number: 431-63953-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C114H174N34O31; MW 2516.87

307 €
348 $
238 £

Catalog number: 431-63953-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C124H188N36O33; MW 2743.17

509 €
578 $
395 £

Catalog number: 431-109325-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C124H188N36O33; MW 2743.17

307 €
348 $
238 £

Catalog number: 431-109325-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C124H188N36O33; MW 2743.17

727 €
825 $
564 £

Catalog number: 431-109325-3
Product Quantity: 10 mg
Category:
Supplier:
Obestatin, rat, mouse Formula C114H174N34O31 Sequence Phe_Asn_Ala_Pro_Phe_Asp_Val_Gly_Ile_Lys_Leu_Ser_Gly_Ala_Gln_Tyr_Gln_Gln_His_Gly_Arg_Ala_Leu_NH2

199 €
225 $
154 £

Catalog number: 55065
Product Quantity: 1mg
Category:
Supplier: GLSChina
Orexin-B, Human [Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 2899.4]

390 €
443 $
302 £

Catalog number: SP-54422-5
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Bak _ BH3 Formula C72H125N25O24 Sequence Gly_Gln_Val_Gly_Arg_Gln_Leu_Ala_Ile_Ile_Gly_Asp_Asp_Ile_Asn_Arg

162 €
184 $
126 £

Catalog number: 53294
Product Quantity: 1mg
Category:
Supplier: GLSChina
GRF (free acid) (human) (AA:Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-

557 €
632 $
432 £

Catalog number: SP-89088-1
Product Quantity: 1 mg
Category:
Supplier: ADI
GHRF, Ovine [H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MW:

371 €
421 $
288 £

Catalog number: SP-55421-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Biotin_[Tyr0]_Orexin B, mouse,rat Formula C145H238N48O38S2 Sequence Biotin_Tyr_Arg_Pro_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Asn_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

241 €
274 $
187 £

Catalog number: 101128
Product Quantity: 1mg
Category:
Supplier: GLSChina
á_Conotoxin GS Formula C139H232N52O47S7 Sequence Ala_Cys_Ser_Gly_Arg_Gly_Ser_Arg_Cys_Hyp_Hyp_Gln_Cys_Cys_Met_Gly_Leu_Arg_Cys_Gly_Arg_Gly_Asn_Pro_Gln_Lys_Cys_Ile_Gly_Ala_His_Gla_Asp_Val

184 €
208 $
142 £

Catalog number: 103042
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val; MF C139H232N52O47S7; MW 3624.11

679 €
771 $
527 £

Catalog number: 431-111930-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val; MF C139H232N52O47S7; MW 3624.11

475 €
539 $
368 £

Catalog number: 431-111930-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val; MF C139H232N52O47S7; MW 3624.11

274 €
312 $
213 £

Catalog number: 431-111930-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg; MF C72H125N25O24; MW 1724.95

257 €
292 $
200 £

Catalog number: 431-62182-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg; MF C72H125N25O24; MW 1724.95

576 €
654 $
447 £

Catalog number: 431-62182-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg; MF C72H125N25O24; MW 1724.95

373 €
423 $
289 £

Catalog number: 431-62182-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2; MF C215H

440 €
500 $
341 £

Catalog number: 431-61145-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2; MF C215H

986 €
1119 $
765 £

Catalog number: 431-61145-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2; MF C215H

1520 €
1725 $
1179 £

Catalog number: 431-61145-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Arg-Val-Arg-Leu-NH2; MF C219H

1520 €
1725 $
1179 £

Catalog number: 431-97977-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Arg-Val-Arg-Leu-NH2; MF C219H

440 €
500 $
341 £

Catalog number: 431-97977-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Arg-Val-Arg-Leu-NH2; MF C219H

986 €
1119 $
765 £

Catalog number: 431-97977-2
Product Quantity: 5 mg
Category:
Supplier:
α-Conotoxin GS (AA: Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val) (MW: 3624.11)

223 €
253 $
173 £

Catalog number: SP-103042-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Bak - BH3 (AA: Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg) (MW: 1724.95)

223 €
253 $
173 £

Catalog number: SP-53294-1
Product Quantity: 1 mg
Category:
Supplier: ADI
BNP_45 ,rat Formula C213H349N71O65S3 Sequence Ser_Gln_Asp_Ser_Ala_Phe_Arg_Ile_Gln_Glu_Arg_Leu_Arg_Asn_Ser_Lys_Met_Ala_His_Ser_Ser_Ser_Cys_Phe_Gly_Gln_Lys_Ile_Asp_Arg_Ile_Gly_Ala_Val_Ser_Arg_Leu_Gly_

272 €
309 $
211 £

Catalog number: 89386
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Biotin-[Tyr0]-Orexin B, mouse, rat (AA: Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2) (MW: 3325.9)

390 €
443 $
302 £

Catalog number: SP-101128-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg- Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C126H215N45O34S; MW 2936.46

373 €
423 $
289 £

Catalog number: 431-64122-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg- Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C126H215N45O34S; MW 2936.46

307 €
348 $
238 £

Catalog number: 431-64122-1
Product Quantity: 500
Category:
Supplier:
Orexin B, Rat, Mouse [H-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 2936.46]

318 €
361 $
247 £

Catalog number: SP-55234-5
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg- Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C126H215N45O34S; MW 2936.46

576 €
654 $
447 £

Catalog number: 431-64122-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu; MF C215H357N

970 €
1101 $
752 £

Catalog number: 431-97976-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu; MF C215H357N

440 €
500 $
341 £

Catalog number: 431-97976-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu; MF C215H357N

1520 €
1725 $
1179 £

Catalog number: 431-97976-3
Product Quantity: 10 mg
Category:
Supplier:
GRF, porcine (AA: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Arg-Val-Arg-Leu-NH2) (

557 €
632 $
432 £

Catalog number: SP-89089-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala; MF C194H317N61O63S; MW 4544

407 €
462 $
316 £

Catalog number: 431-97036-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-NH2; MF C194H318N62O62S; MW

1407 €
1596 $
1091 £

Catalog number: 431-97035-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-NH2; MF C194H318N62O62S; MW

407 €
462 $
316 £

Catalog number: 431-97035-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala; MF C194H317N61O63S; MW 4544

1407 €
1596 $
1091 £

Catalog number: 431-97036-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala; MF C194H317N61O63S; MW 4544

954 €
1083 $
740 £

Catalog number: 431-97036-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-NH2; MF C194H318N62O62S; MW

954 €
1083 $
740 £

Catalog number: 431-97035-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-Gly-His-Cys-NH2; MF C194H338N63O54S1;

1471 €
1669 $
1141 £

Catalog number: 431-64305-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-Gly-His-Cys-NH2; MF C194H338N63O54S1;

440 €
500 $
341 £

Catalog number: 431-64305-1
Product Quantity: 1mg
Category:
Supplier:
Urocortin II, Human [H-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-Gly-His-Cys-NH2; MW: 4449

531 €
603 $
412 £

Catalog number: SP-55417-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-Gly-His-Cys-NH2; MF C194H338N63O54S1;

970 €
1101 $
752 £

Catalog number: 431-64305-2
Product Quantity: 5 mg
Category:
Supplier:
GHRF (1_44), human (AA Tyr_Ala_Asp_Ala_Ile_Phe_Thr_Asn_Ser_Tyr_Arg_Lys_Val_ Leu_Gly_Gln_Leu_Ser_Ala_Arg_Lys_Leu_Leu_Gln_Asp_Ile_Met _Ser_Arg_Gln_Gln_Gly_Glu_Ser_Asn_Gln_Glu_Arg_Gly_Ala_ Arg_Ala_Arg_L

616 €
699 $
478 £

Catalog number: SP-52257-1
Product Quantity: 1 mg
Category:
Supplier: Alpha Dia
GHRF, ovine Formula C221H368N72O66S1 Sequence Tyr_Ala_Asp_Ala_Ile_Phe_Thr_Asn_Ser_Tyr_Arg_Lys_Ile_Leu_Gly_Gln_Leu_Ser_Ala_Arg_Lys_Leu_Leu_Gln_Asp_Ile_Met_Asn_Arg_Gln_Gln_Gly_Glu_Arg_Asn_Gln_Glu_Gln_

360 €
409 $
279 £

Catalog number: 55421
Product Quantity: 1mg
Category:
Supplier: GLSChina
Biotin_Obestatin (rat) Formula C124H188N36O33 Sequence Biotin_Phe_Asn_Ala_Pro_Phe_Asp_Val_Gly_Ile_Lys_Leu_Ser_Gly_Ala_Gln_Tyr_Gln_Gln_His_Gly_Arg_Ala_Leu_NH2

193 €
219 $
150 £

Catalog number: 100437
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C220H

986 €
1119 $
765 £

Catalog number: 431-64308-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C220H

440 €
500 $
341 £

Catalog number: 431-64308-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C220H

1520 €
1725 $
1179 £

Catalog number: 431-64308-3
Product Quantity: 10 mg
Category:
Supplier:
Biotin-Obestatin (rat) (AA: Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2) (MW: 2743.17)

306 €
347 $
237 £

Catalog number: SP-100437-1
Product Quantity: 1 mg
Category:
Supplier: ADI
GHRF (1-44), human (AA: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val- Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met -Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala- Arg-Ala-Ar

557 €
632 $
432 £

Catalog number: SP-52257-1
Product Quantity: 1 mg
Category:
Supplier: ADI
PKI_tide Formula C85H149N31O24 Sequence Ile_Ala_Ala_Gly_Arg_Thr_Gly_Arg_Arg_Gln_Ala_Ile_His_Asp_Ile_Leu_Val_Ala_Ala

177 €
201 $
137 £

Catalog number: 101409
Product Quantity: 1mg
Category:
Supplier: GLSChina
GRF, porcine Formula C219H365N73O66S Sequence Tyr_Ala_Asp_Ala_Ile_Phe_Thr_Asn_Ser_Tyr_Arg_Lys_Val_Leu_Gly_Gln_Leu_Ser_Ala_Arg_Lys_Leu_Leu_Gln_Asp_Ile_Met_Ser_Arg_Gln_Gln_Gly_Glu_Arg_Asn_Gln_Glu_Gln_

360 €
409 $
279 £

Catalog number: 89089
Product Quantity: 1mg
Category:
Supplier: GLSChina
GHRF, Bovine [H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MW:

505 €
573 $
391 £

Catalog number: SP-55420-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Lytic Peptide, Shiva_1 Formula C155H269N53O39S Sequence Met_Pro_Arg_Leu_Phe_Arg_Arg_Ile_Asp_Arg_Val_Gly_Lys_Gln_Gly_Ile_Leu_Arg_Ala_Gly_Pro_Ala_Ile_Ala_Leu_Val_Gly_Asp_Ala_Arg_Ala_Val_Gly

289 €
329 $
224 £

Catalog number: 88327
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ile-Ala-Ala-Gly-Arg-Thr-Gly-Arg-Arg-Gln-Ala-Ile-His-Asp-Ile-Leu-Val-Ala-Ala; MF C85H149N31O24; MW 1989.31

662 €
751 $
513 £

Catalog number: 431-110297-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Ile-Ala-Ala-Gly-Arg-Thr-Gly-Arg-Arg-Gln-Ala-Ile-His-Asp-Ile-Leu-Val-Ala-Ala; MF C85H149N31O24; MW 1989.31

440 €
500 $
341 £

Catalog number: 431-110297-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ile-Ala-Ala-Gly-Arg-Thr-Gly-Arg-Arg-Gln-Ala-Ile-His-Asp-Ile-Leu-Val-Ala-Ala; MF C85H149N31O24; MW 1989.31

257 €
292 $
200 £

Catalog number: 431-110297-1
Product Quantity: 1mg
Category:
Supplier:
Prolactin Releasing Peptide (1_31), bovine Formula C157H244N54O41S Sequence Ser_Arg_Ala_His_Gln_His_Ser_Met_Glu_Ile_Arg_Thr_Pro_Asp_Ile_Asn_Pro_Ala_Trp_Tyr_Ala_Gly_Arg_Gly_Ile_Arg_Pro_Val_Gly_Arg_Ph

282 €
320 $
219 £

Catalog number: 101265
Product Quantity: 1mg
Category:
Supplier: GLSChina
Prolactin Releasing Peptide (1-31), bovine (AA: Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2) (MW: 3576.07)

390 €
443 $
302 £

Catalog number: SP-101265-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2; MF C157H244N54O41S; MW 3576.07

355 €
403 $
275 £

Catalog number: 431-110153-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2; MF C157H244N54O41S; MW 3576.07

1116 €
1266 $
865 £

Catalog number: 431-110153-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2; MF C157H244N54O41S; MW 3576.07

775 €
880 $
601 £

Catalog number: 431-110153-2
Product Quantity: 5 mg
Category:
Supplier:
Growth Hormone Releasing Factor, GRF (1 - 40), amide, human (AA: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser

306 €
347 $
237 £

Catalog number: SP-88147-1
Product Quantity: 1 mg
Category:
Supplier: ADI
PKI-tide (AA: Ile-Ala-Ala-Gly-Arg-Thr-Gly-Arg-Arg-Gln-Ala-Ile-His-Asp-Ile-Leu-Val-Ala-Ala) (MW: 1989.31)

223 €
253 $
173 £

Catalog number: SP-101409-1
Product Quantity: 1 mg
Category:
Supplier: ADI
MF C85H149N31O24 ; MW 1989.30 ; IAAGRTGRQAIHDILVAA, Ile-Ala-Ala-Gly-Arg-Thr-Gly-Arg-Arg-Gln-Ala-Ile-His-Asp-Ile-Leu-Val-Ala-Ala

323 €
366 $
250 £

Catalog number: RB-PP-0425
Product Quantity: 1 mg
Category:
Supplier:
Sequence His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Arg-Ser-Arg-Phe-Asn; MF C225H361N77O6

970 €
1101 $
752 £

Catalog number: 431-63306-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Arg-Ser-Arg-Phe-Asn; MF C225H361N77O6

440 €
500 $
341 £

Catalog number: 431-63306-1
Product Quantity: 1mg
Category:
Supplier:
Sequence His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gly-Gln-Leu-Tyr-Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Arg-Ser-Arg-Phe-Asn; MF C225H361N77O6

1520 €
1725 $
1179 £

Catalog number: 431-63306-3
Product Quantity: 10 mg
Category:
Supplier:
GHRF (1_44), human Formula C215H358N72O66S1 Sequence Tyr_Ala_Asp_Ala_Ile_Phe_Thr_Asn_Ser_Tyr_Arg_Lys_Val_Leu_Gly_Gln_Leu_Ser_Ala_Arg_Lys_Leu_Leu_Gln_Asp_Ile_Met_Ser_Arg_Gln_Gln_Gly_Glu_Ser_Asn_Gln_G

360 €
409 $
279 £

Catalog number: 52257
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Arg-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Val-Thr-Ile-Gly-Lys; MF C73H126N26O18; MW 1655.98

373 €
423 $
289 £

Catalog number: 431-65657-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Arg-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Val-Thr-Ile-Gly-Lys; MF C73H126N26O18; MW 1655.98

257 €
292 $
200 £

Catalog number: 431-65657-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Val-Thr-Ile-Gly-Lys; MF C73H126N26O18; MW 1655.98

543 €
616 $
421 £

Catalog number: 431-65657-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Trp-Pro-Gln-Ala-Pro-Ala-Met-Asp-Gly-Ala-Gly-Lys-Thr-Gly-Ala-Glu-Glu-Ala-Gln-Pro-Pro-Glu-Gly-Lys-Gly-Ala-Arg-Glu-His-Ser-Arg-Gln-Glu-Glu-Glu-Glu-Glu-Thr-Ala-Gly-Ala-Pro-Gln-Gly-Leu-Phe-Ar

1341 €
1522 $
1040 £

Catalog number: 431-61180-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Gly-Trp-Pro-Gln-Ala-Pro-Ala-Met-Asp-Gly-Ala-Gly-Lys-Thr-Gly-Ala-Glu-Glu-Ala-Gln-Pro-Pro-Glu-Gly-Lys-Gly-Ala-Arg-Glu-His-Ser-Arg-Gln-Glu-Glu-Glu-Glu-Glu-Thr-Ala-Gly-Ala-Pro-Gln-Gly-Leu-Phe-Ar

594 €
675 $
461 £

Catalog number: 431-61180-1
Product Quantity: 500
Category:
Supplier:
Sequence Gly-Trp-Pro-Gln-Ala-Pro-Ala-Met-Asp-Gly-Ala-Gly-Lys-Thr-Gly-Ala-Glu-Glu-Ala-Gln-Pro-Pro-Glu-Gly-Lys-Gly-Ala-Arg-Glu-His-Ser-Arg-Gln-Glu-Glu-Glu-Glu-Glu-Thr-Ala-Gly-Ala-Pro-Gln-Gly-Leu-Phe-Ar

921 €
1045 $
714 £

Catalog number: 431-61180-2
Product Quantity: 1mg
Category:
Supplier:
Stresscopin_Related Peptide,human Formula C205H358N68O57 Sequence His_Pro_Gly_Ser_Arg_Ile_Val_Leu_Ser_Leu_Asp_Val_Pro_Ile_Gly_Leu_Leu_Gln_Ile_Leu_Leu_Glu_Gln_Ala_Arg_Ala_Arg_Ala_Ala_Arg_Glu_Gln_Ala_

354 €
401 $
274 £

Catalog number: 55419
Product Quantity: 1mg
Category:
Supplier: GLSChina
[Tyr0]-Stresscopin-Related Peptide (human) [Tyr-His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-

557 €
632 $
432 £

Catalog number: SP-89719-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Bid BH3 _ r9 Formula C151H272N70O42S Sequence Arg_Arg_Arg_Arg_Arg_Arg_Arg_Arg_Arg_Gly_Glu_Asp_Ile_Ile_Arg_Asn_Ile_Ala_Arg_His_Leu_Ala_Gln_Val_Gly_Asp_Ser_Met_Asp_Arg

225 €
256 $
175 £

Catalog number: 88267
Product Quantity: 1mg
Category:
Supplier: GLSChina
Urocortin II, mouse Formula C187H320N56O50 Sequence Val_Ile_Leu_Ser_Leu_Asp_Val_Pro_Ile_Gly_Leu_Leu_Arg_Ile_Leu_Leu_Glu_Gln_Ala_Arg_Tyr_Lys_Ala_Ala_Arg_Asn_Gln_Ala_Ala_Thr_Asn_Ala_Gln_Ile_Leu_Ala_Hi

324 €
367 $
251 £

Catalog number: 55406
Product Quantity: 1mg
Category:
Supplier: GLSChina
Bid BH3 _ r8 Formula C145H260N66O41S Sequence D_Arg_D_Arg_D_Arg_D_Arg_D_Arg_D_Arg_D_Arg_D_Arg_Gly_Glu_Asp_Ile_Ile_Arg_Asn_Ile_Ala_Arg_His_Leu_Ala_Gln_Val_Gly_Asp_Ser_Met_Asp_Arg

254 €
289 $
197 £

Catalog number: 88266
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Met-Pro-Arg-Leu-Phe-Arg-Arg-Ile-Asp-Arg-Val-Gly-Lys-Gln-Gly-Ile-Leu-Arg-Ala-Gly-Pro-Ala-Ile-Ala-Leu-Val-Gly-Asp-Ala-Arg-Ala-Val-Gly; MF C155H269N53O39S; MW 3531.27

355 €
403 $
275 £

Catalog number: 431-97215-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Met-Pro-Arg-Leu-Phe-Arg-Arg-Ile-Asp-Arg-Val-Gly-Lys-Gln-Gly-Ile-Leu-Arg-Ala-Gly-Pro-Ala-Ile-Ala-Leu-Val-Gly-Asp-Ala-Arg-Ala-Val-Gly; MF C155H269N53O39S; MW 3531.27

1116 €
1266 $
865 £

Catalog number: 431-97215-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Met-Pro-Arg-Leu-Phe-Arg-Arg-Ile-Asp-Arg-Val-Gly-Lys-Gln-Gly-Ile-Leu-Arg-Ala-Gly-Pro-Ala-Ile-Ala-Leu-Val-Gly-Asp-Ala-Arg-Ala-Val-Gly; MF C155H269N53O39S; MW 3531.27

775 €
880 $
601 £

Catalog number: 431-97215-2
Product Quantity: 5 mg
Category:
Supplier:
Lytic Peptide, Shiva – 1 (AA: Met-Pro-Arg-Leu-Phe-Arg-Arg-Ile-Asp-Arg-Val-Gly-Lys-Gln-Gly-Ile-Leu-Arg-Ala-Gly-Pro-Ala-Ile-Ala-Leu-Val-Gly-Asp-Ala-Arg-Ala-Val-Gly) (MW: 3531.27)

472 €
536 $
366 £

Catalog number: SP-88327-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Gly-Glu-Asp-Ile-Ile-Arg-Asn-Ile-Ala-Arg-His-Leu-Ala-Gln-Val-Gly-Asp-Ser-Met-Asp-Arg; MF C151H272N70O42S; MW 3772.36

613 €
695 $
475 £

Catalog number: 431-97155-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Gly-Glu-Asp-Ile-Ile-Arg-Asn-Ile-Ala-Arg-His-Leu-Ala-Gln-Val-Gly-Asp-Ser-Met-Asp-Arg; MF C151H272N70O42S; MW 3772.36

921 €
1045 $
714 £

Catalog number: 431-97155-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Gly-Glu-Asp-Ile-Ile-Arg-Asn-Ile-Ala-Arg-His-Leu-Ala-Gln-Val-Gly-Asp-Ser-Met-Asp-Arg; MF C151H272N70O42S; MW 3772.36

323 €
366 $
250 £

Catalog number: 431-97155-1
Product Quantity: 1mg
Category:
Supplier:
Pancreastatin, porcine Formula C214H330N68O76S Sequence Gly_Trp_Pro_Gln_Ala_Pro_Ala_Met_Asp_Gly_Ala_Gly_Lys_Thr_Gly_Ala_Glu_Glu_Ala_Gln_Pro_Pro_Glu_Gly_Lys_Gly_Ala_Arg_Glu_His_Ser_Arg_Gln_Glu_Glu_Gl

479 €
544 $
371 £

Catalog number: 52292
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
HIV_gp120_ Fragment (308_331) Formula C114H199N41O31 Sequence Asn_Asn_Thr_Arg_Lys_Ser_Ile_Arg_Ile_Gln_Arg_Gly_Pro_Gly_Arg_Ala_Phe_Val_Thr_Ile_Gly_Lys_Ile_Gly

199 €
225 $
154 £

Catalog number: 89134
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2; MF C214H

986 €
1119 $
765 £

Catalog number: 431-98607-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2; MF C214H

1520 €
1725 $
1179 £

Catalog number: 431-98607-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2; MF C214H

440 €
500 $
341 £

Catalog number: 431-98607-1
Product Quantity: 1mg
Category:
Supplier:
Stresscopin-Related Peptide (free acid) (human) (AA: His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala

557 €
632 $
432 £

Catalog number: SP-89709-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-Glu-Asp-Ile-Ile-Arg-Asn-Ile-Ala-Arg- His-Leu-Ala-Gln-Val-Gly-Asp-Ser-Met-Asp-Arg; MF C145H260N66O41S; MW 3616.17

339 €
384 $
263 £

Catalog number: 431-97154-1
Product Quantity: 1mg
Category:
Supplier:
Sequence D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-Glu-Asp-Ile-Ile-Arg-Asn-Ile-Ala-Arg- His-Leu-Ala-Gln-Val-Gly-Asp-Ser-Met-Asp-Arg; MF C145H260N66O41S; MW 3616.17

695 €
789 $
539 £

Catalog number: 431-97154-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-Glu-Asp-Ile-Ile-Arg-Asn-Ile-Ala-Arg- His-Leu-Ala-Gln-Val-Gly-Asp-Ser-Met-Asp-Arg; MF C145H260N66O41S; MW 3616.17

986 €
1119 $
765 £

Catalog number: 431-97154-3
Product Quantity: 10 mg
Category:
Supplier:
Bid BH3 - r9 (AA:Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Arg-Gly-Glu-Asp-Ile-Ile-Arg-Asn-Ile-Ala-Arg-His-Leu-Ala-Gln-Val-Gly-Asp-Ser-Met-Asp-Arg) (MW: 3772.36)

306 €
347 $
237 £

Catalog number: SP-88267-1
Product Quantity: 1 mg
Category:
Supplier: ADI
HIV-gp120- Fragment (308-331) (AA: Asn-Asn-Thr-Arg-Lys-Ser-Ile-Arg-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Val-Thr-Ile-Gly-Lys-Ile-Gly) (MW: 2640.11)

306 €
347 $
237 £

Catalog number: SP-89134-1
Product Quantity: 1 mg
Category:
Supplier: ADI
GRF (free acid) (human) Formula C215H357N71O67S Sequence Tyr_Ala_Asp_Ala_Ile_Phe_Thr_Asn_Ser_Tyr_Arg_Lys_Val_Leu_Gly_Gln_Leu_Ser_Ala_Arg_Lys_Leu_Leu_Gln_Asp_Ile_Met_Ser_Arg_Gln_Gln_Gly_Glu_Ser_Asn_G

354 €
401 $
274 £

Catalog number: 89088
Product Quantity: 1mg
Category:
Supplier: GLSChina
Atrial Natriuretic Peptide (4_24),frog Formula C93H152N34O27S3 Sequence Cys_Phe_Gly_Ser_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Met_Gly_Cys_Gly_Arg_Arg_Phe(Disulfide bridge Cys1_Cys17)

199 €
225 $
154 £

Catalog number: 101107
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2; MF C187H320N56O50; MW 4152.98

954 €
1083 $
740 £

Catalog number: 431-64294-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2; MF C187H320N56O50; MW 4152.98

407 €
462 $
316 £

Catalog number: 431-64294-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2; MF C187H320N56O50; MW 4152.98

1341 €
1522 $
1040 £

Catalog number: 431-64294-3
Product Quantity: 10 mg
Category:
Supplier:
Bid BH3 - r8 (AA: D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-D-Arg-Gly-Glu-Asp-Ile-Ile-Arg-Asn-Ile-Ala-Arg- His-Leu-Ala-Gln-Val-Gly-Asp-Ser-Met-Asp-Arg) (MW:3616.17)

223 €
253 $
173 £

Catalog number: SP-88266-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Atrial Natriuretic Peptide (4-24), frog (AA: Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Arg-Phe (Disulfide bridge: Cys1-Cys17)) (MW: 2273.64)

390 €
443 $
302 £

Catalog number: SP-101107-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Intermedin (human) Formula C219H351N69O66S3 Sequence Thr_Gln_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Met_Gly_Pro_Ala_Gly_Arg_Gln_Asp_Ser_A

378 €
429 $
293 £

Catalog number: 54832
Product Quantity: 1mg
Category:
Supplier: GLSChina
Stresscopin-Related Peptide, Human [H-His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Al

398 €
451 $
308 £

Catalog number: SP-55419-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
[Tyr0]_Stresscopin_Related Peptide (human) Formula C214H367N69O59 Sequence Tyr_His_Pro_Gly_Ser_Arg_Ile_Val_Leu_Ser_Leu_Asp_Val_Pro_Ile_Gly_Leu_Leu_Gln_Ile_Leu_Leu_Glu_Gln_Ala_Arg_Ala_Arg_Ala_Ala_Arg

360 €
409 $
279 £

Catalog number: 89719
Product Quantity: 1mg
Category:
Supplier: GLSChina
Growth Hormone Releasing Factor, GRF, (1 - 40), human (AA: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-G

557 €
632 $
432 £

Catalog number: SP-88148-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Defensin-1 (human) HNP-1 (AA: Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridges Cys2-Cys30, Cys4-Cys19, and C

724 €
822 $
561 £

Catalog number: SP-100512-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2; MF C205H358N

1520 €
1725 $
1179 £

Catalog number: 431-64307-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2; MF C205H358N

970 €
1101 $
752 £

Catalog number: 431-64307-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2; MF C205H358N

440 €
500 $
341 £

Catalog number: 431-64307-1
Product Quantity: 1mg
Category:
Supplier:
Urocortrin II, Mouse [H-Val-Ile-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Arg-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Tyr-Lys-Ala-Ala-Arg-Asn-Gln-Ala-Ala-Thr-Asn-Ala-Gln-Ile-Leu-Ala-His-Val-NH2; MW: 4152.98]

531 €
603 $
412 £

Catalog number: SP-55406-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Defensin_1 (human) HNP_1 Formula C150H222N44O38S6 Sequence Ala_Cys_Tyr_Cys_Arg_Ile_Pro_Ala_Cys_Ile_Ala_Gly_Glu_Arg_Arg_Tyr_Gly_Thr_Cys_Ile_Tyr_Gln_Gly_Arg_Leu_Trp_Ala_Phe_Cys_Cys(Disulfide bridges C

411 €
467 $
319 £

Catalog number: 100512
Product Quantity: 1mg
Category:
Supplier: GLSChina
HIV-1 env Protein gp120 (278-292) (strains BH10, BH8, HXB2, HXB3, PV22) (AA: Arg-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Val-Thr-Ile-Gly-Lys) (MW: 1655.98)

223 €
253 $
173 £

Catalog number: SP-56769-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Asn-Asn-Thr-Arg-Lys-Ser-Ile-Arg-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Val-Thr-Ile-Gly-Lys-Ile-Gly; MF C114H199N41O31; MW 2640.11

727 €
825 $
564 £

Catalog number: 431-98022-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Asn-Asn-Thr-Arg-Lys-Ser-Ile-Arg-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Val-Thr-Ile-Gly-Lys-Ile-Gly; MF C114H199N41O31; MW 2640.11

307 €
348 $
238 £

Catalog number: 431-98022-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Asn-Asn-Thr-Arg-Lys-Ser-Ile-Arg-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Val-Thr-Ile-Gly-Lys-Ile-Gly; MF C114H199N41O31; MW 2640.11

509 €
578 $
395 £

Catalog number: 431-98022-2
Product Quantity: 5 mg
Category:
Supplier:
[CysCys21] Atrial Natriuretic Factor (3-28), Rat [Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys7-Cys23 ); MW: 2862.20]

390 €
443 $
302 £

Catalog number: SP-101754-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Urocortin II, human Formula C194H338N63O54S1 Sequence Ile_Val_Leu_Ser_Leu_Asp_Val_Pro_Ile_Gly_Leu_Leu_Gln_Ile_Leu_Leu_Glu_Gln_Ala_Arg_Ala_Arg_Ala_Ala_Arg_Glu_Gln_Ala_Thr_Thr_Asn_Ala_Arg_Ile_Leu_Ala_

342 €
388 $
265 £

Catalog number: 55417
Product Quantity: 1mg
Category:
Supplier: GLSChina
Stresscopin_Related Peptide (free acid) (human) Formula C205H357N67O58 Sequence His_Pro_Gly_Ser_Arg_Ile_Val_Leu_Ser_Leu_Asp_Val_Pro_Ile_Gly_Leu_Leu_Gln_Ile_Leu_Leu_Glu_Gln_Ala_Arg_Ala_Arg_Ala_Ala_Ar

348 €
395 $
270 £

Catalog number: 89709
Product Quantity: 1mg
Category:
Supplier: GLSChina
[CysCys21] Atrial Natriuretic Factor (3_28), Rat Formula C119H189N43O36S2 Sequence Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr (Disulfide

180 €
205 $
140 £

Catalog number: 101754
Product Quantity: 1mg
Category:
Supplier: GLSChina
Proinsulin C _ Peptide (31 _63), porcine Formula C142H239N47O46 Sequence Arg_Arg_Glu_Ala_Glu_Asn_Pro_Gln_Ala_Gly_Ala_Val_Glu_Leu_Gly_Gly_Gly_Leu_Gly_Gly_Leu_Gln_Ala_Leu_Ala_Leu_Glu_Gly_Pro_Pro_Gln_L

289 €
329 $
224 £

Catalog number: 88238
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe

857 €
972 $
664 £

Catalog number: 431-98274-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe

355 €
403 $
275 £

Catalog number: 431-98274-1
Product Quantity: 500
Category:
Supplier:
Sequence Ser-Gln-Asp-Ser-Ala-Phe-Arg-Ile-Gln-Glu-Arg-Leu-Arg-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe

509 €
578 $
395 £

Catalog number: 431-98274-2
Product Quantity: 1mg
Category:
Supplier:
MF C114H199N41O31 ; MW 2640.07 ; NNTRKSIRIQRGPGRAFVTIGKIG, Asn-Asn-Thr-Arg-Lys-Ser-Ile-Arg-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Val-Thr-Ile-Gly-Lys-Ile-Gly

339 €
384 $
263 £

Catalog number: RB-PP-0793
Product Quantity: 1 mg
Category:
Supplier:
Defensin (human) HNP-2 (AA: Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys (Disulfide bridge: Cys1- Cys29, Cys3- Cys18, Cys8- Cys2

1058 €
1201 $
820 £

Catalog number: SP-88393-1
Product Quantity: 1 mg
Category:
Supplier: ADI
HIV_1 env Protein gp120 (278_292) (strains BH10, BH8,HXB2, HXB3, PV22) Formula C73H126N26O18 Sequence Arg_Ile_Gln_Arg_Gly_Pro_Gly_Arg_Ala_Phe_Val_Thr_Ile_Gly_Lys

159 €
180 $
123 £

Catalog number: 56769
Product Quantity: 1mg
Category:
Supplier: GLSChina
Pancreastatin, Porcine [Gly-Trp-Pro-Gln-Ala-Pro-Ala-Met-Asp-Gly-Ala-Gly-Lys-ThrGly-Ala-Glu-Glu-Ala-Gln-Pro-Pro-Glu-Gly-Lys-Gly-Ala-Arg-Glu-His-Ser-Arg-Gln-Glu-Glu-Glu-Glu-Glu-THr-Ala-Gl-Ala-Pro-Gln-Gl

865 €
982 $
671 £

Catalog number: SP-52292-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Adrenomedullin (1_ 52),porcine Formula C262H403N79O76S3 Sequence Tyr_Arg_Gln_Ser_Met_Asn_Asn_Phe_Gln_Gly_Leu_Arg_Ser_Phe_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Val_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_T

433 €
491 $
336 £

Catalog number: 100825
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C162H268N50O54; MW 3780.24

339 €
384 $
263 £

Catalog number: 431-98433-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C162H268N50O54; MW 3780.24

695 €
789 $
539 £

Catalog number: 431-98433-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C162H268N50O54; MW 3780.24

986 €
1119 $
765 £

Catalog number: 431-98433-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg; MF C142H239N47O46; MW 3340.78

1116 €
1266 $
865 £

Catalog number: 431-97126-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg; MF C142H239N47O46; MW 3340.78

355 €
403 $
275 £

Catalog number: 431-97126-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg; MF C142H239N47O46; MW 3340.78

775 €
880 $
601 £

Catalog number: 431-97126-2
Product Quantity: 5 mg
Category:
Supplier:
Proinsulin C - Peptide (31 - 63), porcine (AA: Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg) (MW: 3340.78)

472 €
536 $
366 £

Catalog number: SP-88238-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Defensin (human) HNP_2 Formula C147H217N43O37S6 Sequence Cys_Tyr_Cys_Arg_Ile_Pro_Ala_Cys_Ile_Ala_Gly_Glu_Arg_Arg_Tyr_Gly_Thr_Cys_Ile_Tyr_Gln_Gly_Arg_Leu_Trp_Ala_Phe_Cys_Cys(Disulfide bridge 1_29, 3

729 €
828 $
566 £

Catalog number: 88393
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2; MF C183H324N58O51; MW 4152.98

1341 €
1522 $
1040 £

Catalog number: 431-98606-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2; MF C183H324N58O51; MW 4152.98

407 €
462 $
316 £

Catalog number: 431-98606-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-NH2; MF C183H324N58O51; MW 4152.98

954 €
1083 $
740 £

Catalog number: 431-98606-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val; MF C205H357N67O5

970 €
1101 $
752 £

Catalog number: 431-98597-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val; MF C205H357N67O5

440 €
500 $
341 £

Catalog number: 431-98597-1
Product Quantity: 1mg
Category:
Supplier:
Sequence His-Pro-Gly-Ser-Arg-Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val; MF C205H357N67O5

1471 €
1669 $
1141 £

Catalog number: 431-98597-3
Product Quantity: 10 mg
Category:
Supplier:
Atrial Natriuretic Peptide (126-150) (rat) (AA: Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge: Cys4-Cys20)) (MW: 2706.04)

390 €
443 $
302 £

Catalog number: SP-55277-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Atrial Natriuretic Peptide (126_150) (rat) Formula C113H177N39O35S2 Sequence Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr (Disulfide bridge Cy

240 €
273 $
186 £

Catalog number: 55277
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Melittin(Mellitin) Formula C131H229N39O31 Sequence Gly_Ile_Gly_Ala_Val_Leu_Lys_Val_Leu_Thr_Thr_Gly_Leu_Pro_Ala_Leu_Ile_Ser_Trp_Ile_Lys_Arg_Lys_Arg_Gln_Gln_NH2

212 €
241 $
165 £

Catalog number: 52272
Product Quantity: 1mg
Category:
Supplier: GLSChina
Biotin_Intermedin (human) Formula C229H353N71O68S4 Sequence Biotin_Thr_Gln_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Met_Gly_Pro_Ala_Gly_Arg

257 €
292 $
200 £

Catalog number: 89205
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys4-Cys20); MF C113H177N39O35S2; MW 2706.04

662 €
751 $
513 £

Catalog number: 431-64165-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys4-Cys20); MF C113H177N39O35S2; MW 2706.04

323 €
366 $
250 £

Catalog number: 431-64165-1
Product Quantity: 500
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys4-Cys20); MF C113H177N39O35S2; MW 2706.04

440 €
500 $
341 £

Catalog number: 431-64165-2
Product Quantity: 1mg
Category:
Supplier:
Atrial Natriuretic Peptide (126_149) (rat) Formula C104H168N38O33S2 Sequence Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg

240 €
273 $
186 £

Catalog number: 55276
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Fibrinogen Related Peptide Formula C62H99N23O21 Sequence Gly_Gln_Gln_His_His_Leu_Gly_Gly_Ala_Lys_Gln_Ala_Gly_Asp_Val

158 €
179 $
122 £

Catalog number: 88463
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys4-Cys20); MF C104H168N38O33S2; MW 2542.86

323 €
366 $
250 £

Catalog number: 431-64164-1
Product Quantity: 500
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys4-Cys20); MF C104H168N38O33S2; MW 2542.86

662 €
751 $
513 £

Catalog number: 431-64164-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys4-Cys20); MF C104H168N38O33S2; MW 2542.86

440 €
500 $
341 £

Catalog number: 431-64164-2
Product Quantity: 1mg
Category:
Supplier:
Stresscopin-Related Peptide (6-43) (human) (AA: Ile-Val-Leu-Ser-Leu-Asp-Val-Pro-Ile-Gly-Leu-Leu-Gln-Ile-Leu-Leu-Glu-Gln-Ala-Arg-Ala-Arg-Ala-Ala-Arg-Glu-Gln-Ala-Thr-Thr-Asn-Ala-Arg-Ile-Leu-Ala-Arg-Val-

557 €
632 $
432 £

Catalog number: SP-89718-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-Trp-Ile-Lys-Arg-Lys-Arg-Gln-Gln-NH2; MF C131H229N39O31; MW 2846.5

857 €
972 $
664 £

Catalog number: 431-61160-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-Trp-Ile-Lys-Arg-Lys-Arg-Gln-Gln-NH2; MF C131H229N39O31; MW 2846.5

307 €
348 $
238 £

Catalog number: 431-61160-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-Trp-Ile-Lys-Arg-Lys-Arg-Gln-Gln-NH2; MF C131H229N39O31; MW 2846.5

576 €
654 $
447 £

Catalog number: 431-61160-2
Product Quantity: 5 mg
Category:
Supplier:
Atriopeptin I (rat) Formula C83H135N29O30S2 Sequence Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser(Disulfide bridge Cys3_Cys19)

202 €
229 $
156 £

Catalog number: 55273
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser(Disulfide bridge Cys3-Cys19); MF C83H135N29O30S2; MW 2083.31

543 €
616 $
421 £

Catalog number: 431-64161-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser(Disulfide bridge Cys3-Cys19); MF C83H135N29O30S2; MW 2083.31

355 €
403 $
275 £

Catalog number: 431-64161-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser(Disulfide bridge Cys3-Cys19); MF C83H135N29O30S2; MW 2083.31

307 €
348 $
238 £

Catalog number: 431-64161-1
Product Quantity: 500
Category:
Supplier:
Adrenomedullin (1_50), rat Formula C248H381N77O75S5 Sequence Tyr_Arg_Gln_Ser_Met_Asn_Gln_Gly_Ser_Arg_Ser_Thr_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Met_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr_Asp_Lys_A

433 €
491 $
336 £

Catalog number: 100046
Product Quantity: 1mg
Category:
Supplier: GLSChina
Adrenomedullin (1_52), human Formula C264H406N80O77S3 Sequence Tyr_Arg_Gln_Ser_Met_Asn_Asn_Phe_Gln_Gly_Leu_Arg_Ser_Phe_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Val_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr

433 €
491 $
336 £

Catalog number: 55426
Product Quantity: 1mg
Category:
Supplier: GLSChina
Stresscopin_Related Peptide (6_43) (human) Formula C183H324N58O51 Sequence Ile_Val_Leu_Ser_Leu_Asp_Val_Pro_Ile_Gly_Leu_Leu_Gln_Ile_Leu_Leu_Glu_Gln_Ala_Arg_Ala_Arg_Ala_Ala_Arg_Glu_Gln_Ala_Thr_Thr_Asn

324 €
367 $
251 £

Catalog number: 89718
Product Quantity: 1mg
Category:
Supplier: GLSChina
Mastoparan [Gly-Ile-Gly-Ala-Val-Leu-Lys-Val-Leu-Thr-Thr-Gly-Leu-Pro-Ala-Leu-Ile-Ser-Trp-Ile-Arg-Lys-Arg-Gln-Gln-NH2; MW 2846.5]

318 €
361 $
247 £

Catalog number: SP-52272-5
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C153H259N49O52; MW 3617.07

857 €
972 $
664 £

Catalog number: 431-97127-2
Product Quantity: 5 mg
Category:
Supplier:
Proinsulin C - peptide (55 - 89), human (AA: Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg) (MW: 3617.07)

390 €
443 $
302 £

Catalog number: SP-88239-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C153H259N49O52; MW 3617.07

1148 €
1303 $
890 £

Catalog number: 431-97127-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C153H259N49O52; MW 3617.07

373 €
423 $
289 £

Catalog number: 431-97127-1
Product Quantity: 1mg
Category:
Supplier:
Intermedin-53(human)(AA:His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-

724 €
822 $
561 £

Catalog number: SP-89208-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Ser-Ser-Cys-Tyr-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

307 €
348 $
238 £

Catalog number: 431-109997-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Ser-Cys-Tyr-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

576 €
654 $
447 £

Catalog number: 431-109997-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ser-Ser-Cys-Tyr-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

775 €
880 $
601 £

Catalog number: 431-109997-3
Product Quantity: 10 mg
Category:
Supplier:
Atrial Natriuretic Peptide Substrate, [pS6] ANF 1-28 (AA: Ser-Leu-Arg-Arg-Ser-pSer-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys7-Cys23

390 €
443 $
302 £

Catalog number: SP-101376-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Urodilatin CCC ANP-95-126 [Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (Disfulide brdige Cys11-Cys27); MW: 356]

665 €
755 $
516 £

Catalog number: SP-52313-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Atriopeptin III (rat) Formula C107H165N35O34S2 Sequence Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr(Disulfide bridge Cys3_Cys19)

240 €
273 $
186 £

Catalog number: 55275
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Atriopeptin II (rat, rabbit,mouse) Formula C98H156N34O32S2 Sequence Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg(Disulfide bridge Cys3_Cys18)

253 €
287 $
196 £

Catalog number: 55274
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
[Tyr0]_Atriopeptin II (rat) Formula C107H165N35O34S2 Sequence Tyr_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg (Disulfide bridge Cys4_Cys20 )

203 €
230 $
157 £

Catalog number: 100529
Product Quantity: 1mg
Category:
Supplier: GLSChina
MF C142H239N47O46 ; MW 3340.72; RREAENPQAGAVELGGGLGGLQALALEGPPQKR, Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg

509 €
578 $
395 £

Catalog number: RB-PP-1297
Product Quantity: 1 mg
Category:
Supplier:
Urodilatin CCC_ANP_95_126 Formula C145H234N52O44S3 Sequence Thr_Ala_Pro_Arg_Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr(Disulfide

383 €
434 $
297 £

Catalog number: 52313
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Gly-Gln-Gln-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val; MF C62H99N23O21; MW 1502.62

355 €
403 $
275 £

Catalog number: 431-97351-2
Product Quantity: 5 mg
Category:
Supplier:
Fibrinogen Related Peptide (AA: Gly-Gln-Gln-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val) (MW: 1502.62)

223 €
253 $
173 £

Catalog number: SP-88463-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Gly-Gln-Gln-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val; MF C62H99N23O21; MW 1502.62

257 €
292 $
200 £

Catalog number: 431-97351-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Gln-Gln-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val; MF C62H99N23O21; MW 1502.62

543 €
616 $
421 £

Catalog number: 431-97351-3
Product Quantity: 10 mg
Category:
Supplier:
[Tyr0]-Atriopeptin II (rat) [Tyr-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg (Disulfide bridge:Cys4-Cys20 ); MW 2549.9]

306 €
347 $
237 £

Catalog number: SP-100529-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys3-Cys19); MF C107H165N35O34S2; MW 2549.85

440 €
500 $
341 £

Catalog number: 431-64163-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys3-Cys19); MF C107H165N35O34S2; MW 2549.85

323 €
366 $
250 £

Catalog number: 431-64163-1
Product Quantity: 500
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys3-Cys19); MF C107H165N35O34S2; MW 2549.85

662 €
751 $
513 £

Catalog number: 431-64163-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-pSer-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H206N45PO42S2; MW 3143.5

679 €
771 $
527 £

Catalog number: 431-110264-3
Product Quantity: 2.5 mg
Category:
Supplier:
Atrial Natriuretic Peptide Substrate, [pS6] ANF 1 – 28 Formula C128H206N49O38S2P Sequence Ser_Leu_Arg_Arg_Ser_pSer_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg

247 €
280 $
191 £

Catalog number: 101376
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Ser-Leu-Arg-Arg-Ser-pSer-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H206N45PO42S2; MW 3143.5

339 €
384 $
263 £

Catalog number: 431-110264-1
Product Quantity: 500
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-pSer-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H206N45PO42S2; MW 3143.5

440 €
500 $
341 £

Catalog number: 431-110264-2
Product Quantity: 1mg
Category:
Supplier:
CAP _ 18, rabbit Formula C202H356N64O47 Sequence Gly_Leu_Arg_Lys_Arg_Leu_Arg_Lys_Phe_Arg_Asn_Lys_Ile_Lys_Glu_Lys_Leu_Lys_Lys_Ile_Gly_Gln_Lys_Ile_Gln_Gly_Leu_Leu_Pro_Lys_Leu_Ala_Pro_Arg_Thr_Asp_Tyr

315 €
358 $
244 £

Catalog number: 88322
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys3-Cys18); MF C98H156N34O32S2; MW 2386.67

339 €
384 $
263 £

Catalog number: 431-64162-1
Product Quantity: 500
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys3-Cys18); MF C98H156N34O32S2; MW 2386.67

475 €
539 $
368 £

Catalog number: 431-64162-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys3-Cys18); MF C98H156N34O32S2; MW 2386.67

695 €
789 $
539 £

Catalog number: 431-64162-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ala-Pro-Arg-Ser-Met-Arg-Arg-Ser-Ser-Asp-Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Phe(Disulfide bridge Cys11-Cys27); MF C131H215N49O41S4; MW 3260.73

355 €
403 $
275 £

Catalog number: 431-64311-1
Product Quantity: 500
Category:
Supplier:
Sequence Ala-Pro-Arg-Ser-Met-Arg-Arg-Ser-Ser-Asp-Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Phe(Disulfide bridge Cys11-Cys27); MF C131H215N49O41S4; MW 3260.73

475 €
539 $
368 £

Catalog number: 431-64311-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Ala-Pro-Arg-Ser-Met-Arg-Arg-Ser-Ser-Asp-Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Phe(Disulfide bridge Cys11-Cys27); MF C131H215N49O41S4; MW 3260.73

727 €
825 $
564 £

Catalog number: 431-64311-3
Product Quantity: 2.5 mg
Category:
Supplier:
Atriopeptin I [H-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-OH(Cys7-Cys23); MW: 2083.31]

306 €
347 $
237 £

Catalog number: SP-55273-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Tyr-Proinsulin C-Peptide (55-89) (human) (AA: Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg) (MW: 3780

390 €
443 $
302 £

Catalog number: SP-89545-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Tyr_Proinsulin C_Peptide (55_89) (human) Formula C162H268N50O54 Sequence Tyr_Arg_Arg_Glu_Ala_Glu_Asp_Leu_Gln_Val_Gly_Gln_Val_Glu_Leu_Gly_Gly_Gly_Pro_Gly_Ala_Gly_Ser_Leu_Gln_Pro_Leu_Ala_Leu_Glu_Gly_S

253 €
287 $
196 £

Catalog number: 89545
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys

1116 €
1266 $
865 £

Catalog number: 431-109400-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys

509 €
578 $
395 £

Catalog number: 431-109400-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys

1855 €
2105 $
1439 £

Catalog number: 431-109400-3
Product Quantity: 10 mg
Category:
Supplier:
gp38 Formula C133H209N41O38S2 Sequence Arg_Val_Thr_Ala_Ile_Glu_Lys_Tyr_Leu_Gln_Asp_Gln_Ala_Arg_Leu_Asn_Ser_Trp_Gly_Cys_Ala_Phe_Arg_Gln_Val_Cys

304 €
346 $
236 £

Catalog number: 55433
Product Quantity: 1mg
Category:
Supplier: GLSChina
gp38 [H-Arg-Val-Thr-Ala-Ile-Glu-Lys-Tyr-Leu-Gln-Asp-Gln-Ala-Arg-Leu-Asn-Ser-Trp-Gly-Cys-Ala-Phe-Arg-Gln-Val-Cys-OH (Cys20-Cys26); MW: 3054.53]

505 €
573 $
391 £

Catalog number: SP-55433-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr; MF C202H356N64O47; MW 4433.49

373 €
423 $
289 £

Catalog number: 431-97210-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr; MF C202H356N64O47; MW 4433.49

921 €
1045 $
714 £

Catalog number: 431-97210-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr; MF C202H356N64O47; MW 4433.49

1277 €
1449 $
991 £

Catalog number: 431-97210-3
Product Quantity: 10 mg
Category:
Supplier:
Atrial Natriuretic Peptide (1-28), rat (AA: Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp- Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg -Tyr (Disulfide bridge:Cys7-Cys23)(MW: 3062

390 €
443 $
302 £

Catalog number: SP-55278-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Prolactin Releasing Peptide (1_31), rat Formula C156H242N54O43S Sequence Ser_Arg_Ala_His_Gln_His_Ser_Met_Glu_Thr_Arg_Thr_Pro_Asp_Ile_Asn_Pro_Ala_Trp_Tyr_Thr_Gly_Arg_Gly_Ile_Arg_Pro_Val_Gly_Arg_Phe_N

282 €
320 $
219 £

Catalog number: 101266
Product Quantity: 1mg
Category:
Supplier: GLSChina
MF C62H99N23O21 ; MW 1502.60 ; GQQHHLGGAKQAGDV, Gly-Gln-Gln-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val

307 €
348 $
238 £

Catalog number: RB-PP-0655
Product Quantity: 1 mg
Category:
Supplier:
Intermedin_53 (human) Formula C247H397N83O73S3 Sequence His_Ser_Gly_Pro_Arg_Arg_Thr_Gln_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Met_Gly_Pr

414 €
469 $
321 £

Catalog number: 89208
Product Quantity: 1mg
Category:
Supplier: GLSChina
Prolactin Releasing Peptide (1-31), rat (AA: Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2) (MW: 3594.07)

390 €
443 $
302 £

Catalog number: SP-101266-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Arg-Phe

355 €
403 $
275 £

Catalog number: 431-109995-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Arg-Phe

307 €
348 $
238 £

Catalog number: 431-109995-1
Product Quantity: 500
Category:
Supplier:
Sequence Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Arg-Phe

543 €
616 $
421 £

Catalog number: 431-109995-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp- Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H205N45O39S2; MW 3062.47

679 €
771 $
527 £

Catalog number: 431-64166-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp- Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H205N45O39S2; MW 3062.47

339 €
384 $
263 £

Catalog number: 431-64166-1
Product Quantity: 500
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp- Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H205N45O39S2; MW 3062.47

440 €
500 $
341 £

Catalog number: 431-64166-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2; MF C156H242N54O43S; MW 3594.07

355 €
403 $
275 £

Catalog number: 431-110154-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2; MF C156H242N54O43S; MW 3594.07

775 €
880 $
601 £

Catalog number: 431-110154-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Thr-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Thr-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2; MF C156H242N54O43S; MW 3594.07

1116 €
1266 $
865 £

Catalog number: 431-110154-3
Product Quantity: 10 mg
Category:
Supplier:
Auriculin A [H-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-OH (Cys7-Cys23); MW: 2542.86]

390 €
443 $
302 £

Catalog number: SP-55276-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Adrenomedullin (11-50) (rat) [Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; (Disu

724 €
822 $
561 £

Catalog number: SP-100047-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly; MF C131H199N39O37S; MW 2944.35

576 €
654 $
447 £

Catalog number: 431-98012-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly; MF C131H199N39O37S; MW 2944.35

307 €
348 $
238 £

Catalog number: 431-98012-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly; MF C131H199N39O37S; MW 2944.35

775 €
880 $
601 £

Catalog number: 431-98012-3
Product Quantity: 10 mg
Category:
Supplier:
Pre_S2 (1_26) Formula C131H199N39O37S Sequence Met_Gln_Trp_Asn_Ser_Thr_Ala_Phe_His_Gln_Thr_Leu_Gln_Asp_Pro_Arg_Val_Arg_Gly_Leu_Tyr_Leu_Pro_Ala_Gly_Gly

207 €
235 $
161 £

Catalog number: 89124
Product Quantity: 1mg
Category:
Supplier: GLSChina
[Leu31,Pro34]-Peptide YY (human) [Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Ala-Aib-Arg-Gln-Arg-Tyr-NH2; MW: 4207.73]

472 €
536 $
366 £

Catalog number: SP-100451-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Atrial Natriuretic Factor (3_28) (human) Formula C117H187N43O36S3 Sequence Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr(Disulfide bridge Cy

247 €
280 $
191 £

Catalog number: 100523
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Atrial Natriuretic Factor (3-28) (human) (AA: Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys5-Cys21 )) (MW: 2880.3)

390 €
443 $
302 £

Catalog number: SP-100523-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Arg-Val-Thr-Ala-Ile-Glu-Lys-Tyr-Leu-Gln-Asp-Gln-Ala- Arg-Leu-Asn-Ser-Trp-Gly-Cys-Ala-Phe-Arg-Gln-Val-Cys(Disulfide bridge Cys20-Cys26); MF C133H209N41O38S2; MW 3056.5

857 €
972 $
664 £

Catalog number: 431-64321-3
Product Quantity: 5 mg
Category:
Supplier:
Sequence Arg-Val-Thr-Ala-Ile-Glu-Lys-Tyr-Leu-Gln-Asp-Gln-Ala- Arg-Leu-Asn-Ser-Trp-Gly-Cys-Ala-Phe-Arg-Gln-Val-Cys(Disulfide bridge Cys20-Cys26); MF C133H209N41O38S2; MW 3056.5

576 €
654 $
447 £

Catalog number: 431-64321-2
Product Quantity: 2mg
Category:
Supplier:
Sequence Arg-Val-Thr-Ala-Ile-Glu-Lys-Tyr-Leu-Gln-Asp-Gln-Ala- Arg-Leu-Asn-Ser-Trp-Gly-Cys-Ala-Phe-Arg-Gln-Val-Cys(Disulfide bridge Cys20-Cys26); MF C133H209N41O38S2; MW 3056.5

373 €
423 $
289 £

Catalog number: 431-64321-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

662 €
751 $
513 £

Catalog number: 431-110642-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

274 €
312 $
213 £

Catalog number: 431-110642-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

440 €
500 $
341 £

Catalog number: 431-110642-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys11- Cys 27); MF C145H234N52O44S3; MW 350

475 €
539 $
368 £

Catalog number: 431-61201-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys11- Cys 27); MF C145H234N52O44S3; MW 350

257 €
292 $
200 £

Catalog number: 431-61201-3
Product Quantity:
Category:
Supplier:
Sequence Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys11- Cys 27); MF C145H234N52O44S3; MW 350

257 €
292 $
200 £

Catalog number: 431-61201-2
Product Quantity:
Category:
Supplier:
Atriopeptin III [H-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-As-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (Cys7-Cys23); MW: 2549.85]

390 €
443 $
302 £

Catalog number: SP-55275-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Atrial Natriuretic Peptide (1_28),rat Formula C128H205N45O39S2 Sequence Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr

247 €
280 $
191 £

Catalog number: 55278
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Atrial Natriuretic Factor (1_24) (frog) Formula C103H165N37O34S3 Sequence Ser_Ser_Asp_Cys_Phe_Gly_Ser_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Met_Gly_Cys_Gly_Arg_Arg_Phe (Disulfide bond)

247 €
280 $
191 £

Catalog number: 100520
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
CAP - 18, rabbit (AA: Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr) (MW: 4433.49)

472 €
536 $
366 £

Catalog number: SP-88322-1
Product Quantity: 1 mg
Category:
Supplier: ADI
GHRF, mouse Formula C220H365N69O64S1 Sequence His_Val_Asp_Ala_Ile_Phe_Thr_Thr_Asn_Tyr_Arg_Lys_Leu_Leu_Ser_Gln_Leu_Tyr_Ala_Arg_Lys_Val_Ile_Gln_Asp_Ile_Met_Asn_Lys_Gln_Gly_Glu_Arg_Ile_Gln_Glu_Gln_Arg_

304 €
346 $
236 £

Catalog number: 55415
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys

2199 €
2496 $
1706 £

Catalog number: 431-97281-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys

3221 €
3656 $
2499 £

Catalog number: 431-97281-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys

857 €
972 $
664 £

Catalog number: 431-97281-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Se

543 €
616 $
421 £

Catalog number: 431-109713-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Se

1992 €
2261 $
1545 £

Catalog number: 431-109713-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Se

1148 €
1303 $
890 £

Catalog number: 431-109713-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Ala-Aib-Arg-Gln-Arg-Tyr-NH2; MF C183H281N57O54S2; MW 4207.73

1277 €
1449 $
991 £

Catalog number: 431-109335-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Ala-Aib-Arg-Gln-Arg-Tyr-NH2; MF C183H281N57O54S2; MW 4207.73

373 €
423 $
289 £

Catalog number: 431-109335-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Pro-Ser-Gln-Pro-Thr-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Ala-Aib-Arg-Gln-Arg-Tyr-NH2; MF C183H281N57O54S2; MW 4207.73

921 €
1045 $
714 £

Catalog number: 431-109335-2
Product Quantity: 5 mg
Category:
Supplier:
Pre-S2 (1-26) (AA: Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly) (MW: 2944.35)

306 €
347 $
237 £

Catalog number: SP-89124-1
Product Quantity: 1 mg
Category:
Supplier: ADI
a-ANF (1-28), Human [Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cus-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MW: 3080.46]

390 €
443 $
302 £

Catalog number: SP-52223-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

1148 €
1303 $
890 £

Catalog number: 431-108935-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

543 €
616 $
421 £

Catalog number: 431-108935-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

1992 €
2261 $
1545 £

Catalog number: 431-108935-3
Product Quantity: 10 mg
Category:
Supplier:
[Tyr8]-Atrial Natriuretic Peptide (5-27), rat; [Tyr8]-Atriopeptin II, rat [Ser-Ser-Cys-Tyr-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg Disulfide bridge:Cys3-Cys19 ); M

306 €
347 $
237 £

Catalog number: SP-101109-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys7-Cys23 ); MF C112H175N39O35S3; MW 2724.06

307 €
348 $
238 £

Catalog number: 431-109413-1
Product Quantity: 500
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys7-Cys23 ); MF C112H175N39O35S3; MW 2724.06

373 €
423 $
289 £

Catalog number: 431-109413-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys7-Cys23 ); MF C112H175N39O35S3; MW 2724.06

594 €
675 $
461 £

Catalog number: 431-109413-3
Product Quantity: 2.5 mg
Category:
Supplier:
Atrial Natriuretic Factor (4-28) (human) (AA: Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys7-Cys23 )) (MW: 2724.06)

390 €
443 $
302 £

Catalog number: SP-100525-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
[Tyr8]_Atrial Natriuretic Peptide (5_27), rat; [Tyr8]_Atriopeptin II, rat Formula C98H156N34O33S2 Sequence Ser_Ser_Cys_Tyr_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg

209 €
238 $
162 £

Catalog number: 101109
Product Quantity: 1mg
Category:
Supplier: GLSChina
Atrial Natriuretic Factor (4_28) (human) Formula C112H175N39O35S3 Sequence Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr(Disulfide bridge Cys7_C

215 €
244 $
166 £

Catalog number: 100525
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Proinsulin C _ peptide (55 _89), human Formula C153H259N49O52 Sequence Arg_Arg_Glu_Ala_Glu_Asp_Leu_Gln_Val_Gly_Gln_Val_Glu_Leu_Gly_Gly_Gly_Pro_Gly_Ala_Gly_Ser_Leu_Gln_Pro_Leu_Ala_Leu_Glu_Gly_Ser_Leu

300 €
341 $
233 £

Catalog number: 88239
Product Quantity: 1mg
Category:
Supplier: GLSChina
Corticotropin Releasing Factor, Human, Rat [H-Ser-Glu-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Gly-Met-Ala-Arg-Ala-Gly-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Met-Gl

398 €
451 $
308 £

Catalog number: SP-52234-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
[Gln11] -β- Amyloid (1 - 40) [sp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MW: 4328.9

390 €
443 $
302 £

Catalog number: SP-87935-1
Product Quantity: 1 mg
Category:
Supplier: ADI
ANP (1_30), frog Formula C131H215N49O41S4 Sequence Ala_Pro_Arg_Ser_Met_Arg_Arg_Ser_Ser_Asp_Cys_Phe_Gly_Ser_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Met_Gly_Cys_Gly_Arg_Phe

266 €
302 $
206 £

Catalog number: 55423
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

475 €
539 $
368 £

Catalog number: 431-82927-1
Product Quantity: 1mg
Category: Peptides
Supplier:
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

1018 €
1156 $
790 £

Catalog number: 431-82927-2
Product Quantity: 5 mg
Category: Peptides
Supplier:
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

1018 €
1156 $
790 £

Catalog number: 431-96823-2
Product Quantity: 5 mg
Category: Peptides
Supplier:
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

1665 €
1890 $
1292 £

Catalog number: 431-96823-3
Product Quantity: 10 mg
Category: Peptides
Supplier:
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

475 €
539 $
368 £

Catalog number: 431-96823-1
Product Quantity: 1mg
Category: Peptides
Supplier:
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

1665 €
1890 $
1292 £

Catalog number: 431-82927-3
Product Quantity: 10 mg
Category: Peptides
Supplier:
Sequence Tyr-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

594 €
675 $
461 £

Catalog number: 431-109417-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

775 €
880 $
601 £

Catalog number: 431-109417-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

307 €
348 $
238 £

Catalog number: 431-109417-1
Product Quantity: 1mg
Category:
Supplier:
MF C202H356N64O47 ; MW 4433.41 ; GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY, Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-

543 €
616 $
421 £

Catalog number: RB-PP-0427
Product Quantity: 1 mg
Category:
Supplier:
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

440 €
500 $
341 £

Catalog number: 431-109411-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

679 €
771 $
527 £

Catalog number: 431-109411-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

339 €
384 $
263 £

Catalog number: 431-109411-1
Product Quantity: 500
Category:
Supplier:
Atrial Natriuretic Peptide (1_28), rat (AA Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_ Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg _Tyr

430 €
488 $
333 £

Catalog number: SP-55278-05
Product Quantity: 0.5 mg
Category:
Supplier: Alpha Dia
Sequence Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln; MF C181H302N50O48; MW 3946.73

970 €
1101 $
752 £

Catalog number: 431-97219-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln; MF C181H302N50O48; MW 3946.73

339 €
384 $
263 £

Catalog number: 431-97219-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln; MF C181H302N50O48; MW 3946.73

679 €
771 $
527 £

Catalog number: 431-97219-2
Product Quantity: 5 mg
Category:
Supplier:
Rcramp Formula C181H302N50O48 Sequence Gly_Leu_Val_Arg_Lys_Gly_Gly_Glu_Lys_Phe_Gly_Glu_Lys_Leu_Arg_Lys_Ile_Gly_Gln_Lys_Ile_Lys_Glu_Phe_Phe_Gln_Lys_Leu_Ala_Leu_Glu_Ile_Glu_Gln

243 €
276 $
189 £

Catalog number: 88331
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser; MF C220H365N69O64S;

373 €
423 $
289 £

Catalog number: 431-64303-1
Product Quantity: 500
Category:
Supplier:
Sequence His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser; MF C220H365N69O64S;

576 €
654 $
447 £

Catalog number: 431-64303-2
Product Quantity: 1mg
Category:
Supplier:
Sequence His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser; MF C220H365N69O64S;

857 €
972 $
664 £

Catalog number: 431-64303-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Se

1116 €
1266 $
865 £

Catalog number: 431-98096-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Se

1855 €
2105 $
1439 £

Catalog number: 431-98096-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Se

509 €
578 $
395 £

Catalog number: 431-98096-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gl

1992 €
2261 $
1545 £

Catalog number: 431-108934-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gl

1148 €
1303 $
890 £

Catalog number: 431-108934-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gl

543 €
616 $
421 £

Catalog number: 431-108934-1
Product Quantity: 1mg
Category:
Supplier:
Adrenomedullin (11_50) (rat) Formula C194H304N58O59S4 Sequence Ser_Thr_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Met_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr_Asp_Lys_Asp_Lys_Asp_Gly_Met_Ala_Pro_Arg_Asn_Lys

433 €
491 $
336 £

Catalog number: 100047
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp- Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bridge Cys16-Cy

1992 €
2261 $
1545 £

Catalog number: 431-64313-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp- Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bridge Cys16-Cy

543 €
616 $
421 £

Catalog number: 431-64313-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp- Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bridge Cys16-Cy

1148 €
1303 $
890 £

Catalog number: 431-64313-2
Product Quantity: 5 mg
Category:
Supplier:
Atrial Natriuretic Factor (1-24) (frog) (AA: Ser-Ser-Asp-Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Arg-Phe (MW: 2561.87) (Disulfide bridge:Cys4-Cys20) (MW: 2561.87)

390 €
443 $
302 £

Catalog number: SP-100520-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
CFP10 (71_85) Formula C72H120N24O25 Sequence Glu_Ile_Ser_Thr_Asn_Ile_Arg_Gln_Ala_Gly_Val_Gln_Tyr_Ser_Arg

159 €
180 $
123 £

Catalog number: 88354
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Glu-Ile-Ser-Thr-Asn-Ile-Arg-Gln-Ala-Gly-Val-Gln-Tyr-Ser-Arg; MF C72H120N24O25; MW 1721.91

543 €
616 $
421 £

Catalog number: 431-97242-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Glu-Ile-Ser-Thr-Asn-Ile-Arg-Gln-Ala-Gly-Val-Gln-Tyr-Ser-Arg; MF C72H120N24O25; MW 1721.91

373 €
423 $
289 £

Catalog number: 431-97242-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Glu-Ile-Ser-Thr-Asn-Ile-Arg-Gln-Ala-Gly-Val-Gln-Tyr-Ser-Arg; MF C72H120N24O25; MW 1721.91

257 €
292 $
200 £

Catalog number: 431-97242-1
Product Quantity: 1mg
Category:
Supplier:
MF C72H120N24O25 ; MW 1721.88 ; EISTNIRQAGVQYSR, Glu-Ile-Ser-Thr-Asn-Ile-Arg-Gln-Ala-Gly-Val-Gln-Tyr-Ser-Arg

307 €
348 $
238 £

Catalog number: RB-PP-0459
Product Quantity: 1 mg
Category:
Supplier:
á_ANF(1_28), human Formula C127H203N45O39S3 Sequence Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr (Disulfide bridge Cys7_Cys23)

266 €
302 $
206 £

Catalog number: 52223
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
CFP10 (71-85) (AA: Glu-Ile-Ser-Thr-Asn-Ile-Arg-Gln-Ala-Gly-Val-Gln-Tyr-Ser-Arg) (MW: 1721.91)

223 €
253 $
173 £

Catalog number: SP-88354-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C127H203N45O39S3; MW 3080.46

727 €
825 $
564 £

Catalog number: 431-61111-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C127H203N45O39S3; MW 3080.46

355 €
403 $
275 £

Catalog number: 431-61111-1
Product Quantity: 500
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C127H203N45O39S3; MW 3080.46

475 €
539 $
368 £

Catalog number: 431-61111-2
Product Quantity: 1mg
Category:
Supplier:
MF C162H268N50O54 ; MW 3780.18 ; YRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR, Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-

407 €
462 $
316 £

Catalog number: RB-PP-1561
Product Quantity: 1 mg
Category:
Supplier:
â_Defensin_3, human Formula C216H371N75O59S6 Sequence Gly_Ile_Ile_Asn_Thr_Leu_Gln_Lys_Tyr_Tyr_Cys_Arg_Val_Arg_Gly_Gly_Arg_Cys_Ala_Val_Leu_Ser_Cys_Leu_Pro_Lys_Glu_Glu_Gln_Ile_Gly_Lys_Cys_Ser_Thr_Arg_

847 €
961 $
657 £

Catalog number: 100511
Product Quantity: 1mg
Category:
Supplier: GLSChina
Biotin-Intermedin (human) (AA: Biotin-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pr

390 €
443 $
302 £

Catalog number: SP-89205-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Amyloid Peptide(1-42), Rat [H-Asp-Ala-Gly-Phe-Gly-His-Asp-Ser-Gly-Phe-Gly-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH

558 €
633 $
433 £

Catalog number: SP-53771-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Cecropin P1 (porcine) Formula C147H253N46O43 Sequence Ser_Trp_Leu_Ser_Lys_Thr_Ala_Lys_Lys_Leu_Glu_Asn_Ser_Ala_Lys_Lys_Arg_Ile_Ser_Glu_Gly_Ile_Ala_Ile_Ala_Ile_Gln_Gly_Gly_Pro_Arg

231 €
262 $
179 £

Catalog number: 89425
Product Quantity: 1mg
Category:
Supplier: GLSChina
GHRF, Mouse [H-His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Il-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser-OH; MW: 5032.85]

505 €
573 $
391 £

Catalog number: SP-55415-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
[Gln22] _ 25359 _ Amyloid (6 _40) Formula C167H258N46O48S Sequence His_Asp_Ser_Gly_Tyr_Glu_Val_His_His_Gln_Lys_Leu_Val_Phe_Phe_Ala_Gln_Asp_Val_Gly_Ser_Asn_Lys_Gly_Ala_Ile_Ile_Gly_Leu_Met_Val_Gly_Gly

353 €
400 $
273 £

Catalog number: 87936
Product Quantity: 1mg
Category:
Supplier: GLSChina
[Gln22] _â_ Amyloid (1 _ 40) Formula C194H296N54O57S Sequence Asp_Ala_Glu_Phe_Arg_His_Asp_Ser_Gly_Tyr_Glu_Val_His_His_Gln_Lys_Leu_Val_Phe_Phe_Ala_Gln_Asp_Val_Gly_Ser_Asn_Lys_Gly_Ala_Ile_Ile_Gly_Leu_

389 €
442 $
302 £

Catalog number: 74039
Product Quantity: 1mg
Category: Peptides
Supplier: GLSChina
[Gln11] _â_ Amyloid (1 _ 40) Formula C194H296N54O57S Sequence Asp_Ala_Glu_Phe_Arg_His_Asp_Ser_Gly_Tyr_Gln_Val_His_His_Gln_Lys_Leu_Val_Phe_Phe_Ala_Glu_Asp_Val_Gly_Ser_Asn_Lys_Gly_Ala_Ile_Ile_Gly_Leu_

389 €
442 $
302 £

Catalog number: 87935
Product Quantity: 1mg
Category: Peptides
Supplier: GLSChina
Sequence Lys-Arg-Val-Thr-Ile-Met-Pro-Lys-Asp-Ile-Gln-Leu-Ala-Arg-Arg-Ile-Arg-Gly-Glu-Arg-Ala; MF C107H195N39O28S; MW 2508.06

274 €
312 $
213 £

Catalog number: 431-95594-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Lys-Arg-Val-Thr-Ile-Met-Pro-Lys-Asp-Ile-Gln-Leu-Ala-Arg-Arg-Ile-Arg-Gly-Glu-Arg-Ala; MF C107H195N39O28S; MW 2508.06

679 €
771 $
527 £

Catalog number: 431-95594-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Lys-Arg-Val-Thr-Ile-Met-Pro-Lys-Asp-Ile-Gln-Leu-Ala-Arg-Arg-Ile-Arg-Gly-Glu-Arg-Ala; MF C107H195N39O28S; MW 2508.06

475 €
539 $
368 £

Catalog number: 431-95594-2
Product Quantity: 5 mg
Category:
Supplier:
α-Defensin-1, human [Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys (Disulfide bridge: Cys5- Cys34, Cy

1225 €
1390 $
950 £

Catalog number: SP-88391-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Glu-Gln-Val-Thr-Asn-Val-Gly-Gly-Ala-Val-Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val-Glu-Gly-Ala-Gly-Ser-Ile-Ala-Ala-Ala-Thr-Gly-Phe-Val; MF C141H235N39O49; MW 3260.68

1148 €
1303 $
890 £

Catalog number: 431-98205-3
Product Quantity: 10 mg
Category:
Supplier:
Non-Ab Component of Alzheimer's Disease Amyloid (AA: Glu-Gln-Val-Thr-Asn-Val-Gly-Gly-Ala-Val-Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val-Glu-Gly-Ala-Gly-Ser-Ile-Ala-Ala-Ala-Thr-Gly-Phe-Val) (MW: 3

390 €
443 $
302 £

Catalog number: SP-89317-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Glu-Gln-Val-Thr-Asn-Val-Gly-Gly-Ala-Val-Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val-Glu-Gly-Ala-Gly-Ser-Ile-Ala-Ala-Ala-Thr-Gly-Phe-Val; MF C141H235N39O49; MW 3260.68

857 €
972 $
664 £

Catalog number: 431-98205-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Glu-Gln-Val-Thr-Asn-Val-Gly-Gly-Ala-Val-Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val-Glu-Gly-Ala-Gly-Ser-Ile-Ala-Ala-Ala-Thr-Gly-Phe-Val; MF C141H235N39O49; MW 3260.68

373 €
423 $
289 £

Catalog number: 431-98205-1
Product Quantity: 1mg
Category:
Supplier:
Non_Ab Component of Alzheimer's Disease Amyloid Formula C141H235N39O49 Sequence Glu_Gln_Val_Thr_Asn_Val_Gly_Gly_Ala_Val_Val_Thr_Gly_Val_Thr_Ala_Val_Ala_Gln_Lys_Thr_Val_Glu_Gly_Ala_Gly_Ser_Ile_Ala_Al

300 €
341 $
233 £

Catalog number: 89317
Product Quantity: 1mg
Category:
Supplier: GLSChina
Biotin_Atrial Natriuretic Peptide (1_28), human,porcine Formula C137H217N47O41S4 Sequence Biotin_Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_P

291 €
330 $
225 £

Catalog number: 101108
Product Quantity: 1mg
Category:
Supplier: GLSChina
Intermedin (rat) Formula C226H361N75O64S2 Sequence Pro_His_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Val_Arg_Pro_Ser_Gly_Arg_Arg_Asp_Ser_Ala

378 €
429 $
293 £

Catalog number: 89206
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Se

543 €
616 $
421 £

Catalog number: 431-64314-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Se

1148 €
1303 $
890 £

Catalog number: 431-64314-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Se

1992 €
2261 $
1545 £

Catalog number: 431-64314-3
Product Quantity: 10 mg
Category:
Supplier:
ANP(1-30), Frog peptide [H-Ala-Pro-Arg-Ser-Met-Arg-Arg-Ser-Ser-Asp-Cys-Phe-Gly-Ser-Arg-Ile-Asp-Asp-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Fly-Arg-Phe-OH(Cys11-Cys27); MW: 3260.73]

390 €
443 $
302 £

Catalog number: SP-55423-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Adrenomedullin(13-52), Human [H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-Nh2(Cys1

731 €
830 $
567 £

Catalog number: SP-55425-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Thr-Glu-Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys-Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu-Met-NH2; MF C155H242N40O49S; MW 3481.96

954 €
1083 $
740 £

Catalog number: 431-95574-3
Product Quantity: 10 mg
Category: Peptides
Supplier:
Sequence Thr-Glu-Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys-Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu-Met-NH2; MF C155H242N40O49S; MW 3481.96

662 €
751 $
513 £

Catalog number: 431-95574-2
Product Quantity: 5 mg
Category: Peptides
Supplier:
Sequence Thr-Glu-Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys-Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu-Met-NH2; MF C155H242N40O49S; MW 3481.96

323 €
366 $
250 £

Catalog number: 431-95574-1
Product Quantity: 1mg
Category: Peptides
Supplier:
Obestatin, human Formula C16H176N32O33 Sequence Phe_Asn_Ala_Pro_Phe_Asp_Val_Gly_Ile_Lys_Leu_Ser_Gly_Val_Gln_Tyr_Gln_Gln_His_Ser_Gln_Ala_Leu_NH2

199 €
225 $
154 £

Catalog number: 52792
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C126H190N34O35; MW 2773.19

727 €
825 $
564 £

Catalog number: 431-109324-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C126H190N34O35; MW 2773.19

509 €
578 $
395 £

Catalog number: 431-109324-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C126H190N34O35; MW 2773.19

307 €
348 $
238 £

Catalog number: 431-109324-1
Product Quantity: 1mg
Category:
Supplier:
á_Defensin_1, human Formula C167H256N48O50S6 Sequence Asp_His_Tyr_Asn_Cys_Val_Ser_Ser_Gly_Gly_Gln_Cys_Leu_Tyr_Ser_Ala_Cys_Pro_Ile_Phe_Thr_Lys_Ile_Gln_Gly_Thr_Cys_Tyr_Arg_Gly_Lys_Ala_Lys_Cys_Cys_Lys

781 €
886 $
605 £

Catalog number: 88391
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ser-Trp-Leu-Ser-Lys-Thr-Ala-Lys-Lys-Leu-Glu-Asn-Ser-Ala-Lys-Lys-Arg-Ile-Ser-Glu-Gly-Ile-Ala-Ile-Ala-Ile-Gln-Gly-Gly-Pro-Arg; MF C147H253N46O43; MW 3338.93

921 €
1045 $
714 £

Catalog number: 431-98313-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Ser-Trp-Leu-Ser-Lys-Thr-Ala-Lys-Lys-Leu-Glu-Asn-Ser-Ala-Lys-Lys-Arg-Ile-Ser-Glu-Gly-Ile-Ala-Ile-Ala-Ile-Gln-Gly-Gly-Pro-Arg; MF C147H253N46O43; MW 3338.93

323 €
366 $
250 £

Catalog number: 431-98313-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Trp-Leu-Ser-Lys-Thr-Ala-Lys-Lys-Leu-Glu-Asn-Ser-Ala-Lys-Lys-Arg-Ile-Ser-Glu-Gly-Ile-Ala-Ile-Ala-Ile-Gln-Gly-Gly-Pro-Arg; MF C147H253N46O43; MW 3338.93

613 €
695 $
475 £

Catalog number: 431-98313-2
Product Quantity: 5 mg
Category:
Supplier:
Gastric Inhibitory Polypeptide (1_30) (porcine) Formula C162H244N40O48S Sequence Tyr_Ala_Glu_Gly_Thr_Phe_Ile_Ser_Asp_Tyr_Ser_Ile_Ala_Met_Asp_Lys_Ile_Arg_Gln_Gln_Asp_Phe_Val_Asn_Trp_Leu_Leu_Ala_Gln_L

225 €
256 $
175 £

Catalog number: 101816
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C16H176N32O33; MW 2546.89

509 €
578 $
395 £

Catalog number: 431-61680-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C16H176N32O33; MW 2546.89

727 €
825 $
564 £

Catalog number: 431-61680-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C16H176N32O33; MW 2546.89

307 €
348 $
238 £

Catalog number: 431-61680-1
Product Quantity: 1mg
Category:
Supplier:
C_Peptide 2 (rat) Formula C135H222N38O49 Sequence Glu_Val_Glu_Asp_Pro_Gln_Val_Ala_Gln_Leu_Glu_Leu_Gly_Gly_Gly_Pro_Gly_Ala_Gly_Asp_Leu_Gln_Thr_Leu_Ala_Leu_Glu_Val_Ala_Arg_Gln

231 €
262 $
179 £

Catalog number: 89544
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C197H300N54O59S; MW 4400

1018 €
1156 $
790 £

Catalog number: 431-98181-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C197H300N54O59S; MW 4400

1665 €
1890 $
1292 £

Catalog number: 431-98181-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C197H300N54O59S; MW 4400

475 €
539 $
368 £

Catalog number: 431-98181-1
Product Quantity: 1mg
Category:
Supplier:
GIP, mouse, rat (AA: Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln) (MW: 5002.

557 €
632 $
432 £

Catalog number: SP-88138-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Obestatin, human (AA: Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2) (MW: 2546.89)

306 €
347 $
237 £

Catalog number: SP-52792-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Biotin-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

775 €
880 $
601 £

Catalog number: 431-109996-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Biotin-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

1116 €
1266 $
865 £

Catalog number: 431-109996-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Biotin-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

355 €
403 $
275 £

Catalog number: 431-109996-1
Product Quantity: 1mg
Category:
Supplier:
ã_TAC4 (32 _ 50) Formula C92H146N24O31 Sequence Ala_Glu_Thr_Trp_Glu_Gly_Ala_Gly_Pro_Ser_Ile_Gln_Leu_Gln_Leu_Gln_Glu_Val_Lys

177 €
201 $
137 £

Catalog number: 86685
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys; MF C92H146N24O31; MW 2084.33

440 €
500 $
341 £

Catalog number: 431-95573-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys; MF C92H146N24O31; MW 2084.33

662 €
751 $
513 £

Catalog number: 431-95573-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys; MF C92H146N24O31; MW 2084.33

257 €
292 $
200 £

Catalog number: 431-95573-1
Product Quantity: 1mg
Category:
Supplier:
mCRAMP, mouse Formula C178H302N50O46 Sequence Gly_Leu_Leu_Arg_Lys_Gly_Gly_Glu_Lys_Ile_Gly_Glu_Lys_Leu_Lys_Lys_Ile_Gly_Gln_Lys_Ile_Lys_Asn_Phe_Phe_Gln_Lys_Leu_Val_Pro_Gln_Pro_Glu_Gln

243 €
276 $
189 £

Catalog number: 88328
Product Quantity: 1mg
Category:
Supplier: GLSChina
GIP, porcine Formula C225H342N60O66S Sequence Tyr_Ala_Glu_Gly_Thr_Phe_Ile_Ser_Asp_Tyr_Ser_Ile_Ala_Met_Asp_Lys_Ile_Arg_Gln_Gln_Asp_Phe_Val_Asn_Trp_Leu_Leu_Ala_Gln_Lys_Gly_Lys_Lys_Ser_Asp_Trp_Lys_His_

342 €
388 $
265 £

Catalog number: 88139
Product Quantity: 1mg
Category:
Supplier: GLSChina
Biotin_Atrial Natriuretic Peptide (1_28), human, porcine (AA Biotin_Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr (Disulfide bridge

523 €
593 $
405 £

Catalog number: SP-101108-1
Product Quantity: 1 mg
Category:
Supplier: Alpha Dia
Biotin-Atrial Natriuretic Peptide (1-28), human, porcine (AA: Biotin-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridg

472 €
536 $
366 £

Catalog number: SP-101108-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Cecropin P1 (porcine) (AA: Ser-Trp-Leu-Ser-Lys-Thr-Ala-Lys-Lys-Leu-Glu-Asn-Ser-Ala-Lys-Lys-Arg-Ile-Ser-Glu-Gly-Ile-Ala-Ile-Ala-Ile-Gln-Gly-Gly-Pro-Arg) (MW: 3338.93)

306 €
347 $
237 £

Catalog number: SP-89425-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Hepatitus B Virus Pre-S Region (120-145) (AA: Met-Gln-Trp-Asn-Ser-Thr-Thr-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Phe-Pro-Ala-Gly-Gly) (MW: 3008.4)

306 €
347 $
237 £

Catalog number: SP-54781-1
Product Quantity: 1 mg
Category:
Supplier: ADI
MF C92H146N24O31 ; MW 2084.30 ; AETWEGAGPSIQLQLQEVK, Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys

323 €
366 $
250 £

Catalog number: RB-PP-1685
Product Quantity: 1 mg
Category:
Supplier:
gp120, HIV_1 MN Formula C135H221N45O33 Sequence Tyr_Asn_Ala_Lys_Arg_Lys_Arg_Ile_His_Ile_Gln_Arg_Gly_Pro_Gly_Arg_Ala_Phe_Tyr_Thr_Thr_Lys_Asn_Ile_Ile

203 €
230 $
157 £

Catalog number: 101042
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys

970 €
1101 $
752 £

Catalog number: 431-109399-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys

3950 €
4483 $
3064 £

Catalog number: 431-109399-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly-Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly-Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-Lys

2655 €
3014 $
2060 £

Catalog number: 431-109399-2
Product Quantity: 5 mg
Category:
Supplier:
Hepatitus B Virus Pre_S Region (120_145) Formula C135H199N39O38S1 Sequence Met_Gln_Trp_Asn_Ser_Thr_Thr_Phe_His_Gln_Thr_Leu_Gln_Asp_Pro_Arg_Val_Arg_Gly_Leu_Tyr_Phe_Pro_Ala_Gly_Gly

207 €
235 $
161 £

Catalog number: 54781
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Me

576 €
654 $
447 £

Catalog number: 431-98437-1
Product Quantity: 500
Category:
Supplier:
Sequence Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Me

775 €
880 $
601 £

Catalog number: 431-98437-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Me

1245 €
1413 $
966 £

Catalog number: 431-98437-3
Product Quantity: 2.5 mg
Category:
Supplier:
[Gln9]_Amyloid â_Protein (1_40) Formula C197H300N54O59S Sequence Asp_Ala_Glu_Phe_Arg_His_Asp_Ser_Gln_Tyr_Glu_Val_His_His_Gln_Lys_Leu_Val_Phe_Phe_Ala_Glu_Asp_Val_Gly_Ser_Asn_Lys_Gly_Ala_Ile_Ile_Gly_L

389 €
442 $
302 £

Catalog number: 89293
Product Quantity: 1mg
Category:
Supplier: GLSChina
Gastric Inhibitory Peptide (GIP), human Formula C226H338N60O66S1 Sequence Tyr_Ala_Glu_Gly_Thr_Phe_Ile_Ser_Asp_Tyr_Ser_Ile_Ala_Met_Asp_Lys_Ile_His_Gln_Gln_Asp_Phe_Val_Asn_Trp_Leu_Leu_Ala_Gln_Lys_Gly_

215 €
244 $
166 £

Catalog number: 55416
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Proadrenomedullin (45_92) (human) Formula C215H359N67O73S2 Sequence Glu_Leu_Arg_Met_Ser_Ser_Ser_Tyr_Pro_Thr_Gly_Leu_Ala_Asp_Val_Lys_Ala_Gly_Pro_Ala_Gln_Thr_Leu_Ile_Arg_Pro_Gln_Asp_Met_Lys_Gly_Ala_Se

378 €
429 $
293 £

Catalog number: 100050
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; MF C226H343N61O66S;

970 €
1101 $
752 £

Catalog number: 431-97026-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; MF C226H343N61O66S;

440 €
500 $
341 £

Catalog number: 431-97026-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; MF C225H342N60O66S;

970 €
1101 $
752 £

Catalog number: 431-97027-2
Product Quantity: 5 mg
Category:
Supplier:
GIP, porcine (AA: Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln) (MW: 4975.66)

557 €
632 $
432 £

Catalog number: SP-88139-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; MF C225H342N60O66S;

440 €
500 $
341 £

Catalog number: 431-97027-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; MF C225H342N60O66S;

1471 €
1669 $
1141 £

Catalog number: 431-97027-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln; MF C226H343N61O66S;

1471 €
1669 $
1141 £

Catalog number: 431-97026-3
Product Quantity: 10 mg
Category:
Supplier:
GIP, mouse, rat Formula C226H343N61O66S Sequence Tyr_Ala_Glu_Gly_Thr_Phe_Ile_Ser_Asp_Tyr_Ser_Ile_Ala_Met_Asp_Lys_Ile_Arg_Gln_Gln_Asp_Phe_Val_Asn_Trp_Leu_Leu_Ala_Gln_Lys_Gly_Lys_Lys_Asn_Asp_Trp_Lys_H

342 €
388 $
265 £

Catalog number: 88138
Product Quantity: 1mg
Category:
Supplier: GLSChina
Apelin_36, human Formula C184H297N69O43S Sequence Leu_Val_Gln_Pro_Arg_Gly_Ser_Arg_Asn_Gly_Pro_Gly_Pro_Trp_Gln_Gly_Gly_Arg_Arg_Lys_Phe_Arg_Arg_Gln_Arg_Pro_Arg_Leu_Ser_His_Lys_Gly_Pro_Met_Pro_Phe

253 €
287 $
196 £

Catalog number: 71114
Product Quantity: 1mg
Category:
Supplier: GLSChina
BNP (1-32), Rat peptide [H-Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Ley-Gly-Cys-Asp-Gly-Leu-Arg-Leu-Phe-OH(Cys10-Cys26); MW: 3453.01]

390 €
443 $
302 £

Catalog number: SP-55422-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Met-Gln-Trp-Asn-Ser-Thr-Thr-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Phe-Pro-Ala-Gly-Gly; MF C135H199N39O38S; MW 3008.4

307 €
348 $
238 £

Catalog number: 431-63669-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Met-Gln-Trp-Asn-Ser-Thr-Thr-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Phe-Pro-Ala-Gly-Gly; MF C135H199N39O38S; MW 3008.4

775 €
880 $
601 £

Catalog number: 431-63669-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Met-Gln-Trp-Asn-Ser-Thr-Thr-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Phe-Pro-Ala-Gly-Gly; MF C135H199N39O38S; MW 3008.4

576 €
654 $
447 £

Catalog number: 431-63669-2
Product Quantity: 5 mg
Category:
Supplier:
[Gln9]-Amyloid β-Protein (1-40) [Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MW: 44

390 €
443 $
302 £

Catalog number: SP-89293-1
Product Quantity: 1 mg
Category:
Supplier: ADI
MF C153H259N49O52 ; MW 3617.01 ; RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR, Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-G

509 €
578 $
395 £

Catalog number: RB-PP-1299
Product Quantity: 1 mg
Category:
Supplier:
γ-TAC4 (32 - 50) [Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys (MW: 2084.33)]

223 €
253 $
173 £

Catalog number: SP-86685-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Pro-Ala-Gln-Glu-Asp-Gly-Lys-Val-Tyr-Ile-Asn-Met-Pro-Gly-Arg-Gly; MF C74H118N22O24S; MW 1731.96

576 €
654 $
447 £

Catalog number: 431-95636-3
Product Quantity: 10 mg
Category: Peptides
Supplier:
Sequence Pro-Ala-Gln-Glu-Asp-Gly-Lys-Val-Tyr-Ile-Asn-Met-Pro-Gly-Arg-Gly; MF C74H118N22O24S; MW 1731.96

373 €
423 $
289 £

Catalog number: 431-95636-2
Product Quantity: 5 mg
Category: Peptides
Supplier:
DAP10 Signaling Fragment (AA: Pro-Ala-Gln-Glu-Asp-Gly-Lys-Val-Tyr-Ile-Asn-Met-Pro-Gly-Arg-Gly) (MW: 1731.96)

223 €
253 $
173 £

Catalog number: SP-86748-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Pro-Ala-Gln-Glu-Asp-Gly-Lys-Val-Tyr-Ile-Asn-Met-Pro-Gly-Arg-Gly; MF C74H118N22O24S; MW 1731.96

257 €
292 $
200 £

Catalog number: 431-95636-1
Product Quantity: 1mg
Category: Peptides
Supplier:
Sequence Tyr-Val-Met-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-Arg-Arg-Asn-Gly-Ser-Ser-Ser-Ser-Gly-Val-Gly-Gly-Ala-Ala-Gln; MF C126H188N44O37S; MW 2943.2

576 €
654 $
447 £

Catalog number: 431-61165-2
Product Quantity: 2mg
Category:
Supplier:
Sequence Tyr-Val-Met-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-Arg-Arg-Asn-Gly-Ser-Ser-Ser-Ser-Gly-Val-Gly-Gly-Ala-Ala-Gln; MF C126H188N44O37S; MW 2943.2

921 €
1045 $
714 £

Catalog number: 431-61165-3
Product Quantity: 5 mg
Category:
Supplier:
ã3_MSH Formula C126H188N44O37S Sequence Tyr_Val_Met_Gly_His_Phe_Arg_Trp_Asp_Arg_Phe_Gly_Arg_Arg_Asn_Gly_Ser_Ser_Ser_Ser_Gly_Val_Gly_Gly_Ala_Ala_Gln

310 €
352 $
240 £

Catalog number: 52277
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-Val-Met-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-Arg-Arg-Asn-Gly-Ser-Ser-Ser-Ser-Gly-Val-Gly-Gly-Ala-Ala-Gln; MF C126H188N44O37S; MW 2943.2

373 €
423 $
289 £

Catalog number: 431-61165-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2; MF C175H284N52O52S; MW 5980.6

1277 €
1449 $
991 £

Catalog number: 431-61171-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2; MF C175H284N52O52S; MW 5980.6

373 €
423 $
289 £

Catalog number: 431-61171-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Asp-Ala-Asp-Ser-Ser-Ile-Glu-Lys-Gln-Val-Ala-Leu-Leu-Lys-Ala-Leu-Tyr-Gly-His-Gly-Gln-Ile-Ser-His-Lys-Arg-His-Lys-Thr-Asp-Ser-Phe-Val-Gly-Leu-Met-NH2; MF C175H284N52O52S; MW 5980.6

921 €
1045 $
714 £

Catalog number: 431-61171-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Glu-Val-Glu-Asp-Pro-Gln-Val-Ala-Gln-Leu-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Asp-Leu-Gln-Thr-Leu-Ala-Leu-Glu-Val-Ala-Arg-Gln; MF C135H222N38O49; MW 3161.50

613 €
695 $
475 £

Catalog number: 431-98432-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Glu-Val-Glu-Asp-Pro-Gln-Val-Ala-Gln-Leu-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Asp-Leu-Gln-Thr-Leu-Ala-Leu-Glu-Val-Ala-Arg-Gln; MF C135H222N38O49; MW 3161.50

921 €
1045 $
714 £

Catalog number: 431-98432-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Glu-Val-Glu-Asp-Pro-Gln-Val-Ala-Gln-Leu-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Asp-Leu-Gln-Thr-Leu-Ala-Leu-Glu-Val-Ala-Arg-Gln; MF C135H222N38O49; MW 3161.50

323 €
366 $
250 £

Catalog number: 431-98432-1
Product Quantity: 1mg
Category:
Supplier:
PACAP_38, amide, frog Formula C204H333N63O53S Sequence His_Ser_Asp_Gly_Ile_Phe_Thr_Asp_Ser_Tyr_Ser_Arg_Tyr_Arg_Lys_Gln_Met_Ala_Val_Lys_Lys_Tyr_Leu_Ala_Ala_Val_Leu_Gly_Lys_Arg_Tyr_Lys_Gln_Arg_Ile_Lys

324 €
367 $
251 £

Catalog number: 55404
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Cys-Gly-Lys-Arg-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala; MF C

543 €
616 $
421 £

Catalog number: 431-98184-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Cys-Gly-Lys-Arg-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala; MF C

1148 €
1303 $
890 £

Catalog number: 431-98184-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Cys-Gly-Lys-Arg-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala; MF C

1992 €
2261 $
1545 £

Catalog number: 431-98184-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala; MF C200H307N55O58S;

509 €
578 $
395 £

Catalog number: 431-96121-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala; MF C200H307N55O58S;

1855 €
2105 $
1439 £

Catalog number: 431-96121-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala; MF C200H307N55O58S;

857 €
972 $
664 £

Catalog number: 431-96121-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys

2409 €
2734 $
1869 £

Catalog number: 431-97279-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys

921 €
1045 $
714 £

Catalog number: 431-97279-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys

3464 €
3932 $
2687 £

Catalog number: 431-97279-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Biotin-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser

727 €
825 $
564 £

Catalog number: 431-98093-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Biotin-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser

986 €
1119 $
765 £

Catalog number: 431-98093-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH

1665 €
1890 $
1292 £

Catalog number: 431-63720-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Biotin-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser

339 €
384 $
263 £

Catalog number: 431-98093-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH

1018 €
1156 $
790 £

Catalog number: 431-63720-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH

475 €
539 $
368 £

Catalog number: 431-63720-1
Product Quantity: 1mg
Category:
Supplier:
[Pyr3]-Amyloid β-Protein (3-42) [Pyr-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala; MW 430

724 €
822 $
561 £

Catalog number: SP-89299-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Pyr-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala; MF C196H299N53O55S; MW 4309

1795 €
2037 $
1392 £

Catalog number: 431-98187-3
Product Quantity: 10 mg
Category: Peptides
Supplier:
Sequence Pyr-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala; MF C196H299N53O55S; MW 4309

1083 €
1230 $
840 £

Catalog number: 431-98187-2
Product Quantity: 5 mg
Category: Peptides
Supplier:
Sequence Pyr-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala; MF C196H299N53O55S; MW 4309

509 €
578 $
395 £

Catalog number: 431-98187-1
Product Quantity: 1mg
Category: Peptides
Supplier:
[Gln22] - 25359 - Amyloid (6 - 40) [His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MW: 3710.26]

557 €
632 $
432 £

Catalog number: SP-87936-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C167H258N46O48S; MW 3710.26

440 €
500 $
341 £

Catalog number: 431-96824-1
Product Quantity: 1mg
Category:
Supplier:
Sequence His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C167H258N46O48S; MW 3710.26

1471 €
1669 $
1141 £

Catalog number: 431-96824-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C167H258N46O48S; MW 3710.26

970 €
1101 $
752 £

Catalog number: 431-96824-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Asn-Ala-Lys-Arg-Lys-Arg-Ile-His-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Tyr-Thr-Thr-Lys-Asn-Ile-Ile; MF C135H221N45O33; MW 3002.55

775 €
880 $
601 £

Catalog number: 431-109930-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Asn-Ala-Lys-Arg-Lys-Arg-Ile-His-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Tyr-Thr-Thr-Lys-Asn-Ile-Ile; MF C135H221N45O33; MW 3002.55

543 €
616 $
421 £

Catalog number: 431-109930-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Asn-Ala-Lys-Arg-Lys-Arg-Ile-His-Ile-Gln-Arg-Gly-Pro-Gly-Arg-Ala-Phe-Tyr-Thr-Thr-Lys-Asn-Ile-Ile; MF C135H221N45O33; MW 3002.55

307 €
348 $
238 £

Catalog number: 431-109930-1
Product Quantity: 1mg
Category:
Supplier:
Rcramp (AA: Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln) (MW: 3946.73)

390 €
443 $
302 £

Catalog number: SP-88331-1
Product Quantity: 1 mg
Category:
Supplier: ADI
ã_TAC4 (30 _ 61) _ NH2 Formula C155H242N40O49S Sequence Thr_Glu_Ala_Glu_Thr_Trp_Glu_Gly_Ala_Gly_Pro_Ser_Ile_Gln_Leu_Gln_Leu_Gln_Glu_Val_Lys_Thr_Gly_Lys_Ala_Ser_Gln_Phe_Phe_Gly_Leu_Met_NH2

239 €
272 $
185 £

Catalog number: 86686
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln; MF C178H302N50O46; MW 3878.70

970 €
1101 $
752 £

Catalog number: 431-97216-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln; MF C178H302N50O46; MW 3878.70

339 €
384 $
263 £

Catalog number: 431-97216-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln; MF C178H302N50O46; MW 3878.70

679 €
771 $
527 £

Catalog number: 431-97216-2
Product Quantity: 5 mg
Category:
Supplier:
BNP_32, rat Formula C146H239N47O44S3 Sequence Asn_Ser_Lys_Met_Ala_His_Ser_Ser_Ser_Cys_Phe_Gly_Gln_Lys_Ile_Asp_Arg_Ile_Gly_Ala_Val_Ser_Arg_Leu_Gly_Cys_Asp_ Gly_Leu_Arg_Leu_Phe(Disulfide bridge Cys10_

240 €
273 $
186 £

Catalog number: 55422
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp- Gly-Leu-Arg-Leu-Phe(Disulfide bridge Cys10-Cys26); MF C146H239N47O44S3; MW 3453

323 €
366 $
250 £

Catalog number: 431-64310-1
Product Quantity: 500
Category:
Supplier:
Sequence Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp- Gly-Leu-Arg-Leu-Phe(Disulfide bridge Cys10-Cys26); MF C146H239N47O44S3; MW 3453

662 €
751 $
513 £

Catalog number: 431-64310-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp- Gly-Leu-Arg-Leu-Phe(Disulfide bridge Cys10-Cys26); MF C146H239N47O44S3; MW 3453

440 €
500 $
341 £

Catalog number: 431-64310-2
Product Quantity: 1mg
Category:
Supplier:
Sequence His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Ile-Lys-Asn-Lys-NH2; MF C204H333N63O53S; MW 4548.38

954 €
1083 $
740 £

Catalog number: 431-64292-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Ile-Lys-Asn-Lys-NH2; MF C204H333N63O53S; MW 4548.38

1341 €
1522 $
1040 £

Catalog number: 431-64292-3
Product Quantity: 10 mg
Category:
Supplier:
 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur