GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, sales@genprice.com

Full view Results
FRETS_25Ala

324 €
367 $
251 £

Catalog number: 3701-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_VWF73

623 €
707 $
483 £

Catalog number: 3224-s
Product Quantity: 0.1mg
Category:
Supplier: Sceti K.K.
FRETS_25Leu

324 €
367 $
251 £

Catalog number: 3710-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Ile

324 €
367 $
251 £

Catalog number: 3709-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25His

324 €
367 $
251 £

Catalog number: 3708-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Gly

324 €
367 $
251 £

Catalog number: 3707-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Glu

324 €
367 $
251 £

Catalog number: 3706-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Gln

324 €
367 $
251 £

Catalog number: 3705-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Asp

324 €
367 $
251 £

Catalog number: 3704-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Asn

324 €
367 $
251 £

Catalog number: 3703-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Arg

324 €
367 $
251 £

Catalog number: 3702-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Lys

324 €
367 $
251 £

Catalog number: 3711-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Met

324 €
367 $
251 £

Catalog number: 3712-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25_STD2

224 €
255 $
174 £

Catalog number: 3721-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25_STD1

224 €
255 $
174 £

Catalog number: 3720-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Val

324 €
367 $
251 £

Catalog number: 3719-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Tyr

324 €
367 $
251 £

Catalog number: 3718-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Trp

324 €
367 $
251 £

Catalog number: 3717-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Thr

324 €
367 $
251 £

Catalog number: 3716-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Ser

324 €
367 $
251 £

Catalog number: 3715-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Pro

324 €
367 $
251 £

Catalog number: 3714-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS_25Phe

324 €
367 $
251 £

Catalog number: 3713-v
Product Quantity: 1ìmol
Category:
Supplier: Sceti K.K.
FRETS - VWF73 (Fluorescence - Quenching Substrate for ADAMTS - 13)DRE - Dap(Nma) - APNLVYMVTG - Dpa - PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR

743 €
844 $
576 £

Catalog number: KP0749
Product Quantity: 1 mg
Category:
Supplier: KareBay
FRETS - VWF73 (Fluorescence - Quenching Substrate for ADAMTS - 13)DRE - Dap(Nma) - APNLVYMVTG - Dpa - PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR

1353 €
1536 $
1049 £

Catalog number: KP0750
Product Quantity: 2 mg
Category:
Supplier: KareBay
 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur