GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908,

Full view Results
Fibrinogen Related Peptide Formula C62H99N23O21 Sequence Gly_Gln_Gln_His_His_Leu_Gly_Gly_Ala_Lys_Gln_Ala_Gly_Asp_Val

158 €
179 $
122 £

Catalog number: 88463
Product Quantity: 1mg
Supplier: GLSChina
Fibrinogen Related Peptide (AA: Gly-Gln-Gln-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val) (MW: 1502.62)

223 €
253 $
173 £

Catalog number: SP-88463-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Gly-Gln-Gln-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val; MF C62H99N23O21; MW 1502.62

257 €
292 $
200 £

Catalog number: 431-97351-1
Product Quantity: 1mg
Sequence Gly-Gln-Gln-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val; MF C62H99N23O21; MW 1502.62

355 €
403 $
275 £

Catalog number: 431-97351-2
Product Quantity: 5 mg
Sequence Gly-Gln-Gln-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val; MF C62H99N23O21; MW 1502.62

543 €
616 $
421 £

Catalog number: 431-97351-3
Product Quantity: 10 mg
MF C62H99N23O21 ; MW 1502.60 ; GQQHHLGGAKQAGDV, Gly-Gln-Gln-His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val

307 €
348 $
238 £

Catalog number: RB-PP-0655
Product Quantity: 1 mg
[Tyr0]_C_Peptide (human) Formula C138H220N36O50 Sequence Tyr_Glu_Ala_Glu_Asp_Leu_Gln_Val_Gly_Gln_Val_Glu_Leu_Gly_Gly_Gly_Pro_Gly_Ala_Gly_Ser_Leu_Gln_Pro_Leu_Ala_Leu_Glu_Gly_Ser_Leu_Gln

236 €
268 $
183 £

Catalog number: 89542
Product Quantity: 1mg
Supplier: GLSChina
Intermedin (human) Formula C219H351N69O66S3 Sequence Thr_Gln_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Met_Gly_Pro_Ala_Gly_Arg_Gln_Asp_Ser_A

378 €
429 $
293 £

Catalog number: 54832
Product Quantity: 1mg
Supplier: GLSChina
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C114H174N34O31; MW 2516.87

307 €
348 $
238 £

Catalog number: 431-63953-1
Product Quantity: 1mg
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C114H174N34O31; MW 2516.87

509 €
578 $
395 £

Catalog number: 431-63953-2
Product Quantity: 5 mg
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C114H174N34O31; MW 2516.87

727 €
825 $
564 £

Catalog number: 431-63953-3
Product Quantity: 10 mg
Obestatin, rat, mouse (AA: Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2) (MW: 2516.87)

306 €
347 $
237 £

Catalog number: SP-55065-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C124H188N36O33; MW 2743.17

509 €
578 $
395 £

Catalog number: 431-109325-2
Product Quantity: 5 mg
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C124H188N36O33; MW 2743.17

307 €
348 $
238 £

Catalog number: 431-109325-1
Product Quantity: 1mg
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2; MF C124H188N36O33; MW 2743.17

727 €
825 $
564 £

Catalog number: 431-109325-3
Product Quantity: 10 mg
Obestatin, rat, mouse Formula C114H174N34O31 Sequence Phe_Asn_Ala_Pro_Phe_Asp_Val_Gly_Ile_Lys_Leu_Ser_Gly_Ala_Gln_Tyr_Gln_Gln_His_Gly_Arg_Ala_Leu_NH2

199 €
225 $
154 £

Catalog number: 55065
Product Quantity: 1mg
Supplier: GLSChina
Hypocretin (70_98) (human) Formula C125H214N44O37S1 Sequence Arg_Ser_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_Gly

220 €
250 $
170 £

Catalog number: 100438
Product Quantity: 1mg
Supplier: GLSChina
Intermedin_53 (human) Formula C247H397N83O73S3 Sequence His_Ser_Gly_Pro_Arg_Arg_Thr_Gln_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Met_Gly_Pr

414 €
469 $
321 £

Catalog number: 89208
Product Quantity: 1mg
Supplier: GLSChina
Sequence Tyr-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln; MF C138H220N36O50; MW 3183.50

954 €
1083 $
740 £

Catalog number: 431-98430-3
Product Quantity: 10 mg
Sequence Tyr-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln; MF C138H220N36O50; MW 3183.50

323 €
366 $
250 £

Catalog number: 431-98430-1
Product Quantity: 1mg
Sequence Tyr-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln; MF C138H220N36O50; MW 3183.50

662 €
751 $
513 £

Catalog number: 431-98430-2
Product Quantity: 5 mg
C_Peptide (57_87), human Formula C129H211N35O48 Sequence Glu_Ala_Glu_Asp_Leu_Gln_Val_Gly_Gln_Val_Glu_Leu_Gly_Gly_Gly_Pro_Gly_Ala_Gly_Ser_Leu_Gln_Pro_Leu_Ala_Leu_Glu_Gly_Ser_Leu_Gln

323 €
366 $
250 £

Catalog number: 51895
Product Quantity: 1mg
Supplier: GLSChina
[Tyr0]-C-Peptide (human) [Tyr-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln; MW 3183.50]

472 €
536 $
366 £

Catalog number: SP-89542-1
Product Quantity: 1 mg
Supplier: ADI
Biotin_Intermedin (human) Formula C229H353N71O68S4 Sequence Biotin_Thr_Gln_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Met_Gly_Pro_Ala_Gly_Arg

257 €
292 $
200 £

Catalog number: 89205
Product Quantity: 1mg
Supplier: GLSChina
NTproBNP(1_76) Formula C364H596N114O116S Sequence His_Pro_Leu_Gly_Ser_Pro_Gly_Ser_Ala_Ser_Asp_Leu_Glu_Thr_Ser_Gly_Leu_Gln_Glu_Gln_Arg_Asn_His_Leu_Gln_Gly_Lys_Leu_Ser_Glu_Leu_Gln_Val_Glu_Gln_Thr_Ser_

658 €
746 $
510 £

Catalog number: 72959
Product Quantity: 1mg
Category: Peptides
Supplier: GLSChina
Orexin B, canine Formula C125H214N44O34S1 Sequence Arg_Pro_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

215 €
244 $
166 £

Catalog number: 55233
Product Quantity: 0.5mg
Supplier: GLSChina
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly; MF C125H214N44O37S; MW 2957.4

323 €
366 $
250 £

Catalog number: 431-109326-1
Product Quantity: 1mg
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly; MF C125H214N44O37S; MW 2957.4

594 €
675 $
461 £

Catalog number: 431-109326-2
Product Quantity: 5 mg
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly; MF C125H214N44O37S; MW 2957.4

857 €
972 $
664 £

Catalog number: 431-109326-3
Product Quantity: 10 mg
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2; MF C104H151N25O26S; MW 2199.58

679 €
771 $
527 £

Catalog number: 431-64100-3
Product Quantity: 10 mg
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2; MF C104H151N25O26S; MW 2199.58

274 €
312 $
213 £

Catalog number: 431-64100-1
Product Quantity: 1mg
Galantide Formula C104H151N25O26S1 Sequence Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_Gln_Gln_Phe_Phe_Gly_Leu_Met_NH2

186 €
211 $
144 £

Catalog number: 55212
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2; MF C104H151N25O26S; MW 2199.58

475 €
539 $
368 £

Catalog number: 431-64100-2
Product Quantity: 5 mg
[Ala11,D_Leu15]_Orexin B (human) Formula C120H206N44O35S Sequence Arg_Ser_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Ala_Gln_Arg_Leu_D_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

247 €
280 $
191 £

Catalog number: 100439
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gly-Trp-Pro-Gln-Ala-Pro-Ala-Met-Asp-Gly-Ala-Gly-Lys-Thr-Gly-Ala-Glu-Glu-Ala-Gln-Pro-Pro-Glu-Gly-Lys-Gly-Ala-Arg-Glu-His-Ser-Arg-Gln-Glu-Glu-Glu-Glu-Glu-Thr-Ala-Gly-Ala-Pro-Gln-Gly-Leu-Phe-Ar

921 €
1045 $
714 £

Catalog number: 431-61180-2
Product Quantity: 1mg
Sequence Gly-Trp-Pro-Gln-Ala-Pro-Ala-Met-Asp-Gly-Ala-Gly-Lys-Thr-Gly-Ala-Glu-Glu-Ala-Gln-Pro-Pro-Glu-Gly-Lys-Gly-Ala-Arg-Glu-His-Ser-Arg-Gln-Glu-Glu-Glu-Glu-Glu-Thr-Ala-Gly-Ala-Pro-Gln-Gly-Leu-Phe-Ar

1341 €
1522 $
1040 £

Catalog number: 431-61180-3
Product Quantity: 2.5 mg
Sequence Gly-Trp-Pro-Gln-Ala-Pro-Ala-Met-Asp-Gly-Ala-Gly-Lys-Thr-Gly-Ala-Glu-Glu-Ala-Gln-Pro-Pro-Glu-Gly-Lys-Gly-Ala-Arg-Glu-His-Ser-Arg-Gln-Glu-Glu-Glu-Glu-Glu-Thr-Ala-Gly-Ala-Pro-Gln-Gly-Leu-Phe-Ar

594 €
675 $
461 £

Catalog number: 431-61180-1
Product Quantity: 500
Sequence Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C162H268N50O54; MW 3780.24

986 €
1119 $
765 £

Catalog number: 431-98433-3
Product Quantity: 10 mg
Sequence Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C162H268N50O54; MW 3780.24

339 €
384 $
263 £

Catalog number: 431-98433-1
Product Quantity: 1mg
Sequence Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C162H268N50O54; MW 3780.24

695 €
789 $
539 £

Catalog number: 431-98433-2
Product Quantity: 5 mg
Galantide [H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-NH2; MW:2199.58]

390 €
443 $
302 £

Catalog number: SP-55212-1
Product Quantity: 0.5 mg
Supplier: ADI
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C125H214N44O34S; MW 2909.44

576 €
654 $
447 £

Catalog number: 431-64121-3
Product Quantity: 2.5 mg
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C125H214N44O34S; MW 2909.44

307 €
348 $
238 £

Catalog number: 431-64121-1
Product Quantity: 500
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C125H214N44O34S; MW 2909.44

373 €
423 $
289 £

Catalog number: 431-64121-2
Product Quantity: 1mg
Sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln; MF C129H211N35O48; MW 3020.33

407 €
462 $
316 £

Catalog number: 431-60783-1
Product Quantity: 1mg
Sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln; MF C129H211N35O48; MW 3020.33

921 €
1045 $
714 £

Catalog number: 431-60783-2
Product Quantity: 5 mg
Sequence Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln; MF C129H211N35O48; MW 3020.33

1341 €
1522 $
1040 £

Catalog number: 431-60783-3
Product Quantity: 10 mg
Orexin B, human Formula C123H212N44O35S1 Sequence Arg_Ser_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

215 €
244 $
166 £

Catalog number: 54422
Product Quantity: 0.5mg
Supplier: GLSChina
Hypocretin (70-98) (human) (AA: Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly) (MW: 2957.4)

390 €
443 $
302 £

Catalog number: SP-100438-1
Product Quantity: 1 mg
Supplier: ADI
Biotin_Obestatin (rat) Formula C124H188N36O33 Sequence Biotin_Phe_Asn_Ala_Pro_Phe_Asp_Val_Gly_Ile_Lys_Leu_Ser_Gly_Ala_Gln_Tyr_Gln_Gln_His_Gly_Arg_Ala_Leu_NH2

193 €
219 $
150 £

Catalog number: 100437
Product Quantity: 1mg
Supplier: GLSChina
[Ala11, D-Leu15]-Orexin B (human) [Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 2857.28]

390 €
443 $
302 £

Catalog number: SP-100439-1
Product Quantity: 1 mg
Supplier: ADI
Biotin-Obestatin (rat) (AA: Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Ala-Gln-Tyr-Gln-Gln-His-Gly-Arg-Ala-Leu-NH2) (MW: 2743.17)

306 €
347 $
237 £

Catalog number: SP-100437-1
Product Quantity: 1 mg
Supplier: ADI
Orexin B, Canine [H-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 299.44]

318 €
361 $
247 £

Catalog number: SP-55233-5
Product Quantity: 0.5 mg
Supplier: ADI
Sequence Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C153H259N49O52; MW 3617.07

1148 €
1303 $
890 £

Catalog number: 431-97127-3
Product Quantity: 10 mg
Sequence Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C153H259N49O52; MW 3617.07

857 €
972 $
664 £

Catalog number: 431-97127-2
Product Quantity: 5 mg
Sequence Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C153H259N49O52; MW 3617.07

373 €
423 $
289 £

Catalog number: 431-97127-1
Product Quantity: 1mg
Proinsulin C - peptide (55 - 89), human (AA: Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg) (MW: 3617.07)

390 €
443 $
302 £

Catalog number: SP-88239-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C123H212N44O35S; MW 2899.4

307 €
348 $
238 £

Catalog number: 431-63310-1
Product Quantity: 500
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C123H212N44O35S; MW 2899.4

373 €
423 $
289 £

Catalog number: 431-63310-2
Product Quantity: 1mg
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C123H212N44O35S; MW 2899.4

576 €
654 $
447 £

Catalog number: 431-63310-3
Product Quantity: 2.5 mg
Tyr_Proinsulin C_Peptide (55_89) (human) Formula C162H268N50O54 Sequence Tyr_Arg_Arg_Glu_Ala_Glu_Asp_Leu_Gln_Val_Gly_Gln_Val_Glu_Leu_Gly_Gly_Gly_Pro_Gly_Ala_Gly_Ser_Leu_Gln_Pro_Leu_Ala_Leu_Glu_Gly_S

253 €
287 $
196 £

Catalog number: 89545
Product Quantity: 1mg
Supplier: GLSChina
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C120H206N44O35S; MW 2857.28

970 €
1101 $
752 £

Catalog number: 431-109327-3
Product Quantity: 10 mg
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C120H206N44O35S; MW 2857.28

679 €
771 $
527 £

Catalog number: 431-109327-2
Product Quantity: 5 mg
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C120H206N44O35S; MW 2857.28

339 €
384 $
263 £

Catalog number: 431-109327-1
Product Quantity: 1mg
Pancreastatin, porcine Formula C214H330N68O76S Sequence Gly_Trp_Pro_Gln_Ala_Pro_Ala_Met_Asp_Gly_Ala_Gly_Lys_Thr_Gly_Ala_Glu_Glu_Ala_Gln_Pro_Pro_Glu_Gly_Lys_Gly_Ala_Arg_Glu_His_Ser_Arg_Gln_Glu_Glu_Gl

479 €
544 $
371 £

Catalog number: 52292
Product Quantity: 0.5mg
Supplier: GLSChina
Proinsulin C _ Peptide (31 _63), porcine Formula C142H239N47O46 Sequence Arg_Arg_Glu_Ala_Glu_Asn_Pro_Gln_Ala_Gly_Ala_Val_Glu_Leu_Gly_Gly_Gly_Leu_Gly_Gly_Leu_Gln_Ala_Leu_Ala_Leu_Glu_Gly_Pro_Pro_Gln_L

289 €
329 $
224 £

Catalog number: 88238
Product Quantity: 1mg
Supplier: GLSChina
Sequence Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C145H238N48O38S2; MW 3325.9

970 €
1101 $
752 £

Catalog number: 431-110016-3
Product Quantity: 10 mg
Orexin B, rat, mouse Formula C126H215N45O34S1 Sequence Arg_Pro_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Asn_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

215 €
244 $
166 £

Catalog number: 55234
Product Quantity: 0.5mg
Supplier: GLSChina
Sequence Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C145H238N48O38S2; MW 3325.9

679 €
771 $
527 £

Catalog number: 431-110016-2
Product Quantity: 5 mg
Sequence Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C145H238N48O38S2; MW 3325.9

339 €
384 $
263 £

Catalog number: 431-110016-1
Product Quantity: 1mg
Tyr-Proinsulin C-Peptide (55-89) (human) (AA: Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg) (MW: 3780

390 €
443 $
302 £

Catalog number: SP-89545-1
Product Quantity: 1 mg
Supplier: ADI
Orexin-B, Human [Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 2899.4]

390 €
443 $
302 £

Catalog number: SP-54422-5
Product Quantity: 0.5 mg
Supplier: ADI

324 €
367 $
251 £

Catalog number: 3087-v
Product Quantity: 2.5mg
Supplier: Sceti K.K.
Biotin_[Tyr0]_Orexin B, mouse,rat Formula C145H238N48O38S2 Sequence Biotin_Tyr_Arg_Pro_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Asn_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

241 €
274 $
187 £

Catalog number: 101128
Product Quantity: 1mg
Supplier: GLSChina
Adrenomedullin (1_ 52),porcine Formula C262H403N79O76S3 Sequence Tyr_Arg_Gln_Ser_Met_Asn_Asn_Phe_Gln_Gly_Leu_Arg_Ser_Phe_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Val_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_T

433 €
491 $
336 £

Catalog number: 100825
Product Quantity: 1mg
Supplier: GLSChina
Apelin_36, human Formula C184H297N69O43S Sequence Leu_Val_Gln_Pro_Arg_Gly_Ser_Arg_Asn_Gly_Pro_Gly_Pro_Trp_Gln_Gly_Gly_Arg_Arg_Lys_Phe_Arg_Arg_Gln_Arg_Pro_Arg_Leu_Ser_His_Lys_Gly_Pro_Met_Pro_Phe

253 €
287 $
196 £

Catalog number: 71114
Product Quantity: 1mg
Supplier: GLSChina
[Tyr4]-Bombesin [Pyr-Gln-Arg-Tyr-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met- NH2; MW 1669.9]

390 €
443 $
302 £

Catalog number: SP-89336-2
Product Quantity: 2mg
Supplier: ADI
[Tyr4] Bombesin [pGlu-Gln-Arg-Tyr-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MW: 1669.9]

190 €
216 $
147 £

Catalog number: SP-55150-1
Product Quantity: 1 mg
Supplier: ADI
Proinsulin C _ peptide (55 _89), human Formula C153H259N49O52 Sequence Arg_Arg_Glu_Ala_Glu_Asp_Leu_Gln_Val_Gly_Gln_Val_Glu_Leu_Gly_Gly_Gly_Pro_Gly_Ala_Gly_Ser_Leu_Gln_Pro_Leu_Ala_Leu_Glu_Gly_Ser_Leu

300 €
341 $
233 £

Catalog number: 88239
Product Quantity: 1mg
Supplier: GLSChina
Sequence Thr-Glu-Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys-Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu-Met-NH2; MF C155H242N40O49S; MW 3481.96

954 €
1083 $
740 £

Catalog number: 431-95574-3
Product Quantity: 10 mg
Category: Peptides
Sequence Thr-Glu-Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys-Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu-Met-NH2; MF C155H242N40O49S; MW 3481.96

662 €
751 $
513 £

Catalog number: 431-95574-2
Product Quantity: 5 mg
Category: Peptides
Sequence Thr-Glu-Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys-Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu-Met-NH2; MF C155H242N40O49S; MW 3481.96

323 €
366 $
250 £

Catalog number: 431-95574-1
Product Quantity: 1mg
Category: Peptides
Hepatitus B Virus Pre-S Region (120-145) (AA: Met-Gln-Trp-Asn-Ser-Thr-Thr-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Phe-Pro-Ala-Gly-Gly) (MW: 3008.4)

306 €
347 $
237 £

Catalog number: SP-54781-1
Product Quantity: 1 mg
Supplier: ADI
Hepatitus B Virus Pre_S Region (120_145) Formula C135H199N39O38S1 Sequence Met_Gln_Trp_Asn_Ser_Thr_Thr_Phe_His_Gln_Thr_Leu_Gln_Asp_Pro_Arg_Val_Arg_Gly_Leu_Tyr_Phe_Pro_Ala_Gly_Gly

207 €
235 $
161 £

Catalog number: 54781
Product Quantity: 1mg
Supplier: GLSChina
mCRAMP, mouse Formula C178H302N50O46 Sequence Gly_Leu_Leu_Arg_Lys_Gly_Gly_Glu_Lys_Ile_Gly_Glu_Lys_Leu_Lys_Lys_Ile_Gly_Gln_Lys_Ile_Lys_Asn_Phe_Phe_Gln_Lys_Leu_Val_Pro_Gln_Pro_Glu_Gln

243 €
276 $
189 £

Catalog number: 88328
Product Quantity: 1mg
Supplier: GLSChina
Sequence Pyr-Gln-Arg-Tyr-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met- NH2; MF C74H108N24O19S1; MW 1669.9

307 €
348 $
238 £

Catalog number: 431-98224-1
Product Quantity: 2mg
Sequence Pyr-Gln-Arg-Tyr-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met- NH2; MF C74H108N24O19S1; MW 1669.9

1148 €
1303 $
890 £

Catalog number: 431-98224-3
Product Quantity: 10 mg
Sequence Pyr-Gln-Arg-Tyr-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met- NH2; MF C74H108N24O19S1; MW 1669.9

373 €
423 $
289 £

Catalog number: 431-98224-2
Product Quantity: 5 mg
Sequence Met-Gln-Trp-Asn-Ser-Thr-Thr-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Phe-Pro-Ala-Gly-Gly; MF C135H199N39O38S; MW 3008.4

307 €
348 $
238 £

Catalog number: 431-63669-1
Product Quantity: 1mg
Sequence Met-Gln-Trp-Asn-Ser-Thr-Thr-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Phe-Pro-Ala-Gly-Gly; MF C135H199N39O38S; MW 3008.4

775 €
880 $
601 £

Catalog number: 431-63669-3
Product Quantity: 10 mg
Sequence Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly; MF C131H199N39O37S; MW 2944.35

576 €
654 $
447 £

Catalog number: 431-98012-2
Product Quantity: 5 mg
Sequence Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly; MF C131H199N39O37S; MW 2944.35

775 €
880 $
601 £

Catalog number: 431-98012-3
Product Quantity: 10 mg
Pre_S2 (1_26) Formula C131H199N39O37S Sequence Met_Gln_Trp_Asn_Ser_Thr_Ala_Phe_His_Gln_Thr_Leu_Gln_Asp_Pro_Arg_Val_Arg_Gly_Leu_Tyr_Leu_Pro_Ala_Gly_Gly

207 €
235 $
161 £

Catalog number: 89124
Product Quantity: 1mg
Supplier: GLSChina
Sequence Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly; MF C131H199N39O37S; MW 2944.35

307 €
348 $
238 £

Catalog number: 431-98012-1
Product Quantity: 1mg
Sequence Met-Gln-Trp-Asn-Ser-Thr-Thr-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Phe-Pro-Ala-Gly-Gly; MF C135H199N39O38S; MW 3008.4

576 €
654 $
447 £

Catalog number: 431-63669-2
Product Quantity: 5 mg

308 €
349 $
239 £

Catalog number: 3088-v
Product Quantity: 2.5mg
Supplier: Sceti K.K.
Obestatin, human Formula C16H176N32O33 Sequence Phe_Asn_Ala_Pro_Phe_Asp_Val_Gly_Ile_Lys_Leu_Ser_Gly_Val_Gln_Tyr_Gln_Gln_His_Ser_Gln_Ala_Leu_NH2

199 €
225 $
154 £

Catalog number: 52792
Product Quantity: 1mg
Supplier: GLSChina
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C126H190N34O35; MW 2773.19

307 €
348 $
238 £

Catalog number: 431-109324-1
Product Quantity: 1mg
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C126H190N34O35; MW 2773.19

509 €
578 $
395 £

Catalog number: 431-109324-2
Product Quantity: 5 mg
Sequence Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C126H190N34O35; MW 2773.19

727 €
825 $
564 £

Catalog number: 431-109324-3
Product Quantity: 10 mg
Sequence Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val; MF C139H232N52O47S7; MW 3624.11

274 €
312 $
213 £

Catalog number: 431-111930-1
Product Quantity: 1mg
Sequence Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val; MF C139H232N52O47S7; MW 3624.11

679 €
771 $
527 £

Catalog number: 431-111930-3
Product Quantity: 10 mg
á_Conotoxin GS Formula C139H232N52O47S7 Sequence Ala_Cys_Ser_Gly_Arg_Gly_Ser_Arg_Cys_Hyp_Hyp_Gln_Cys_Cys_Met_Gly_Leu_Arg_Cys_Gly_Arg_Gly_Asn_Pro_Gln_Lys_Cys_Ile_Gly_Ala_His_Gla_Asp_Val

184 €
208 $
142 £

Catalog number: 103042
Product Quantity: 1mg
Supplier: GLSChina
Sequence Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val; MF C139H232N52O47S7; MW 3624.11

475 €
539 $
368 £

Catalog number: 431-111930-2
Product Quantity: 5 mg
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C16H176N32O33; MW 2546.89

727 €
825 $
564 £

Catalog number: 431-61680-3
Product Quantity: 10 mg
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C16H176N32O33; MW 2546.89

307 €
348 $
238 £

Catalog number: 431-61680-1
Product Quantity: 1mg
Sequence Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2; MF C16H176N32O33; MW 2546.89

509 €
578 $
395 £

Catalog number: 431-61680-2
Product Quantity: 5 mg
Biotin-[Tyr0]-Orexin B, mouse, rat (AA: Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2) (MW: 3325.9)

390 €
443 $
302 £

Catalog number: SP-101128-1
Product Quantity: 1 mg
Supplier: ADI
C_Peptide 2 (rat) Formula C135H222N38O49 Sequence Glu_Val_Glu_Asp_Pro_Gln_Val_Ala_Gln_Leu_Glu_Leu_Gly_Gly_Gly_Pro_Gly_Ala_Gly_Asp_Leu_Gln_Thr_Leu_Ala_Leu_Glu_Val_Ala_Arg_Gln

231 €
262 $
179 £

Catalog number: 89544
Product Quantity: 1mg
Supplier: GLSChina
Orexin B, Rat, Mouse [H-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 2936.46]

318 €
361 $
247 £

Catalog number: SP-55234-5
Product Quantity: 0.5 mg
Supplier: ADI
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg- Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C126H215N45O34S; MW 2936.46

373 €
423 $
289 £

Catalog number: 431-64122-2
Product Quantity: 1mg
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg- Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C126H215N45O34S; MW 2936.46

576 €
654 $
447 £

Catalog number: 431-64122-3
Product Quantity: 2.5 mg
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg- Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C126H215N45O34S; MW 2936.46

307 €
348 $
238 £

Catalog number: 431-64122-1
Product Quantity: 500
[Tyr4,D-Phe12]-Bombesin [Pyr-Gln-Arg-Tyr-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Met- NH2; MW 1579.95]

390 €
443 $
302 £

Catalog number: SP-89337-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Pyr-Gln-Arg-Tyr-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Met- NH2; MF C77H110N22O19S; MW 1579.95

857 €
972 $
664 £

Catalog number: 431-98225-3
Product Quantity: 25 mg
[Tyr4]_Bombesin Formula C74H108N24O19S1 Sequence Pyr_Gln_Arg_Tyr_Gly_Asn_Gln_Trp_Ala_Val_Gly_His_Leu_Met_NH2

300 €
341 $
233 £

Catalog number: 89336
Product Quantity: 5mg
Supplier: GLSChina
Sequence Pyr-Gln-Arg-Tyr-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Met- NH2; MF C77H110N22O19S; MW 1579.95

355 €
403 $
275 £

Catalog number: 431-98225-1
Product Quantity: 5 mg
Sequence Pyr-Gln-Arg-Tyr-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Met- NH2; MF C77H110N22O19S; MW 1579.95

509 €
578 $
395 £

Catalog number: 431-98225-2
Product Quantity: 10 mg
Sequence Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe; MF C184H297N69O43S; MW 4195.92

695 €
789 $
539 £

Catalog number: 431-80002-2
Product Quantity: 5 mg
Sequence Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe; MF C184H297N69O43S; MW 4195.92

339 €
384 $
263 £

Catalog number: 431-80002-1
Product Quantity: 1mg
Sequence Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe; MF C184H297N69O43S; MW 4195.92

986 €
1119 $
765 £

Catalog number: 431-80002-3
Product Quantity: 10 mg
Obestatin, human (AA: Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2) (MW: 2546.89)

306 €
347 $
237 £

Catalog number: SP-52792-1
Product Quantity: 1 mg
Supplier: ADI
Adrenomedullin (1_50), rat Formula C248H381N77O75S5 Sequence Tyr_Arg_Gln_Ser_Met_Asn_Gln_Gly_Ser_Arg_Ser_Thr_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Met_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr_Asp_Lys_A

433 €
491 $
336 £

Catalog number: 100046
Product Quantity: 1mg
Supplier: GLSChina
Adrenomedullin (1_52), human Formula C264H406N80O77S3 Sequence Tyr_Arg_Gln_Ser_Met_Asn_Asn_Phe_Gln_Gly_Leu_Arg_Ser_Phe_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Val_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr

433 €
491 $
336 £

Catalog number: 55426
Product Quantity: 1mg
Supplier: GLSChina
Pre-S2 (1-26) (AA: Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly) (MW: 2944.35)

306 €
347 $
237 £

Catalog number: SP-89124-1
Product Quantity: 1 mg
Supplier: ADI

724 €
822 $
561 £

Catalog number: SP-89208-1
Product Quantity: 1 mg
Supplier: ADI
α-Conotoxin GS (AA: Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val) (MW: 3624.11)

223 €
253 $
173 £

Catalog number: SP-103042-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln; MF C178H302N50O46; MW 3878.70

970 €
1101 $
752 £

Catalog number: 431-97216-3
Product Quantity: 10 mg
Sequence Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln; MF C178H302N50O46; MW 3878.70

339 €
384 $
263 £

Catalog number: 431-97216-1
Product Quantity: 1mg
Sequence Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln; MF C178H302N50O46; MW 3878.70

679 €
771 $
527 £

Catalog number: 431-97216-2
Product Quantity: 5 mg
Proinsulin C - Peptide (31 - 63), porcine (AA: Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg) (MW: 3340.78)

472 €
536 $
366 £

Catalog number: SP-88238-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg; MF C142H239N47O46; MW 3340.78

775 €
880 $
601 £

Catalog number: 431-97126-2
Product Quantity: 5 mg
Sequence Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg; MF C142H239N47O46; MW 3340.78

1116 €
1266 $
865 £

Catalog number: 431-97126-3
Product Quantity: 10 mg
Sequence Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg; MF C142H239N47O46; MW 3340.78

355 €
403 $
275 £

Catalog number: 431-97126-1
Product Quantity: 1mg
[Tyr4,D_Phe12]_Bombesin Formula C77H110N22O19S Sequence Pyr_Gln_Arg_Tyr_Gly_Asn_Gln_Trp_Ala_Val_Gly_D_Phe_Leu_Met_NH2

281 €
319 $
218 £

Catalog number: 89337
Product Quantity: 5mg
Supplier: GLSChina
Apelin-36, human (AA: Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe) (MW: 4195.92)

390 €
443 $
302 £

Catalog number: SP-71114-1
Product Quantity: 1 mg
Supplier: ADI
MF C162H268N50O54 ; MW 3780.18 ; YRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR, Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-

407 €
462 $
316 £

Catalog number: RB-PP-1561
Product Quantity: 1 mg
ã_TAC4 (30 _ 61) _ NH2 Formula C155H242N40O49S Sequence Thr_Glu_Ala_Glu_Thr_Trp_Glu_Gly_Ala_Gly_Pro_Ser_Ile_Gln_Leu_Gln_Leu_Gln_Glu_Val_Lys_Thr_Gly_Lys_Ala_Ser_Gln_Phe_Phe_Gly_Leu_Met_NH2

239 €
272 $
185 £

Catalog number: 86686
Product Quantity: 1mg
Supplier: GLSChina
Sequence Glu-Val-Glu-Asp-Pro-Gln-Val-Ala-Gln-Leu-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Asp-Leu-Gln-Thr-Leu-Ala-Leu-Glu-Val-Ala-Arg-Gln; MF C135H222N38O49; MW 3161.50

613 €
695 $
475 £

Catalog number: 431-98432-2
Product Quantity: 5 mg
Sequence Glu-Val-Glu-Asp-Pro-Gln-Val-Ala-Gln-Leu-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Asp-Leu-Gln-Thr-Leu-Ala-Leu-Glu-Val-Ala-Arg-Gln; MF C135H222N38O49; MW 3161.50

323 €
366 $
250 £

Catalog number: 431-98432-1
Product Quantity: 1mg
Sequence Glu-Val-Glu-Asp-Pro-Gln-Val-Ala-Gln-Leu-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Asp-Leu-Gln-Thr-Leu-Ala-Leu-Glu-Val-Ala-Arg-Gln; MF C135H222N38O49; MW 3161.50

921 €
1045 $
714 £

Catalog number: 431-98432-3
Product Quantity: 10 mg
Pancreastatin, Porcine [Gly-Trp-Pro-Gln-Ala-Pro-Ala-Met-Asp-Gly-Ala-Gly-Lys-ThrGly-Ala-Glu-Glu-Ala-Gln-Pro-Pro-Glu-Gly-Lys-Gly-Ala-Arg-Glu-His-Ser-Arg-Gln-Glu-Glu-Glu-Glu-Glu-THr-Ala-Gl-Ala-Pro-Gln-Gl

865 €
982 $
671 £

Catalog number: SP-52292-1
Product Quantity: 0.5 mg
Supplier: ADI
Sequence His-Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly; MF C52H76N22O16; MW 1265.3

355 €
403 $
275 £

Catalog number: 431-86472-1
Product Quantity: 5 mg
Alloferon 2 Formula C46H69N19O15 Sequence Gly_Val_Ser_Gly_His_Gly_Gln_His_Gly_Val_His_Gly

252 €
286 $
195 £

Catalog number: 100504
Product Quantity: 5mg
Supplier: GLSChina
Sequence Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly; MF C46H69N19O15; MW 1128.2

339 €
384 $
263 £

Catalog number: 431-109392-1
Product Quantity: 5 mg
Sequence Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly; MF C46H69N19O15; MW 1128.2

440 €
500 $
341 £

Catalog number: 431-109392-2
Product Quantity: 10 mg
Sequence HGVSGHGQHGVHG , His-Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly; MF C52H76N22O16 ; MW 1265.30

307 €
348 $
238 £

Catalog number: RB-PP-0211
Product Quantity: 1 mg
Sequence His-Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly; MF C52H76N22O16; MW 1265.3

475 €
539 $
368 £

Catalog number: 431-86472-2
Product Quantity: 10 mg
Alloferon 1 Formula C52H76N22O16 Sequence His_Gly_Val_Ser_Gly_His_Gly_Gln_His_Gly_Val_His_Gly

266 €
302 $
206 £

Catalog number: 77584
Product Quantity: 5mg
Supplier: GLSChina
Sequence His-Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly; MF C52H76N22O16; MW 1265.3

775 €
880 $
601 £

Catalog number: 431-86472-3
Product Quantity: 25 mg
Sequence Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly; MF C46H69N19O15; MW 1128.2

727 €
825 $
564 £

Catalog number: 431-109392-3
Product Quantity: 25 mg
Biotin_Obestatin (human) Formula C126H190N34O35 Sequence Biotin_Phe_Asn_Ala_Pro_Phe_Asp_Val_Gly_Ile_Lys_Leu_Ser_Gly_Val_Gln_Tyr_Gln_Gln_His_Ser_Gln_Ala_Leu_NH2

193 €
219 $
150 £

Catalog number: 100436
Product Quantity: 1mg
Supplier: GLSChina
mCRAMP, mouse (AA: Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln) (MW: 3878.70)

390 €
443 $
302 £

Catalog number: SP-88328-1
Product Quantity: 1 mg
Supplier: ADI
ã_TAC4 (32 _ 50) Formula C92H146N24O31 Sequence Ala_Glu_Thr_Trp_Glu_Gly_Ala_Gly_Pro_Ser_Ile_Gln_Leu_Gln_Leu_Gln_Glu_Val_Lys

177 €
201 $
137 £

Catalog number: 86685
Product Quantity: 1mg
Supplier: GLSChina
Sequence Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys; MF C92H146N24O31; MW 2084.33

257 €
292 $
200 £

Catalog number: 431-95573-1
Product Quantity: 1mg
Sequence Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys; MF C92H146N24O31; MW 2084.33

662 €
751 $
513 £

Catalog number: 431-95573-3
Product Quantity: 10 mg
Sequence Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys; MF C92H146N24O31; MW 2084.33

440 €
500 $
341 £

Catalog number: 431-95573-2
Product Quantity: 5 mg
Bombesin (AA: Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu- Met-NH2) (MW: 1619.86)

223 €
253 $
173 £

Catalog number: SP-52226-1
Product Quantity: 1 mg
Supplier: ADI
Biotin-Obestatin (human) (AA: Biotin-Phe-Asn-Ala-Pro-Phe-Asp-Val-Gly-Ile-Lys-Leu-Ser-Gly-Val-Gln-Tyr-Gln-Gln-His-Ser-Gln-Ala-Leu-NH2) (MW: 2773.19)

306 €
347 $
237 £

Catalog number: SP-100436-1
Product Quantity: 1 mg
Supplier: ADI
MF C92H146N24O31 ; MW 2084.30 ; AETWEGAGPSIQLQLQEVK, Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys

323 €
366 $
250 £

Catalog number: RB-PP-1685
Product Quantity: 1 mg
[Lys3] – Bombesin [Pyr -Gln-Lys-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MW: 1591.88]

390 €
443 $
302 £

Catalog number: SP-54430-5
Product Quantity: 5 mg
Supplier: ADI
MF C142H239N47O46 ; MW 3340.72; RREAENPQAGAVELGGGLGGLQALALEGPPQKR, Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg

509 €
578 $
395 £

Catalog number: RB-PP-1297
Product Quantity: 1 mg
Sequence Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C71H111N24O18S; MW 1619.86

373 €
423 $
289 £

Catalog number: 431-61114-2
Product Quantity: 5 mg
Sequence Pyr -Gln-Lys-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C71H110N22O18S; MW 1591.88

373 €
423 $
289 £

Catalog number: 431-63318-1
Product Quantity: 5 mg
Sequence Pyr -Gln-Lys-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C71H110N22O18S; MW 1591.88

613 €
695 $
475 £

Catalog number: 431-63318-2
Product Quantity: 10 mg
[D-Phe12]-Bombesin [Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Met-NH2; MW: 1629.93]

390 €
443 $
302 £

Catalog number: SP-89334-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Pyr -Gln-Lys-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C71H110N22O18S; MW 1591.88

986 €
1119 $
765 £

Catalog number: 431-63318-3
Product Quantity: 25 mg
Sequence Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C71H111N24O18S; MW 1619.86

576 €
654 $
447 £

Catalog number: 431-61114-3
Product Quantity: 10 mg
Sequence Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C71H111N24O18S; MW 1619.86

257 €
292 $
200 £

Catalog number: 431-61114-1
Product Quantity: 1mg
Bombesin Formula C71H111N24O18S Sequence Pyr_Gln_Arg_Leu_Gly_Asn_Gln_Trp_Ala_Val_Gly_His_Leu_Met_NH2

161 €
183 $
125 £

Catalog number: 52226
Product Quantity: 1mg
Supplier: GLSChina
γ-TAC4 (32 - 50) [Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys (MW: 2084.33)]

223 €
253 $
173 £

Catalog number: SP-86685-1
Product Quantity: 1 mg
Supplier: ADI
[Gln22] _ 25359 _ Amyloid (6 _40) Formula C167H258N46O48S Sequence His_Asp_Ser_Gly_Tyr_Glu_Val_His_His_Gln_Lys_Leu_Val_Phe_Phe_Ala_Gln_Asp_Val_Gly_Ser_Asn_Lys_Gly_Ala_Ile_Ile_Gly_Leu_Met_Val_Gly_Gly

353 €
400 $
273 £

Catalog number: 87936
Product Quantity: 1mg
Supplier: GLSChina
Sequence Biotin-Glu-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C81H126N26O21S2; MW 1864.2

257 €
292 $
200 £

Catalog number: 431-97121-1
Product Quantity: 1mg
Sequence Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Met-NH2; MF C74H112N22O18S; MW 1629.93

857 €
972 $
664 £

Catalog number: 431-98222-3
Product Quantity: 25 mg
Sequence Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Met-NH2; MF C74H112N22O18S; MW 1629.93

355 €
403 $
275 £

Catalog number: 431-98222-1
Product Quantity: 5 mg
Sequence Biotin-Glu-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C81H126N26O21S2; MW 1864.2

373 €
423 $
289 £

Catalog number: 431-97121-2
Product Quantity: 5 mg
Sequence Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Met-NH2; MF C74H112N22O18S; MW 1629.93

509 €
578 $
395 £

Catalog number: 431-98222-2
Product Quantity: 10 mg
Sequence Biotin-Glu-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C81H126N26O21S2; MW 1864.2

576 €
654 $
447 £

Catalog number: 431-97121-3
Product Quantity: 10 mg
[Lys3] – Bombesin Formula C71H110N22O18S Sequence Pyr _Gln_Lys_Leu_Gly_Asn_Gln_Trp_Ala_Val_Gly_His_Leu_Met_NH2

300 €
341 $
233 £

Catalog number: 54430
Product Quantity: 5mg
Supplier: GLSChina
Biotin-Intermedin (human) (AA: Biotin-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pr

390 €
443 $
302 £

Catalog number: SP-89205-1
Product Quantity: 1 mg
Supplier: ADI
γ-TAC4 (30 - 61) - NH2 [Thr-Glu-Ala-Glu-Thr-Trp-Glu-Gly-Ala-Gly-Pro-Ser-Ile-Gln-Leu-Gln-Leu-Gln-Glu-Val-Lys-Thr-Gly-Lys-Ala-Ser-Gln-Phe-Phe-Gly-Leu-Met-NH2 (MW: 3481.96)]

390 €
443 $
302 £

Catalog number: SP-86686-1
Product Quantity: 1 mg
Supplier: ADI
C-Peptide 2 (rat) (AA: Glu-Val-Glu-Asp-Pro-Gln-Val-Ala-Gln-Leu-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Asp-Leu-Gln-Thr-Leu-Ala-Leu-Glu-Val-Ala-Arg-Gln) (MW: 3161.50)

390 €
443 $
302 £

Catalog number: SP-89544-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2; MF C184H313N53O46; MW 4003.87

1277 €
1449 $
991 £

Catalog number: 431-70206-3
Product Quantity: 10 mg
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2; MF C184H313N53O46; MW 4003.87

407 €
462 $
316 £

Catalog number: 431-70206-1
Product Quantity: 1mg
Cecropin A Formula C184H313N53O46 Sequence Lys_Trp_Lys_Leu_Phe_Lys_Lys_Ile_Glu_Lys_Val_Gly_Gln_Asn_Ile_Arg_Asp_Gly_Ile_Ile_Lys_Ala_Gly_Pro_Ala_Val_Ala_Val_Val_Gly_Gln_Ala_Thr_Gln_Ile_Ala_Lys_NH2

318 €
361 $
247 £

Catalog number: 61318
Product Quantity: 1mg
Supplier: GLSChina
Sequence Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2; MF C184H313N53O46; MW 4003.87

921 €
1045 $
714 £

Catalog number: 431-70206-2
Product Quantity: 5 mg
[D_Phe12]_Bombesin Formula C74H112N22O18S Sequence Pyr_Gln_Arg_Leu_Gly_Asn_Gln_Trp_Ala_Val_Gly_D_Phe_Leu_Met_NH2

270 €
307 $
209 £

Catalog number: 89334
Product Quantity: 5mg
Supplier: GLSChina
Thymus Factor [H-gln-Ala-Lys-Ser-Gln-Gly-Gly-Ser-Asn-OH; MW: 875.9]

190 €
216 $
147 £

Catalog number: SP-55320-1
Product Quantity: 1 mg
Supplier: ADI
Sequence His-Pro-Leu-Gly-Ser-Pro-Gly-Ser-Ala-Ser-Asp-Leu-Glu-Thr-Ser-Gly-Leu-Gln-Glu-Gln-Arg-Asn-His-Leu-Gln-Gly-Lys-Leu-Ser-Glu-Leu-Gln-Val-Glu-Gln-Thr-Ser-Leu-Glu-Pro-Leu-Gln-Glu-Ser-Pro-Arg-Pro-Th

2979 €
3382 $
2311 £

Catalog number: 431-81847-3
Product Quantity: 10 mg
Sequence His-Pro-Leu-Gly-Ser-Pro-Gly-Ser-Ala-Ser-Asp-Leu-Glu-Thr-Ser-Gly-Leu-Gln-Glu-Gln-Arg-Asn-His-Leu-Gln-Gly-Lys-Leu-Ser-Glu-Leu-Gln-Val-Glu-Gln-Thr-Ser-Leu-Glu-Pro-Leu-Gln-Glu-Ser-Pro-Arg-Pro-Th

1992 €
2261 $
1545 £

Catalog number: 431-81847-2
Product Quantity: 5 mg
Sequence His-Pro-Leu-Gly-Ser-Pro-Gly-Ser-Ala-Ser-Asp-Leu-Glu-Thr-Ser-Gly-Leu-Gln-Glu-Gln-Arg-Asn-His-Leu-Gln-Gly-Lys-Leu-Ser-Glu-Leu-Gln-Val-Glu-Gln-Thr-Ser-Leu-Glu-Pro-Leu-Gln-Glu-Ser-Pro-Arg-Pro-Th

775 €
880 $
601 £

Catalog number: 431-81847-1
Product Quantity: 1mg
MF C153H259N49O52 ; MW 3617.01 ; RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR, Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-G

509 €
578 $
395 £

Catalog number: RB-PP-1299
Product Quantity: 1 mg
Bak _ BH3 Formula C72H125N25O24 Sequence Gly_Gln_Val_Gly_Arg_Gln_Leu_Ala_Ile_Ile_Gly_Asp_Asp_Ile_Asn_Arg

162 €
184 $
126 £

Catalog number: 53294
Product Quantity: 1mg
Supplier: GLSChina
Fibrinopeptide B, Bovine Formula C101H154N30O36 Sequence Gln_Phe_Pro_Thr_Asp_Tyr_Asp_Glu_Gly_Gln_Asp_Asp_Arg_Pro_Lys_Val_Gly_Leu_Gly_Ala_Arg

186 €
211 $
144 £

Catalog number: 100818
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gln-Phe-Pro-Thr-Asp-Tyr-Asp-Glu-Gly-Gln-Asp-Asp-Arg-Pro-Lys-Val-Gly-Leu-Gly-Ala-Arg; MF C101H154N30O36; MW 2364.53

274 €
312 $
213 £

Catalog number: 431-109706-1
Product Quantity: 1mg
Sequence Gln-Phe-Pro-Thr-Asp-Tyr-Asp-Glu-Gly-Gln-Asp-Asp-Arg-Pro-Lys-Val-Gly-Leu-Gly-Ala-Arg; MF C101H154N30O36; MW 2364.53

475 €
539 $
368 £

Catalog number: 431-109706-2
Product Quantity: 5 mg
Sequence Gln-Phe-Pro-Thr-Asp-Tyr-Asp-Glu-Gly-Gln-Asp-Asp-Arg-Pro-Lys-Val-Gly-Leu-Gly-Ala-Arg; MF C101H154N30O36; MW 2364.53

679 €
771 $
527 £

Catalog number: 431-109706-3
Product Quantity: 10 mg
Sequence His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Se

1116 €
1266 $
865 £

Catalog number: 431-98096-2
Product Quantity: 5 mg
Sequence His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Se

509 €
578 $
395 £

Catalog number: 431-98096-1
Product Quantity: 1mg
Sequence His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Se

1855 €
2105 $
1439 £

Catalog number: 431-98096-3
Product Quantity: 10 mg
Sequence Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg; MF C72H125N25O24; MW 1724.95

576 €
654 $
447 £

Catalog number: 431-62182-3
Product Quantity: 10 mg
Sequence Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg; MF C72H125N25O24; MW 1724.95

373 €
423 $
289 £

Catalog number: 431-62182-2
Product Quantity: 5 mg
Sequence Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg; MF C72H125N25O24; MW 1724.95

257 €
292 $
200 £

Catalog number: 431-62182-1
Product Quantity: 1mg
Fibrinopeptide B, Bovine (AA: Gln-Phe-Pro-Thr-Asp-Tyr-Asp-Glu-Gly-Gln-Asp-Asp-Arg-Pro-Lys-Val-Gly-Leu-Gly-Ala-Arg) (MW: 2364.53)

223 €
253 $
173 £

Catalog number: SP-100818-1
Product Quantity: 1 mg
Supplier: ADI
Cecropin A (AA: Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2) (MW: 4003.87)

557 €
632 $
432 £

Catalog number: SP-61318-1
Product Quantity: 1 mg
Supplier: ADI
C_Peptide 1 (rat) Formula C140H228N38O51 Sequence Glu_Val_Glu_Asp_Pro_Gln_Val_Pro_Gln_Leu_Glu_Leu_Gly_Gly_Gly_Pro_Glu_Ala_Gly_Asp_Leu_Gln_Thr_Leu_Ala_Leu_Glu_Val_Ala_Arg_Gln

231 €
262 $
179 £

Catalog number: 89543
Product Quantity: 1mg
Supplier: GLSChina
[Nle13]_Motillin Formula C121H190N34O35 Sequence Phe_Val_Pro_Ile_Phe_Thr_Tyr_Gly_Glu_Leu_Gln_Arg_Nle_Gln_Glu_Lys_Glu_Arg_Asn_Lys_Gly_Gln

190 €
216 $
147 £

Catalog number: 88932
Product Quantity: 1mg
Supplier: GLSChina
Motilin, porcine Formula C120H188N34O35S Sequence Phe_Val_Pro_Ile_Phe_Thr_Tyr_Gly_Glu_Leu_Gln_Arg_Met_Gln_Glu_Lys_Glu_Arg_Asn_Lys_Gly_Gln

190 €
216 $
147 £

Catalog number: 52273
Product Quantity: 1mg
Supplier: GLSChina
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Met-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C120H188N34O35S; MW 2699.1

274 €
312 $
213 £

Catalog number: 431-61161-1
Product Quantity: 1mg
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Met-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C120H188N34O35S; MW 2699.1

695 €
789 $
539 £

Catalog number: 431-61161-3
Product Quantity: 10 mg
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Nle-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C121H190N34O35; MW 2681.07

695 €
789 $
539 £

Catalog number: 431-97820-3
Product Quantity: 10 mg
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Nle-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C121H190N34O35; MW 2681.07

475 €
539 $
368 £

Catalog number: 431-97820-2
Product Quantity: 5 mg
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Nle-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C121H190N34O35; MW 2681.07

274 €
312 $
213 £

Catalog number: 431-97820-1
Product Quantity: 1mg
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Met-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C120H188N34O35S; MW 2699.1

475 €
539 $
368 £

Catalog number: 431-61161-2
Product Quantity: 5 mg
Sequence Val-Gly-Ala-Tyr-Gln-Leu-Glu-His-Thr-Phe-Gln-Gly-Leu-Leu-NH2; MF C73H111N19O20; MW 1574.81

373 €
423 $
289 £

Catalog number: 431-63724-2
Product Quantity: 5 mg
Sequence Val-Gly-Ala-Tyr-Gln-Leu-Glu-His-Thr-Phe-Gln-Gly-Leu-Leu-NH2; MF C73H111N19O20; MW 1574.81

257 €
292 $
200 £

Catalog number: 431-63724-1
Product Quantity: 1mg
Sequence Val-Gly-Ala-Tyr-Gln-Leu-Glu-His-Thr-Phe-Gln-Gly-Leu-Leu-NH2; MF C73H111N19O20; MW 1574.81

543 €
616 $
421 £

Catalog number: 431-63724-3
Product Quantity: 10 mg
Endokinin D (Human) (AA: Val-Gly-Ala-Tyr-Gln-Leu-Glu-His-Thr-Phe-Gln-Gly-Leu-Leu-NH2) (MW: 1574.81)

223 €
253 $
173 £

Catalog number: SP-54836-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Leu-NH2; MF C75H114N22O18; MW 1611.90

857 €
972 $
664 £

Catalog number: 431-98223-3
Product Quantity: 25 mg
Sequence Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Leu-NH2; MF C75H114N22O18; MW 1611.90

355 €
403 $
275 £

Catalog number: 431-98223-1
Product Quantity: 5 mg
[D-Phe12,Leu14]-Bombesin [Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Leu-NH2; MW: 1611.90]

390 €
443 $
302 £

Catalog number: SP-89335-5
Product Quantity: 5 mg
Supplier: ADI
Endokinin D (Human) Formula C73H111N19O20 Sequence Val_Gly_Ala_Tyr_Gln_Leu_Glu_His_Thr_Phe_Gln_Gly_Leu_Leu_NH2

159 €
180 $
123 £

Catalog number: 54836
Product Quantity: 1mg
Supplier: GLSChina
Sequence Pyr-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-D-Phe-Leu-Leu-NH2; MF C75H114N22O18; MW 1611.90

509 €
578 $
395 £

Catalog number: 431-98223-2
Product Quantity: 10 mg
[Nle13]-Motillin [Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Nle-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MW 2681.07]

271 €
308 $
210 £

Catalog number: SP-88932-1
Product Quantity: 1 mg
Supplier: ADI
Motilin, procine [Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Met-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln-OH; MW 2699.1]

318 €
361 $
247 £

Catalog number: SP-52273-5
Product Quantity: 0.5 mg
Supplier: ADI
Bak - BH3 (AA: Gly-Gln-Val-Gly-Arg-Gln-Leu-Ala-Ile-Ile-Gly-Asp-Asp-Ile-Asn-Arg) (MW: 1724.95)

223 €
253 $
173 £

Catalog number: SP-53294-1
Product Quantity: 1 mg
Supplier: ADI
[Tyr0]_C_Peptide (dog) Formula C146H234N38O51 Sequence Tyr_Glu_Val_Glu_Asp_Leu_Gln_Val_Arg_Asp_Val_Glu_Leu_Ala_Gly_Ala_Pro_Gly_Glu_Gly_Gly_Leu_Gln_Pro_Leu_Ala_Leu_Glu_Gly_Ala_Leu_Gln

236 €
268 $
183 £

Catalog number: 89541
Product Quantity: 1mg
Supplier: GLSChina
[D_Phe12,Leu14]_Bombesin Formula C75H114N22O18 Sequence Pyr_Gln_Arg_Leu_Gly_Asn_Gln_Trp_Ala_Val_Gly_D_Phe_Leu_Leu_NH2

270 €
307 $
209 £

Catalog number: 89335
Product Quantity: 5mg
Supplier: GLSChina
Alloferon 1 (AA: His-Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly) (MW: 1265.3)

390 €
443 $
302 £

Catalog number: SP-77584-5
Product Quantity: 5 mg
Supplier: ADI
Alloferon 2 (AA: Gly-Val-Ser-Gly-His-Gly-Gln-His-Gly-Val-His-Gly) (MW: 1128.2)

390 €
443 $
302 £

Catalog number: SP-100504-5
Product Quantity: 5 mg
Supplier: ADI
Sequence His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C167H258N46O48S; MW 3710.26

1471 €
1669 $
1141 £

Catalog number: 431-96824-3
Product Quantity: 10 mg
Sequence His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C167H258N46O48S; MW 3710.26

970 €
1101 $
752 £

Catalog number: 431-96824-2
Product Quantity: 5 mg
[Gln22] - 25359 - Amyloid (6 - 40) [His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MW: 3710.26]

557 €
632 $
432 £

Catalog number: SP-87936-1
Product Quantity: 1 mg
Supplier: ADI
Sequence His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C167H258N46O48S; MW 3710.26

440 €
500 $
341 £

Catalog number: 431-96824-1
Product Quantity: 1mg
Non_Ab Component of Alzheimer's Disease Amyloid Formula C141H235N39O49 Sequence Glu_Gln_Val_Thr_Asn_Val_Gly_Gly_Ala_Val_Val_Thr_Gly_Val_Thr_Ala_Val_Ala_Gln_Lys_Thr_Val_Glu_Gly_Ala_Gly_Ser_Ile_Ala_Al

300 €
341 $
233 £

Catalog number: 89317
Product Quantity: 1mg
Supplier: GLSChina
Sequence Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH

475 €
539 $
368 £

Catalog number: 431-63720-1
Product Quantity: 1mg
Sequence Biotin-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser

986 €
1119 $
765 £

Catalog number: 431-98093-3
Product Quantity: 10 mg
Sequence Biotin-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser

339 €
384 $
263 £

Catalog number: 431-98093-1
Product Quantity: 1mg
Sequence Biotin-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser

727 €
825 $
564 £

Catalog number: 431-98093-2
Product Quantity: 5 mg
Sequence Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH

1018 €
1156 $
790 £

Catalog number: 431-63720-2
Product Quantity: 5 mg
Sequence Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-His-Ser-Tyr-NH

1665 €
1890 $
1292 £

Catalog number: 431-63720-3
Product Quantity: 10 mg
Sequence Glu-Val-Glu-Asp-Pro-Gln-Val-Pro-Gln-Leu-Glu-Leu-Gly-Gly-Gly-Pro-Glu-Ala-Gly-Asp-Leu-Gln-Thr-Leu-Ala-Leu-Glu-Val-Ala-Arg-Gln; MF C140H228N38O51; MW 3259.60

613 €
695 $
475 £

Catalog number: 431-98431-2
Product Quantity: 5 mg
Sequence Glu-Val-Glu-Asp-Pro-Gln-Val-Pro-Gln-Leu-Glu-Leu-Gly-Gly-Gly-Pro-Glu-Ala-Gly-Asp-Leu-Gln-Thr-Leu-Ala-Leu-Glu-Val-Ala-Arg-Gln; MF C140H228N38O51; MW 3259.60

323 €
366 $
250 £

Catalog number: 431-98431-1
Product Quantity: 1mg
Sequence Glu-Val-Glu-Asp-Pro-Gln-Val-Pro-Gln-Leu-Glu-Leu-Gly-Gly-Gly-Pro-Glu-Ala-Gly-Asp-Leu-Gln-Thr-Leu-Ala-Leu-Glu-Val-Ala-Arg-Gln; MF C140H228N38O51; MW 3259.60

921 €
1045 $
714 £

Catalog number: 431-98431-3
Product Quantity: 10 mg
Biotin-Bombesin (AA: Biotin-Glu-Gln-Arg-Leu-Gly-Asn-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2) (MW: 1864.2)

223 €
253 $
173 £

Catalog number: SP-88233-1
Product Quantity: 1 mg
Supplier: ADI
Biotin_Bombesin Formula C81H126N26O21S2 Sequence Biotin_Glu_Gln_Arg_Leu_Gly_Asn_Gln_Trp_Ala_Val_Gly_His_Leu_Met_NH2

162 €
184 $
126 £

Catalog number: 88233
Product Quantity: 1mg
Supplier: GLSChina
[Gly11] Substance P Formula C60H92N18O13 Sequence Arg_Pro_Lys_Pro_Gln_Gln_Phe_Phe_Gly_Leu_Gly_NH2

252 €
286 $
195 £

Catalog number: 87372
Product Quantity: 5mg
Supplier: GLSChina
EMP-1 (Epithelial Membrane Protein) (AA: Gly-Gly-Thr-Tyr-Ser-Cys-His-Phe-Gly-Pro-Leu-Thr-Trp-Val-Cys-Lys-Pro-Gln-Gly-Gly) (MW: 2093.39)

223 €
253 $
173 £

Catalog number: SP-88512-1
Product Quantity: 1 mg
Supplier: ADI
Biotin_Intermedin (rat) Formula C236H377N77O66S3 Sequence Biotin_Pro_His_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Val_Arg_Pro_Ser_Gly_Arg_A

257 €
292 $
200 £

Catalog number: 89207
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gly-Gly-Thr-Tyr-Ser-Cys-His-Phe-Gly-Pro-Leu-Thr-Trp-Val-Cys-Lys-Pro-Gln-Gly-Gly; MF C94H133N25O26S2; MW 2093.39

274 €
312 $
213 £

Catalog number: 431-97400-1
Product Quantity: 1mg
Sequence Gly-Gly-Thr-Tyr-Ser-Cys-His-Phe-Gly-Pro-Leu-Thr-Trp-Val-Cys-Lys-Pro-Gln-Gly-Gly; MF C94H133N25O26S2; MW 2093.39

440 €
500 $
341 £

Catalog number: 431-97400-2
Product Quantity: 5 mg
Sequence Gly-Gly-Thr-Tyr-Ser-Cys-His-Phe-Gly-Pro-Leu-Thr-Trp-Val-Cys-Lys-Pro-Gln-Gly-Gly; MF C94H133N25O26S2; MW 2093.39

662 €
751 $
513 £

Catalog number: 431-97400-3
Product Quantity: 10 mg
Intermedin (human) (AA: Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-Val-Asp-Pro-Ser-Ser-Pro-

472 €
536 $
366 £

Catalog number: SP-54832-1
Product Quantity: 1 mg
Supplier: ADI
EMP_1 (Epithelial Membrane Protein) Formula C94H133N25O26S2 Sequence Gly_Gly_Thr_Tyr_Ser_Cys_His_Phe_Gly_Pro_Leu_Thr_Trp_Val_Cys_Lys_Pro_Gln_Gly_Gly

180 €
205 $
140 £

Catalog number: 88512
Product Quantity: 1mg
Supplier: GLSChina
Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Gly-NH2; MF C60H92N18O13; MW 1273.52

727 €
825 $
564 £

Catalog number: 431-96260-3
Product Quantity: 25 mg
Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Gly-NH2; MF C60H92N18O13; MW 1273.52

440 €
500 $
341 £

Catalog number: 431-96260-2
Product Quantity: 10 mg
Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Gly-NH2; MF C60H92N18O13; MW 1273.52

339 €
384 $
263 £

Catalog number: 431-96260-1
Product Quantity: 5 mg
MF C178H302N50O46 ; MW 3878.63; GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ, Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu

407 €
462 $
316 £

Catalog number: RB-PP-1029
Product Quantity: 1 mg
[Gly11] Substance P [Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Gly-NH2; MW: 1273.52]

390 €
443 $
302 £

Catalog number: SP-87372-5
Product Quantity: 5 mg
Supplier: ADI
[Leu13] Motilin, human, porcine Formula C121H190N34O35 Sequence Phe_Val_Pro_Ile_Phe_Thr_Tyr_Gly_Glu_Leu_Gln_Arg_Leu_Gln_Glu_Lys_Glu_Arg_Asn_Lys_Gly_Gln

190 €
216 $
147 £

Catalog number: 88931
Product Quantity: 1mg
Supplier: GLSChina
Sequence Glu-Gln-Val-Thr-Asn-Val-Gly-Gly-Ala-Val-Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val-Glu-Gly-Ala-Gly-Ser-Ile-Ala-Ala-Ala-Thr-Gly-Phe-Val; MF C141H235N39O49; MW 3260.68

1148 €
1303 $
890 £

Catalog number: 431-98205-3
Product Quantity: 10 mg
Sequence Glu-Gln-Val-Thr-Asn-Val-Gly-Gly-Ala-Val-Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val-Glu-Gly-Ala-Gly-Ser-Ile-Ala-Ala-Ala-Thr-Gly-Phe-Val; MF C141H235N39O49; MW 3260.68

857 €
972 $
664 £

Catalog number: 431-98205-2
Product Quantity: 5 mg
Sequence Glu-Gln-Val-Thr-Asn-Val-Gly-Gly-Ala-Val-Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val-Glu-Gly-Ala-Gly-Ser-Ile-Ala-Ala-Ala-Thr-Gly-Phe-Val; MF C141H235N39O49; MW 3260.68

373 €
423 $
289 £

Catalog number: 431-98205-1
Product Quantity: 1mg
Non-Ab Component of Alzheimer's Disease Amyloid (AA: Glu-Gln-Val-Thr-Asn-Val-Gly-Gly-Ala-Val-Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val-Glu-Gly-Ala-Gly-Ser-Ile-Ala-Ala-Ala-Thr-Gly-Phe-Val) (MW: 3

390 €
443 $
302 £

Catalog number: SP-89317-1
Product Quantity: 1 mg
Supplier: ADI
[Leu13] Motilin, human, porcine [Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Leu-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MW: 2681.07]

271 €
308 $
210 £

Catalog number: SP-88931-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C221H

1520 €
1725 $
1179 £

Catalog number: 431-64309-3
Product Quantity: 10 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C221H

986 €
1119 $
765 £

Catalog number: 431-64309-2
Product Quantity: 5 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C221H

440 €
500 $
341 £

Catalog number: 431-64309-1
Product Quantity: 1mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Arg-Val-Arg-Leu-NH2; MF C219H

986 €
1119 $
765 £

Catalog number: 431-97977-2
Product Quantity: 5 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Arg-Val-Arg-Leu-NH2; MF C219H

440 €
500 $
341 £

Catalog number: 431-97977-1
Product Quantity: 1mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Arg-Val-Arg-Leu-NH2; MF C219H

1520 €
1725 $
1179 £

Catalog number: 431-97977-3
Product Quantity: 10 mg
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Leu-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C121H190N34O35; MW 2681.07

475 €
539 $
368 £

Catalog number: 431-97819-2
Product Quantity: 5 mg
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Leu-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C121H190N34O35; MW 2681.07

695 €
789 $
539 £

Catalog number: 431-97819-3
Product Quantity: 10 mg
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Leu-Gln-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C121H190N34O35; MW 2681.07

274 €
312 $
213 £

Catalog number: 431-97819-1
Product Quantity: 1mg
C-Peptide 1 (rat) (AA: Glu-Val-Glu-Asp-Pro-Gln-Val-Pro-Gln-Leu-Glu-Leu-Gly-Gly-Gly-Pro-Glu-Ala-Gly-Asp-Leu-Gln-Thr-Leu-Ala-Leu-Glu-Val-Ala-Arg-Gln) (MW: 3259.60)

390 €
443 $
302 £

Catalog number: SP-89543-1
Product Quantity: 1 mg
Supplier: ADI
C_Peptide, dogs Formula C137H225N37O49 Sequence Glu_Val_Glu_Asp_Leu_Gln_Val_Arg_Asp_Val_Glu_Leu_Ala_Gly_Ala_Pro_Gly_Glu_Gly_Gly_Leu_Gln_Pro_Leu_Ala_Leu_Glu_Gly_Ala_Leu_Gln

323 €
366 $
250 £

Catalog number: 55238
Product Quantity: 1mg
Supplier: GLSChina
Sequence Tyr-Glu-Val-Glu-Asp-Leu-Gln-Val-Arg-Asp-Val-Glu-Leu-Ala-Gly-Ala-Pro-Gly-Glu-Gly-Gly-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ala-Leu-Gln; MF C146H234N38O51; MW 3337.72

954 €
1083 $
740 £

Catalog number: 431-98429-3
Product Quantity: 10 mg
[Tyr0]-C-Peptide (dog) [Tyr-Glu-Val-Glu-Asp-Leu-Gln-Val-Arg-Asp-Val-Glu-Leu-Ala-Gly-Ala-Pro-Gly-Glu-Gly-Gly-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ala-Leu-Gln; MW 3337.72]

390 €
443 $
302 £

Catalog number: SP-89541-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Tyr-Glu-Val-Glu-Asp-Leu-Gln-Val-Arg-Asp-Val-Glu-Leu-Ala-Gly-Ala-Pro-Gly-Glu-Gly-Gly-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ala-Leu-Gln; MF C146H234N38O51; MW 3337.72

662 €
751 $
513 £

Catalog number: 431-98429-2
Product Quantity: 5 mg
Sequence Tyr-Glu-Val-Glu-Asp-Leu-Gln-Val-Arg-Asp-Val-Glu-Leu-Ala-Gly-Ala-Pro-Gly-Glu-Gly-Gly-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ala-Leu-Gln; MF C146H234N38O51; MW 3337.72

323 €
366 $
250 £

Catalog number: 431-98429-1
Product Quantity: 1mg
Galanin (1_13)_Spantide I Formula C138H199N35O30 Sequence Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_D_Arg_Pro_Lys_Pro_Gln_Gln_D_Trp_Phe_D_Trp_Leu_Leu_NH2

239 €
272 $
185 £

Catalog number: 101037
Product Quantity: 1mg
Supplier: GLSChina
C-Peptide, Dogs [H-Glu-Val-Glu-Asp-Leu-Gln-Val-Arg-asp-Val-Glu-Leu-Ala-Gly-Ala-Pro-Gly-Glu-Gly-Gly-Leu-Gln-Pro-Leu-Ala-Leu-Gly-Gly-Ala-Leu-Gln-OH; MW: 3174.54]

398 €
451 $
308 £

Catalog number: SP-55238-1
Product Quantity: 0.5 mg
Supplier: ADI
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-NH2; MF C194H318N62O62S; MW

1407 €
1596 $
1091 £

Catalog number: 431-97035-3
Product Quantity: 10 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala; MF C194H317N61O63S; MW 4544

1407 €
1596 $
1091 £

Catalog number: 431-97036-3
Product Quantity: 10 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala; MF C194H317N61O63S; MW 4544

954 €
1083 $
740 £

Catalog number: 431-97036-2
Product Quantity: 5 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-NH2; MF C194H318N62O62S; MW

954 €
1083 $
740 £

Catalog number: 431-97035-2
Product Quantity: 5 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala; MF C194H317N61O63S; MW 4544

407 €
462 $
316 £

Catalog number: 431-97036-1
Product Quantity: 1mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-NH2; MF C194H318N62O62S; MW

407 €
462 $
316 £

Catalog number: 431-97035-1
Product Quantity: 1mg
Osteogenic Growth Peptide Formula C68H110N22O18 Sequence Ala_Leu_Lys_Arg_Gln_Gly_Arg_Thr_Leu_Tyr_Gly_Phe_Gly_Gly

279 €
316 $
216 £

Catalog number: 60903
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2; MF C138H199N35O30; MW 2828.34

662 €
751 $
513 £

Catalog number: 431-109925-2
Product Quantity: 5 mg
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2; MF C138H199N35O30; MW 2828.34

323 €
366 $
250 £

Catalog number: 431-109925-1
Product Quantity: 1mg
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2; MF C138H199N35O30; MW 2828.34

954 €
1083 $
740 £

Catalog number: 431-109925-3
Product Quantity: 10 mg
Sequence Ala-Leu-Lys-Arg-Gln-Gly-Arg-Thr-Leu-Tyr-Gly-Phe-Gly-Gly; MF C68H110N22O18; MW 1523.74

355 €
403 $
275 £

Catalog number: 431-69791-1
Product Quantity: 1mg
Sequence Ala-Leu-Lys-Arg-Gln-Gly-Arg-Thr-Leu-Tyr-Gly-Phe-Gly-Gly; MF C68H110N22O18; MW 1523.74

257 €
292 $
200 £

Catalog number: 431-69791-2
Product Quantity:
Sequence Ala-Leu-Lys-Arg-Gln-Gly-Arg-Thr-Leu-Tyr-Gly-Phe-Gly-Gly; MF C68H110N22O18; MW 1523.74

257 €
292 $
200 £

Catalog number: 431-69791-3
Product Quantity:
MF C73H115N23O26 ; MW 1730.84 ; YGSLPQKAQRPQDEN, Tyr-Gly-Ser-Leu-Pro-Gln-Lys-Ala-Gln-Arg-Pro-Gln-Asp-Glu-Asn

323 €
366 $
250 £

Catalog number: RB-PP-1075
Product Quantity: 1 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C220H

440 €
500 $
341 £

Catalog number: 431-64308-1
Product Quantity: 1mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C220H

1520 €
1725 $
1179 £

Catalog number: 431-64308-3
Product Quantity: 10 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MF C220H

986 €
1119 $
765 £

Catalog number: 431-64308-2
Product Quantity: 5 mg
Galanin (1-13)-Spantide I (AA: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2) (MW: 2828.34)

390 €
443 $
302 £

Catalog number: SP-101037-1
Product Quantity: 1 mg
Supplier: ADI
GHRF, Ovine [H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Ile-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MW:

371 €
421 $
288 £

Catalog number: SP-55421-1
Product Quantity: 0.5 mg
Supplier: ADI
Adrenomedullin (11-50) (rat) [Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; (Disu

724 €
822 $
561 £

Catalog number: SP-100047-1
Product Quantity: 1 mg
Supplier: ADI
Terlipressin protein Terlipressin contains 12 amino acids Gly-Gly-Gly-c[Cys-Tyr-Phe-Gln-Asn-Cys]-Pro-Lys-Gly-NH2 and having molecular weight of 1227.4 Dalton. For research use only.

524 €
595 $
406 £

Catalog number: orb80760
Product Quantity: 50 mg
Supplier: Biorb
Intermedin (rat) Formula C226H361N75O64S2 Sequence Pro_His_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Val_Arg_Pro_Ser_Gly_Arg_Arg_Asp_Ser_Ala

378 €
429 $
293 £

Catalog number: 89206
Product Quantity: 1mg
Supplier: GLSChina
Sequence Tyr-Gly-Ser-Leu-Pro-Gln-Lys-Ala-Gln-Arg-Pro-Gln-Asp-Glu-Asn; MF C73H115N23O26; MW 1730.87

274 €
312 $
213 £

Catalog number: 431-97399-1
Product Quantity: 1mg
Sequence Tyr-Gly-Ser-Leu-Pro-Gln-Lys-Ala-Gln-Arg-Pro-Gln-Asp-Glu-Asn; MF C73H115N23O26; MW 1730.87

440 €
500 $
341 £

Catalog number: 431-97399-2
Product Quantity: 5 mg
Sequence Tyr-Gly-Ser-Leu-Pro-Gln-Lys-Ala-Gln-Arg-Pro-Gln-Asp-Glu-Asn; MF C73H115N23O26; MW 1730.87

662 €
751 $
513 £

Catalog number: 431-97399-3
Product Quantity: 10 mg
Calcitonin, Human [Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2(Disulfide bridge Cys1-Cys7); MW: 3417.87]

243 €
276 $
189 £

Catalog number: SP-52229-1
Product Quantity: 0.5 mg
Supplier: ADI
GRF, porcine (AA: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Arg-Val-Arg-Leu-NH2) (

557 €
632 $
432 £

Catalog number: SP-89089-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Gln-Gln-Lys-Glu-Pro-Met-Ile-Gly-Val-Asn-Gln-Glu-Leu-Ala-Tyr-Phe; MF C85H131N21O26S; MW 1895.18

695 €
789 $
539 £

Catalog number: 431-87675-3
Product Quantity: 10 mg
Sequence Gln-Gln-Lys-Glu-Pro-Met-Ile-Gly-Val-Asn-Gln-Glu-Leu-Ala-Tyr-Phe; MF C85H131N21O26S; MW 1895.18

274 €
312 $
213 £

Catalog number: 431-87675-1
Product Quantity: 1mg
Sequence Gln-Gln-Lys-Glu-Pro-Met-Ile-Gly-Val-Asn-Gln-Glu-Leu-Ala-Tyr-Phe; MF C85H131N21O26S; MW 1895.18

475 €
539 $
368 £

Catalog number: 431-87675-2
Product Quantity: 5 mg
GRF, porcine Formula C219H365N73O66S Sequence Tyr_Ala_Asp_Ala_Ile_Phe_Thr_Asn_Ser_Tyr_Arg_Lys_Val_Leu_Gly_Gln_Leu_Ser_Ala_Arg_Lys_Leu_Leu_Gln_Asp_Ile_Met_Ser_Arg_Gln_Gln_Gly_Glu_Arg_Asn_Gln_Glu_Gln_

360 €
409 $
279 £

Catalog number: 89089
Product Quantity: 1mg
Supplier: GLSChina
Calcitonin, Rat [H-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile-Gly-Val-Gly-Pro-NH2 (Cys1-Cys7); MW: 3399.9]

243 €
276 $
189 £

Catalog number: SP-55432-1
Product Quantity: 0.5 mg
Supplier: ADI
Sequence Biotin-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys(bio)-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge Cys1-Cys6); MF C171H254N4O

970 €
1101 $
752 £

Catalog number: 431-98281-2
Product Quantity: 5 mg
Sequence Biotin-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys(bio)-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge Cys1-Cys6); MF C171H254N4O

1520 €
1725 $
1179 £

Catalog number: 431-98281-3
Product Quantity: 10 mg
Sequence Biotin-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys(bio)-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Disulfide bridge Cys1-Cys6); MF C171H254N4O

440 €
500 $
341 £

Catalog number: 431-98281-1
Product Quantity: 1mg
Sequence Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2(Disulfide bridge Cys1-Cys7); MF C151H226N40O45S3; MW 34

1277 €
1449 $
991 £

Catalog number: 431-61117-3
Product Quantity: 10 mg
Sequence Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2(Disulfide bridge Cys1-Cys7); MF C151H226N40O45S3; MW 34

921 €
1045 $
714 £

Catalog number: 431-61117-2
Product Quantity: 5 mg
Sequence Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr- Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile- Gly-Val-Gly-Ala-Pro-NH2(Disulfide bridge Cys1-Cys7); MF C148H228N40O46S3; MW 3

921 €
1045 $
714 £

Catalog number: 431-64320-2
Product Quantity: 5 mg
Calcitonin, rat Formula C148H228N40O46S3 Sequence Cys_Gly_Asn_Leu_Ser_Thr_Cys_Met_Leu_Gly_Thr_Tyr_Thr_Gln_Asp_Leu_Asn_Lys_Phe_His_Thr_Phe_Pro_Gln_Thr_Ser_Ile_Gly_Val_Gly_Ala_Pro_NH2(Disulfide bridge

315 €
358 $
244 £

Catalog number: 55432
Product Quantity: 1mg
Supplier: GLSChina
Sequence Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr- Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile- Gly-Val-Gly-Ala-Pro-NH2(Disulfide bridge Cys1-Cys7); MF C148H228N40O46S3; MW 3

373 €
423 $
289 £

Catalog number: 431-64320-1
Product Quantity: 1mg
Sequence Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2(Disulfide bridge Cys1-Cys7); MF C151H226N40O45S3; MW 34

373 €
423 $
289 £

Catalog number: 431-61117-1
Product Quantity: 1mg
Calcitonin, human Formula C151H226N40O45S3 Sequence Cys_Gly_Asn_Leu_Ser_Thr_Cys_Met_Leu_Gly_Thr_Tyr_Thr_Gln_Asp_Phe_Asn_Lys_Phe_His_Thr_Phe_Pro_Gln_Thr_Ala_Ile_Gly_Val_Gly_Ala_Pro_NH2(Disulfide brid

315 €
358 $
244 £

Catalog number: 52229
Product Quantity: 1mg
Supplier: GLSChina
Sequence Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr- Gln-Asp-Leu-Asn-Lys-Phe-His-Thr-Phe-Pro-Gln-Thr-Ser-Ile- Gly-Val-Gly-Ala-Pro-NH2(Disulfide bridge Cys1-Cys7); MF C148H228N40O46S3; MW 3

1277 €
1449 $
991 £

Catalog number: 431-64320-3
Product Quantity: 10 mg
GHRF, Bovine [H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MW:

505 €
573 $
391 £

Catalog number: SP-55420-1
Product Quantity: 0.5 mg
Supplier: ADI
[Des_Asp10]Decorsin, Leech Formula C175H272N54O59S6 Sequence Ala_Pro_Arg_Leu_Pro_Gln_Cys_Gln_Gly_Asp_Gln_Glu_Lys_Cys_Leu_Cys_Asn_Lys_Asp_Glu_Cys_Pro_Pro_Gly_Gln_Cys_Arg_Phe_Pro_Arg_Gly_Asp_Ala_Asp_P

324 €
367 $
251 £

Catalog number: 87461
Product Quantity: 1mg
Supplier: GLSChina
GHRF, (1-44), Human [H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lus-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-N

451 €
512 $
350 £

Catalog number: SP-52557-1
Product Quantity: 0.5 mg
Supplier: ADI
Sequence Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

1992 €
2261 $
1545 £

Catalog number: 431-108935-3
Product Quantity: 10 mg
Sequence Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

1148 €
1303 $
890 £

Catalog number: 431-108935-2
Product Quantity: 5 mg
Sequence Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2

543 €
616 $
421 £

Catalog number: 431-108935-1
Product Quantity: 1mg
Sequence Glu-Val-Glu-Asp-Leu-Gln-Val-Arg-Asp-Val-Glu-Leu-Ala-Gly-Ala-Pro-Gly-Glu-Gly-Gly-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ala-Leu-Gln; MF C137H225N37O49; MW 3174.54

921 €
1045 $
714 £

Catalog number: 431-64126-2
Product Quantity: 5 mg
Sequence Glu-Val-Glu-Asp-Leu-Gln-Val-Arg-Asp-Val-Glu-Leu-Ala-Gly-Ala-Pro-Gly-Glu-Gly-Gly-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ala-Leu-Gln; MF C137H225N37O49; MW 3174.54

1341 €
1522 $
1040 £

Catalog number: 431-64126-3
Product Quantity: 10 mg
Sequence Glu-Val-Glu-Asp-Leu-Gln-Val-Arg-Asp-Val-Glu-Leu-Ala-Gly-Ala-Pro-Gly-Glu-Gly-Gly-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ala-Leu-Gln; MF C137H225N37O49; MW 3174.54

407 €
462 $
316 £

Catalog number: 431-64126-1
Product Quantity: 1mg
GRF (free acid) (human) (AA:Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-

557 €
632 $
432 £

Catalog number: SP-89088-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln; MF C181H302N50O48; MW 3946.73

679 €
771 $
527 £

Catalog number: 431-97219-2
Product Quantity: 5 mg
Sequence Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln; MF C181H302N50O48; MW 3946.73

339 €
384 $
263 £

Catalog number: 431-97219-1
Product Quantity: 1mg
Rcramp Formula C181H302N50O48 Sequence Gly_Leu_Val_Arg_Lys_Gly_Gly_Glu_Lys_Phe_Gly_Glu_Lys_Leu_Arg_Lys_Ile_Gly_Gln_Lys_Ile_Lys_Glu_Phe_Phe_Gln_Lys_Leu_Ala_Leu_Glu_Ile_Glu_Gln

243 €
276 $
189 £

Catalog number: 88331
Product Quantity: 1mg
Supplier: GLSChina
Sequence Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln; MF C181H302N50O48; MW 3946.73

970 €
1101 $
752 £

Catalog number: 431-97219-3
Product Quantity: 10 mg
Adrenomedullin (11_50) (rat) Formula C194H304N58O59S4 Sequence Ser_Thr_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Met_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr_Asp_Lys_Asp_Lys_Asp_Gly_Met_Ala_Pro_Arg_Asn_Lys

433 €
491 $
336 £

Catalog number: 100047
Product Quantity: 1mg
Supplier: GLSChina
Sequence His-Pro-Leu-Gly-Ser-Pro-Gly-Ser-Ala-Ser-Asp-Leu-Glu-Thr-Ser-Gly-Leu-Gln-Glu-Gln-Arg; MF C89H144N28O35; MW 2166.31

274 €
312 $
213 £

Catalog number: 431-96364-1
Product Quantity: 1mg
Sequence His-Pro-Leu-Gly-Ser-Pro-Gly-Ser-Ala-Ser-Asp-Leu-Glu-Thr-Ser-Gly-Leu-Gln-Glu-Gln-Arg; MF C89H144N28O35; MW 2166.31

679 €
771 $
527 £

Catalog number: 431-96364-3
Product Quantity: 10 mg
Sequence His-Pro-Leu-Gly-Ser-Pro-Gly-Ser-Ala-Ser-Asp-Leu-Glu-Thr-Ser-Gly-Leu-Gln-Glu-Gln-Arg; MF C89H144N28O35; MW 2166.31

475 €
539 $
368 £

Catalog number: 431-96364-2
Product Quantity: 5 mg
Sequence Tyr-Gly-Ser-Leu-Pro-Gln-Lys-Ser-Gln-Arg-Ser-Gln-Asp-Glu-Asn; MF C71H113N23O28; MW 1736.8

257 €
292 $
200 £

Catalog number: 431-61167-1
Product Quantity: 1mg
Sequence Tyr-Gly-Ser-Leu-Pro-Gln-Lys-Ser-Gln-Arg-Ser-Gln-Asp-Glu-Asn; MF C71H113N23O28; MW 1736.8

543 €
616 $
421 £

Catalog number: 431-61167-3
Product Quantity: 10 mg
Sequence Tyr-Gly-Ser-Leu-Pro-Gln-Lys-Ser-Gln-Arg-Ser-Gln-Asp-Glu-Asn; MF C71H113N23O28; MW 1736.8

373 €
423 $
289 £

Catalog number: 431-61167-2
Product Quantity: 5 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2; MF C215H

986 €
1119 $
765 £

Catalog number: 431-61145-2
Product Quantity: 5 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2; MF C215H

440 €
500 $
341 £

Catalog number: 431-61145-1
Product Quantity: 1mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2; MF C215H

1520 €
1725 $
1179 £

Catalog number: 431-61145-3
Product Quantity: 10 mg
[Des-Gly77,His78] Myelin Basic Protein (68-84), bovine [Tyr-Gly-Ser-Leu-Pro-Gln-Lys-Ala-Gln-Arg-Pro-Gln-Asp-Glu-Asn; MW: 1730.87]

223 €
253 $
173 £

Catalog number: SP-88511-1
Product Quantity: 1 mg
Supplier: ADI
Phenylalanine-free protein 115 120 125 (AA: Gln-Gln-Lys-Glu-Pro-Met-Ile-Gly-Val-Asn-Gln-Glu-Leu-Ala-Tyr-Phe) (MW: 1895.18)

306 €
347 $
237 £

Catalog number: SP-78787-1
Product Quantity: 1 mg
Supplier: ADI
[Gln11] -β- Amyloid (1 - 40) [sp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MW: 4328.9

390 €
443 $
302 £

Catalog number: SP-87935-1
Product Quantity: 1 mg
Supplier: ADI
Sequence His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val; MF C50H80N18O16; MW 1189.29

339 €
384 $
263 £

Catalog number: 431-61133-1
Product Quantity: 5 mg
Sequence His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val; MF C50H80N18O16; MW 1189.29

857 €
972 $
664 £

Catalog number: 431-61133-3
Product Quantity: 25 mg
Fibrinogen y-chain dodecapeptide [His-his-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val-OH; MW: 1189.29]

390 €
443 $
302 £

Catalog number: SP-52245-1
Product Quantity: 1 mg
Supplier: ADI
Sequence His-His-Leu-Gly-Gly-Ala-Lys-Gln-Ala-Gly-Asp-Val; MF C50H80N18O16; MW 1189.29

440 €
500 $
341 £

Catalog number: 431-61133-2
Product Quantity: 10 mg
Osteogenic Growth Peptide [Ala-Leu-Lys-Arg-Gln-Gly-Arg-Thr-Leu-Tyr-Gly-Phe-Gly-Gly-Arg-Thr-Leu-TyrGly-Phe-Gly-Gly-OH; MW: 1523.74]

451 €
512 $
350 £

Catalog number: SP-60903-1
Product Quantity: 1 mg
Supplier: ADI
Alytesin [pGlu-Gly-Arg-Leu-Gly-Thr-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MW: 1535.8]

190 €
216 $
147 £

Catalog number: SP-55151-1
Product Quantity: 1 mg
Supplier: ADI
GHRF (1_44), human Formula C215H358N72O66S1 Sequence Tyr_Ala_Asp_Ala_Ile_Phe_Thr_Asn_Ser_Tyr_Arg_Lys_Val_Leu_Gly_Gln_Leu_Ser_Ala_Arg_Lys_Leu_Leu_Gln_Asp_Ile_Met_Ser_Arg_Gln_Gln_Gly_Glu_Ser_Asn_Gln_G

360 €
409 $
279 £

Catalog number: 52257
Product Quantity: 1mg
Supplier: GLSChina
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

1018 €
1156 $
790 £

Catalog number: 431-96823-2
Product Quantity: 5 mg
Category: Peptides
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

475 €
539 $
368 £

Catalog number: 431-82927-1
Product Quantity: 1mg
Category: Peptides
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

1665 €
1890 $
1292 £

Catalog number: 431-96823-3
Product Quantity: 10 mg
Category: Peptides
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Gln-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

475 €
539 $
368 £

Catalog number: 431-96823-1
Product Quantity: 1mg
Category: Peptides
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

1665 €
1890 $
1292 £

Catalog number: 431-82927-3
Product Quantity: 10 mg
Category: Peptides
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gln-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C194H296N54O57S; MW 4328

1018 €
1156 $
790 £

Catalog number: 431-82927-2
Product Quantity: 5 mg
Category: Peptides
Fibrinogen Binding Inhibitory Peptide Formula C50H80N18O16 Sequence His_His_Leu_Gly_Gly_Ala_Lys_Gln_Ala_Gly_Asp_Val

252 €
286 $
195 £

Catalog number: 52245
Product Quantity: 5mg
Supplier: GLSChina
Substance P_Gly_Lys_Arg Formula C77H124N24O17S Sequence Arg_Pro_Lys_Pro_Gln_Gln_Phe_Phe_Gly_Leu_Met_Gly_Lys_Arg

155 €
176 $
120 £

Catalog number: 87369
Product Quantity: 1mg
Supplier: GLSChina
GHRF, ovine Formula C221H368N72O66S1 Sequence Tyr_Ala_Asp_Ala_Ile_Phe_Thr_Asn_Ser_Tyr_Arg_Lys_Ile_Leu_Gly_Gln_Leu_Ser_Ala_Arg_Lys_Leu_Leu_Gln_Asp_Ile_Met_Asn_Arg_Gln_Gln_Gly_Glu_Arg_Asn_Gln_Glu_Gln_

360 €
409 $
279 £

Catalog number: 55421
Product Quantity: 1mg
Supplier: GLSChina
GHRF, rat Formula C225H361N77O66S1 Sequence His_Ala_Asp_Ala_Ile_Phe_Thr_Ser_Ser_Tyr_Arg_Arg_Ile_Leu_Gly_Gln_Leu_Tyr_Ala_Arg_Lys_Leu_Leu_His_Glu_Ile_Met_Asn_Arg_Gln_Gln_Gly_Glu_Arg_Asn_Gln_Glu_Gln_Ar

354 €
401 $
274 £

Catalog number: 54418
Product Quantity: 1mg
Supplier: GLSChina
Sequence Pyr-Gly-Arg-Leu-Gly-Thr-Gln-Trp-Ala-Val-Gly-His-Leu-Met- NH2; MF C68H106N22O17S; MW 1535.8

274 €
312 $
213 £

Catalog number: 431-64039-1
Product Quantity: 5 mg
Sequence Pyr-Gly-Arg-Leu-Gly-Thr-Gln-Trp-Ala-Val-Gly-His-Leu-Met- NH2; MF C68H106N22O17S; MW 1535.8

509 €
578 $
395 £

Catalog number: 431-64039-3
Product Quantity: 25 mg
Sequence Pyr-Gly-Arg-Leu-Gly-Thr-Gln-Trp-Ala-Val-Gly-His-Leu-Met- NH2; MF C68H106N22O17S; MW 1535.8

339 €
384 $
263 £

Catalog number: 431-64039-2
Product Quantity: 10 mg
Alytesin Formula C68H106N22O17S Sequence Pyr_Gly_Arg_Leu_Gly_Thr_Gln_Trp_Ala_Val_Gly_His_Leu_Met_NH2

189 €
214 $
146 £

Catalog number: 55151
Product Quantity: 5mg
Supplier: GLSChina
GHRF (1-44), human (AA: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val- Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met -Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala- Arg-Ala-Ar

557 €
632 $
432 £

Catalog number: SP-52257-1
Product Quantity: 1 mg
Supplier: ADI
MBP (68-82), guinea pig; Myelin Basic Protien (68-82) [H-Tyr-Gly-Ser-Leu-Pro-Gln-Lys-Ser-Gln-Arg-Ser-Gln-Asp-Glu-Asn-OH; MW 1736.8]

197 €
224 $
153 £

Catalog number: SP-52279-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu; MF C215H357N

970 €
1101 $
752 £

Catalog number: 431-97976-2
Product Quantity: 5 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu; MF C215H357N

1520 €
1725 $
1179 £

Catalog number: 431-97976-3
Product Quantity: 10 mg
Sequence Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu; MF C215H357N

440 €
500 $
341 £

Catalog number: 431-97976-1
Product Quantity: 1mg
BNP (1_21), Pro (Human) Formula C89H144N28O35 Sequence His_Pro_Leu_Gly_Ser_Pro_Gly_Ser_Ala_Ser_Asp_Leu_Glu_Thr_Ser_Gly_Leu_Gln_Glu_Gln_Arg

186 €
211 $
144 £

Catalog number: 87476
Product Quantity: 1mg
Supplier: GLSChina
Decorsin, Leech Formula C179H277N55O62S6 Sequence Ala_Pro_Arg_Leu_Pro_Gln_Cys_Gln_Gly_Asp_Asp_Gln_Glu_Lys_Cys_Leu_Cys_Asn_Lys_Asp_Glu_Cys_Pro_Pro_Gly_Gln_Cys_Arg_Phe_Pro_Arg_Gly_Asp_Ala_Asp_Pro_Tyr_

324 €
367 $
251 £

Catalog number: 87186
Product Quantity: 1mg
Supplier: GLSChina
Phenylalanine_free protein 115 120 125 Formula C85H131N21O26S Sequence Gln_Gln_Lys_Glu_Pro_Met_Ile_Gly_Val_Asn_Gln_Glu_Leu_Ala_Tyr_Phe

187 €
212 $
145 £

Catalog number: 78787
Product Quantity: 1mg
Supplier: GLSChina
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Se

1992 €
2261 $
1545 £

Catalog number: 431-109713-3
Product Quantity: 10 mg
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Se

1148 €
1303 $
890 £

Catalog number: 431-109713-2
Product Quantity: 5 mg
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Val-Ala-Pro-Arg-Ser-Lys-Ile-Se

543 €
616 $
421 £

Catalog number: 431-109713-1
Product Quantity: 1mg
GHRF, Rat [H-His-Ala-Asp-Ala-Ile-Phe-Thr-Ser-Ser-Tyr-Arg-Arg-Ile-Leu-Gl-Gln-Leu-Tyr0Ala-Arg-Lys-Leu-Leu-His-Glu-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2; MW: 523

505 €
573 $
391 £

Catalog number: SP-54418-1
Product Quantity: 0.5 mg
Supplier: ADI
Pannexin _ 1 Fragment (4512) Formula C55H94N18O24 Sequence Val_Gln_Gln_Lys_Ser_Ser_Leu_Gln_Ser_Glu_Ser_Gly_Asn

266 €
302 $
206 £

Catalog number: 86692
Product Quantity: 5mg
Supplier: GLSChina
GHRF (1_44), human (AA Tyr_Ala_Asp_Ala_Ile_Phe_Thr_Asn_Ser_Tyr_Arg_Lys_Val_ Leu_Gly_Gln_Leu_Ser_Ala_Arg_Lys_Leu_Leu_Gln_Asp_Ile_Met _Ser_Arg_Gln_Gln_Gly_Glu_Ser_Asn_Gln_Glu_Arg_Gly_Ala_ Arg_Ala_Arg_L

616 €
699 $
478 £

Catalog number: SP-52257-1
Product Quantity: 1 mg
Supplier: Alpha Dia
Sequence Pro-Ala-Gln-Glu-Asp-Gly-Lys-Val-Tyr-Ile-Asn-Met-Pro-Gly-Arg-Gly; MF C74H118N22O24S; MW 1731.96

373 €
423 $
289 £

Catalog number: 431-95636-2
Product Quantity: 5 mg
Category: Peptides
DAP10 Signaling Fragment (AA: Pro-Ala-Gln-Glu-Asp-Gly-Lys-Val-Tyr-Ile-Asn-Met-Pro-Gly-Arg-Gly) (MW: 1731.96)

223 €
253 $
173 £

Catalog number: SP-86748-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Pro-Ala-Gln-Glu-Asp-Gly-Lys-Val-Tyr-Ile-Asn-Met-Pro-Gly-Arg-Gly; MF C74H118N22O24S; MW 1731.96

576 €
654 $
447 £

Catalog number: 431-95636-3
Product Quantity: 10 mg
Category: Peptides
Sequence Pro-Ala-Gln-Glu-Asp-Gly-Lys-Val-Tyr-Ile-Asn-Met-Pro-Gly-Arg-Gly; MF C74H118N22O24S; MW 1731.96

257 €
292 $
200 £

Catalog number: 431-95636-1
Product Quantity: 1mg
Category: Peptides
Pannexin - 1 Fragment (4512) (AA: Val-Gln-Gln-Lys-Ser-Ser-Leu-Gln-Ser-Glu-Ser-Gly-Asn) (MW: 1391.47)

390 €
443 $
302 £

Catalog number: SP-86692-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Val-Gln-Gln-Lys-Ser-Ser-Leu-Gln-Ser-Glu-Ser-Gly-Asn; MF C55H94N18O24; MW 1391.47

775 €
880 $
601 £

Catalog number: 431-95580-3
Product Quantity: 25 mg
Sequence Val-Gln-Gln-Lys-Ser-Ser-Leu-Gln-Ser-Glu-Ser-Gly-Asn; MF C55H94N18O24; MW 1391.47

355 €
403 $
275 £

Catalog number: 431-95580-1
Product Quantity: 5 mg
Sequence Val-Gln-Gln-Lys-Ser-Ser-Leu-Gln-Ser-Glu-Ser-Gly-Asn; MF C55H94N18O24; MW 1391.47

475 €
539 $
368 £

Catalog number: 431-95580-2
Product Quantity: 10 mg
Atriopeptin I (rat) Formula C83H135N29O30S2 Sequence Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser(Disulfide bridge Cys3_Cys19)

202 €
229 $
156 £

Catalog number: 55273
Product Quantity: 0.5mg
Supplier: GLSChina
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser(Disulfide bridge Cys3-Cys19); MF C83H135N29O30S2; MW 2083.31

543 €
616 $
421 £

Catalog number: 431-64161-3
Product Quantity: 2.5 mg
Gly_Amyloid b_Protein (15_25)_Gly_e_aminocaproyl(_Lys)6 Salt _ Binding _ Synonym H_Gly_Gln_Lys_Leu_Val_Phe_Phe_Ala_Glu_Asp_Val_Gly_Gly_eAhx_Lys_Lys_Lys_Lys_Lys_Lys_OH SumFormula C105H178N28O26

451 €
512 $
350 £

Catalog number: H-3978.1000
Product Quantity: 1.0 mg
Supplier: Bach
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser(Disulfide bridge Cys3-Cys19); MF C83H135N29O30S2; MW 2083.31

307 €
348 $
238 £

Catalog number: 431-64161-1
Product Quantity: 500
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser(Disulfide bridge Cys3-Cys19); MF C83H135N29O30S2; MW 2083.31

355 €
403 $
275 £

Catalog number: 431-64161-2
Product Quantity: 1mg
Gly_Amyloid b_Protein (15_25)_Gly_e_aminocaproyl(_Lys)6 Salt _ Binding _ Synonym H_Gly_Gln_Lys_Leu_Val_Phe_Phe_Ala_Glu_Asp_Val_Gly_Gly_eAhx_Lys_Lys_Lys_Lys_Lys_Lys_OH SumFormula C105H178N28O26

268 €
304 $
208 £

Catalog number: H-3978.0500
Product Quantity: 0.5 mg
Supplier: Bach
Calcitonin (8_32) (salmon I) Formula C119H198N36O37 Sequence Val_Leu_Gly_Lys_Leu_Ser_Gln_Glu_Leu_His_Lys_Leu_Gln_Thr_Tyr_Pro_Arg_Thr_Asn_Thr_Gly_Ser_Gly_Thr_Pro_NH2

207 €
235 $
161 £

Catalog number: 89395
Product Quantity: 1mg
Supplier: GLSChina
MF C55H94N18O24 ; MW 1391.45 ; VQQKSSLQSESGN , Val-Gln-Gln-Lys-Ser-Ser-Leu-Gln-Ser-Glu-Ser-Gly-Asn

307 €
348 $
238 £

Catalog number: RB-PP-1171
Product Quantity: 1 mg
Big Gastrin _ 1, human Formula C176H251N43O53S Sequence Pyr_Leu_Gly_Pro_Gln_Gly_Pro_Pro_His_Leu_Val_Ala_Asp_Pro_Ser_Lys_Lys_Gln_Gly_Pro_Trp_Leu_Glu_Glu_Glu_Glu_Glu_Ala_Tyr_Gly_Trp_Met_Asp_Phe_NH2

225 €
256 $
175 £

Catalog number: 88140
Product Quantity: 1mg
Supplier: GLSChina
Growth Hormone Releasing Factor, GRF (1 - 40), amide, human (AA: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser

306 €
347 $
237 £

Catalog number: SP-88147-1
Product Quantity: 1 mg
Supplier: ADI
MF C141H235N39O49 ; MW 3260.62 ; EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFV, Glu-Gln-Val-Thr-Asn-Val-Gly-Gly-Ala-Val-Val-Thr-Gly-Val-Thr-Ala-Val-Ala-Gln-Lys-Thr-Val-Glu-Gly-Ala-Gly-Ser-Ile-Ala-Ala-Ala-Thr-G

509 €
578 $
395 £

Catalog number: RB-PP-1121
Product Quantity: 1 mg
Sequence Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; MF C119H198N36O37; MW 2725.12

775 €
880 $
601 £

Catalog number: 431-98283-3
Product Quantity: 10 mg
Sequence Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; MF C119H198N36O37; MW 2725.12

307 €
348 $
238 £

Catalog number: 431-98283-1
Product Quantity: 1mg
Sequence Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2; MF C119H198N36O37; MW 2725.12

576 €
654 $
447 £

Catalog number: 431-98283-2
Product Quantity: 5 mg
[Des-Asp10]Decorsin, Leech [Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu; MW: 4268.78]

557 €
632 $
432 £

Catalog number: SP-87461-1
Product Quantity: 1 mg
Supplier: ADI
Gly-Amyloid β-Protein (15-25)-Gly-ε-aminocaproyl(-Lys)6 H-Gly-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Gly-εAhx-Lys-Lys-Lys-Lys-Lys-Lys-OH 98% C105H178N28O26 CAS: 184951-46-0

746 €
847 $
579 £

Catalog number: A-1435-2
Product Quantity: 5mg
Supplier: Other suppliers
DAP10 Signaling Fragment Formula C74H118N22O24S Sequence Pro_Ala_Gln_Glu_Asp_Gly_Lys_Val_Tyr_Ile_Asn_Met_Pro_Gly_Arg_Gly

162 €
184 $
126 £

Catalog number: 86748
Product Quantity: 1mg
Supplier: GLSChina
Sequence Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2; MF C176H251N43O53S; MW 3849.30

613 €
695 $
475 £

Catalog number: 431-97028-2
Product Quantity: 5 mg
Sequence Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2; MF C176H251N43O53S; MW 3849.30

323 €
366 $
250 £

Catalog number: 431-97028-1
Product Quantity: 1mg
Sequence Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2; MF C176H251N43O53S; MW 3849.30

921 €
1045 $
714 £

Catalog number: 431-97028-3
Product Quantity: 10 mg
Big Gastrin - 1, human (AA: Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2) (MW: 3849.30)

306 €
347 $
237 £

Catalog number: SP-88140-1
Product Quantity: 1 mg
Supplier: ADI
Calcitonin (8-32) (salmon I) (AA: Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asn-Thr-Gly-Ser-Gly-Thr-Pro-NH2) (MW: 2725.12)

306 €
347 $
237 £

Catalog number: SP-89395-1
Product Quantity: 1 mg
Supplier: ADI
Atriopeptin I [H-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-OH(Cys7-Cys23); MW: 2083.31]

306 €
347 $
237 £

Catalog number: SP-55273-1
Product Quantity: 0.5 mg
Supplier: ADI
BNP (1-21), Pro (Human) (AA: His-Pro-Leu-Gly-Ser-Pro-Gly-Ser-Ala-Ser-Asp-Leu-Glu-Thr-Ser-Gly-Leu-Gln-Glu-Gln-Arg) (MW: 2166.31)

223 €
253 $
173 £

Catalog number: SP-87476-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp- Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bridge Cys16-Cy

1148 €
1303 $
890 £

Catalog number: 431-64313-2
Product Quantity: 5 mg
Sequence Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp- Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bridge Cys16-Cy

543 €
616 $
421 £

Catalog number: 431-64313-1
Product Quantity: 1mg
Sequence Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp- Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2(Disulfide bridge Cys16-Cy

1992 €
2261 $
1545 £

Catalog number: 431-64313-3
Product Quantity: 10 mg
Biotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human) (AA:Biotin-Cys-Gly-Asn-Leu-Ser-Thr-Cys-Met-Leu-Gly-Thr-Tyr-Thr-Gln-Asp-Phe-Asn-Lys(bio)-Phe-His-Thr-Phe-Pro-Gln-Thr-Ala-Ile-Gly-Val-Gly-Ala-Pro-NH2 (Di

557 €
632 $
432 £

Catalog number: SP-89393-1
Product Quantity: 1 mg
Supplier: ADI
α-Defensin-1, human [Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys (Disulfide bridge: Cys5- Cys34, Cy

1225 €
1390 $
950 £

Catalog number: SP-88391-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gl

543 €
616 $
421 £

Catalog number: 431-108934-1
Product Quantity: 1mg
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gl

1992 €
2261 $
1545 £

Catalog number: 431-108934-3
Product Quantity: 10 mg
Sequence Tyr-Arg-Gln-Ser-Met-Asn-Gln-Gly-Ser-Arg-Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gl

1148 €
1303 $
890 £

Catalog number: 431-108934-2
Product Quantity: 5 mg
Sequence Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu; MF C175H272N54O59S6; MW 4268.78

1341 €
1522 $
1040 £

Catalog number: 431-96349-3
Product Quantity: 10 mg
Sequence Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu; MF C175H272N54O59S6; MW 4268.78

954 €
1083 $
740 £

Catalog number: 431-96349-2
Product Quantity: 5 mg
Sequence Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu; MF C175H272N54O59S6; MW 4268.78

407 €
462 $
316 £

Catalog number: 431-96349-1
Product Quantity: 1mg
á_Defensin_1, human Formula C167H256N48O50S6 Sequence Asp_His_Tyr_Asn_Cys_Val_Ser_Ser_Gly_Gly_Gln_Cys_Leu_Tyr_Ser_Ala_Cys_Pro_Ile_Phe_Thr_Lys_Ile_Gln_Gly_Thr_Cys_Tyr_Arg_Gly_Lys_Ala_Lys_Cys_Cys_Lys

781 €
886 $
605 £

Catalog number: 88391
Product Quantity: 1mg
Supplier: GLSChina
Rcramp (AA: Gly-Leu-Val-Arg-Lys-Gly-Gly-Glu-Lys-Phe-Gly-Glu-Lys-Leu-Arg-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Glu-Phe-Phe-Gln-Lys-Leu-Ala-Leu-Glu-Ile-Glu-Gln) (MW: 3946.73)

390 €
443 $
302 £

Catalog number: SP-88331-1
Product Quantity: 1 mg
Supplier: ADI
Substance P-Gly-Lys-Arg (AA: Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-Gly-Lys-Arg) (MW: 1690.06)

223 €
253 $
173 £

Catalog number: SP-87369-1
Product Quantity: 1 mg
Supplier: ADI
Neuropeptide AF (hNPAF),Human Formula C90H132N26O25 Sequence Ala_Gly_Glu_Gly_Leu_Asn_Ser_Gln_Phe_Trp_Ser_Leu_Ala_Ala_Pro_Gln_Arg_Phe_NH2

177 €
201 $
137 £

Catalog number: 68624
Product Quantity: 1mg
Supplier: GLSChina
MF C28H41N7O9 ; MW 619.67 ; GYPGQV , Gly-Tyr-Pro-Gly-Gln-Val

257 €
292 $
200 £

Catalog number: RB-PP-1195
Product Quantity: 1 mg
PAR-4 (1-6) (human) (AA: Gly-Tyr-Pro-Gly-Gln-Val) (MW: 619.68)

223 €
253 $
173 £

Catalog number: SP-89792-5
Product Quantity: 5 mg
Supplier: ADI
GRF (free acid) (human) Formula C215H357N71O67S Sequence Tyr_Ala_Asp_Ala_Ile_Phe_Thr_Asn_Ser_Tyr_Arg_Lys_Val_Leu_Gly_Gln_Leu_Ser_Ala_Arg_Lys_Leu_Leu_Gln_Asp_Ile_Met_Ser_Arg_Gln_Gln_Gly_Glu_Ser_Asn_G

354 €
401 $
274 £

Catalog number: 89088
Product Quantity: 1mg
Supplier: GLSChina
[Gly1,Ser3,22,Gln4,34,Thr6,Ala19,Tyr21,Ala23,31, Aib32]_Pancreatic Polypeptide (human) Formula C183H281N57O54S2 Sequence Gly_Pro_Ser_Gln_Pro_Thr_Tyr_Pro_Gly_Asp_Asn_Ala_Thr_Pro_Glu_Gln_Met_Ala_Arg_T

311 €
353 $
241 £

Catalog number: 100447
Product Quantity: 1mg
Supplier: GLSChina
Sequence Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu; MF C179H277N55O62S6; MW 4383.87

1341 €
1522 $
1040 £

Catalog number: 431-96074-3
Product Quantity: 10 mg
Sequence Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu; MF C179H277N55O62S6; MW 4383.87

407 €
462 $
316 £

Catalog number: 431-96074-1
Product Quantity: 1mg
Sequence Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu; MF C179H277N55O62S6; MW 4383.87

954 €
1083 $
740 £

Catalog number: 431-96074-2
Product Quantity: 5 mg
BNP_45 ,rat Formula C213H349N71O65S3 Sequence Ser_Gln_Asp_Ser_Ala_Phe_Arg_Ile_Gln_Glu_Arg_Leu_Arg_Asn_Ser_Lys_Met_Ala_His_Ser_Ser_Ser_Cys_Phe_Gly_Gln_Lys_Ile_Asp_Arg_Ile_Gly_Ala_Val_Ser_Arg_Leu_Gly_

272 €
309 $
211 £

Catalog number: 89386
Product Quantity: 0.5mg
Supplier: GLSChina
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys7-Cys23 ); MF C112H175N39O35S3; MW 2724.06

307 €
348 $
238 £

Catalog number: 431-109413-1
Product Quantity: 500
Atrial Natriuretic Peptide (4_24),frog Formula C93H152N34O27S3 Sequence Cys_Phe_Gly_Ser_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Met_Gly_Cys_Gly_Arg_Arg_Phe(Disulfide bridge Cys1_Cys17)

199 €
225 $
154 £

Catalog number: 101107
Product Quantity: 0.5mg
Supplier: GLSChina
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys7-Cys23 ); MF C112H175N39O35S3; MW 2724.06

373 €
423 $
289 £

Catalog number: 431-109413-2
Product Quantity: 1mg
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys7-Cys23 ); MF C112H175N39O35S3; MW 2724.06

594 €
675 $
461 £

Catalog number: 431-109413-3
Product Quantity: 2.5 mg
Atrial Natriuretic Factor (4-28) (human) (AA: Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys7-Cys23 )) (MW: 2724.06)

390 €
443 $
302 £

Catalog number: SP-100525-05
Product Quantity: 0.5 mg
Supplier: ADI
Atrial Natriuretic Factor (4_28) (human) Formula C112H175N39O35S3 Sequence Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr(Disulfide bridge Cys7_C

215 €
244 $
166 £

Catalog number: 100525
Product Quantity: 0.5mg
Supplier: GLSChina
Sequence Tyr-Val-Met-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-Arg-Arg-Asn-Gly-Ser-Ser-Ser-Ser-Gly-Val-Gly-Gly-Ala-Ala-Gln; MF C126H188N44O37S; MW 2943.2

576 €
654 $
447 £

Catalog number: 431-61165-2
Product Quantity: 2mg
ã3_MSH Formula C126H188N44O37S Sequence Tyr_Val_Met_Gly_His_Phe_Arg_Trp_Asp_Arg_Phe_Gly_Arg_Arg_Asn_Gly_Ser_Ser_Ser_Ser_Gly_Val_Gly_Gly_Ala_Ala_Gln

310 €
352 $
240 £

Catalog number: 52277
Product Quantity: 1mg
Supplier: GLSChina
Sequence Tyr-Val-Met-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-Arg-Arg-Asn-Gly-Ser-Ser-Ser-Ser-Gly-Val-Gly-Gly-Ala-Ala-Gln; MF C126H188N44O37S; MW 2943.2

921 €
1045 $
714 £

Catalog number: 431-61165-3
Product Quantity: 5 mg
Sequence Tyr-Val-Met-Gly-His-Phe-Arg-Trp-Asp-Arg-Phe-Gly-Arg-Arg-Asn-Gly-Ser-Ser-Ser-Ser-Gly-Val-Gly-Gly-Ala-Ala-Gln; MF C126H188N44O37S; MW 2943.2

373 €
423 $
289 £

Catalog number: 431-61165-1
Product Quantity: 1mg
Sequence Gly-Tyr-Pro-Gly-Gln-Val; MF C28H41N7O9; MW 619.68

323 €
366 $
250 £

Catalog number: 431-98680-2
Product Quantity: 10 mg
Sequence Gly-Tyr-Pro-Gly-Gln-Val; MF C28H41N7O9; MW 619.68

257 €
292 $
200 £

Catalog number: 431-98680-1
Product Quantity: 5 mg
Sequence Gly-Tyr-Pro-Gly-Gln-Val; MF C28H41N7O9; MW 619.68

475 €
539 $
368 £

Catalog number: 431-98680-3
Product Quantity: 25 mg
Atrial Natriuretic Peptide (4-24), frog (AA: Cys-Phe-Gly-Ser-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Met-Gly-Cys-Gly-Arg-Arg-Phe (Disulfide bridge: Cys1-Cys17)) (MW: 2273.64)

390 €
443 $
302 £

Catalog number: SP-101107-05
Product Quantity: 0.5 mg
Supplier: ADI
Sequence Ala-Gly-Glu-Gly-Leu-Asn-Ser-Gln-Phe-Trp-Ser-Leu-Ala-Ala-Pro-Gln-Arg-Phe-NH2; MF C90H132N26O25; MW 1978.21

440 €
500 $
341 £

Catalog number: 431-77512-2
Product Quantity: 5 mg
Neuropeptide AF (hNPAF), Human (AA: Ala-Gly-Glu-Gly-Leu-Asn-Ser-Gln-Phe-Trp-Ser-Leu-Ala-Ala-Pro-Gln-Arg-Phe-NH2) (MW: 1978.21)

223 €
253 $
173 £

Catalog number: SP-68624-1
Product Quantity: 1 mg
Supplier: ADI
Sequence Ala-Gly-Glu-Gly-Leu-Asn-Ser-Gln-Phe-Trp-Ser-Leu-Ala-Ala-Pro-Gln-Arg-Phe-NH2; MF C90H132N26O25; MW 1978.21

662 €
751 $
513 £

Catalog number: 431-77512-3
Product Quantity: 10 mg
Sequence Ala-Gly-Glu-Gly-Leu-Asn-Ser-Gln-Phe-Trp-Ser-Leu-Ala-Ala-Pro-Gln-Arg-Phe-NH2; MF C90H132N26O25; MW 1978.21

257 €
292 $
200 £

Catalog number: 431-77512-1
Product Quantity: 1mg
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu-NH2; MF C61H94N18O16; MW 1335.54

257 €
292 $
200 £

Catalog number: 431-64025-1
Product Quantity: 2mg
Allatostatin I Formula C61H94N18O16 Sequence Ala_Pro_Ser_Gly_Ala_Gln_Arg_Leu_Tyr_Gly_Phe_Gly_Leu_NH2

227 €
258 $
176 £

Catalog number: 55137
Product Quantity: 5mg
Supplier: GLSChina
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu-NH2; MF C61H94N18O16; MW 1335.54

407 €
462 $
316 £

Catalog number: 431-64025-3
Product Quantity: 10 mg
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu-NH2; MF C61H94N18O16; MW 1335.54

323 €
366 $
250 £

Catalog number: 431-64025-2
Product Quantity: 5 mg
Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-Gly-Lys-Arg; MF C77H124N24O17S; MW 1690.06

509 €
578 $
395 £

Catalog number: 431-96257-3
Product Quantity: 10 mg
Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-Gly-Lys-Arg; MF C77H124N24O17S; MW 1690.06

257 €
292 $
200 £

Catalog number: 431-96257-1
Product Quantity: 1mg
Sequence Arg-Pro-Lys-Pro-Gln-Gln-Phe-Phe-Gly-Leu-Met-Gly-Lys-Arg; MF C77H124N24O17S; MW 1690.06

355 €
403 $
275 £

Catalog number: 431-96257-2
Product Quantity: 5 mg
Secretin, rat Formula C129H216N42O42 Sequence His_Ser_Asp_Gly_Thr_Phe_Thr_Ser_Glu_Leu_Ser_Arg_Leu_Gln_Asp_Ser_Ala_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Gly_Leu_Val_NH2

216 €
245 $
167 £

Catalog number: 55230
Product Quantity: 1mg
Supplier: GLSChina
Allatostatin I (free acid) (AA: Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu) (MW: 1335.5)

390 €
443 $
302 £

Catalog number: SP-100832-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu; MF C61H94N18O16; MW 1335.5

355 €
403 $
275 £

Catalog number: 431-109720-1
Product Quantity: 5 mg
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu; MF C61H94N18O16; MW 1335.5

775 €
880 $
601 £

Catalog number: 431-109720-3
Product Quantity: 25 mg
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu; MF C61H94N18O16; MW 1335.5

475 €
539 $
368 £

Catalog number: 431-109720-2
Product Quantity: 10 mg
Growth Hormone Releasing Factor, GRF, (1 - 40), human (AA: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-G

557 €
632 $
432 £

Catalog number: SP-88148-1
Product Quantity: 1 mg
Supplier: ADI
Allatostatin I (free acid) Formula C61H94N18O16 Sequence Ala_Pro_Ser_Gly_Ala_Gln_Arg_Leu_Tyr_Gly_Phe_Gly_Leu

266 €
302 $
206 £

Catalog number: 100832
Product Quantity: 5mg
Supplier: GLSChina
Adrenomedullin(13-52), Human [H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-Nh2(Cys1

731 €
830 $
567 £

Catalog number: SP-55425-1
Product Quantity: 0.5 mg
Supplier: ADI
Allatostatin [H-Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-tyr-Gly-Phe-Gly-Leu-NH2; MW: 1335.54]

390 €
443 $
302 £

Catalog number: SP-55137-1
Product Quantity: 1 mg
Supplier: ADI
PAR-4 (1-6) amide (human) (AA: Gly-Tyr-Pro-Gly-Gln-Val-NH2) (MW: 618.70)

223 €
253 $
173 £

Catalog number: SP-53696-5
Product Quantity: 5 mg
Supplier: ADI
Sequence Gly-Tyr-Pro-Gly-Gln-Val-NH2; MF C28H42N8O8; MW 618.70

274 €
312 $
213 £

Catalog number: 431-62584-1
Product Quantity: 5 mg
Sequence Gly-Tyr-Pro-Gly-Gln-Val-NH2; MF C28H42N8O8; MW 618.70

339 €
384 $
263 £

Catalog number: 431-62584-2
Product Quantity: 10 mg
Sequence Gly-Tyr-Pro-Gly-Gln-Val-NH2; MF C28H42N8O8; MW 618.70

509 €
578 $
395 £

Catalog number: 431-62584-3
Product Quantity: 25 mg
PAR_4 (1_6) (human) Formula C28H41N7O9 Sequence Gly_Tyr_Pro_Gly_Gln_Val

174 €
197 $
135 £

Catalog number: 89792
Product Quantity: 5mg
Supplier: GLSChina
Atrial Natriuretic Factor (3-28) (human) (AA: Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys5-Cys21 )) (MW: 2880.3)

390 €
443 $
302 £

Catalog number: SP-100523-05
Product Quantity: 0.5 mg
Supplier: ADI
Atrial Natriuretic Factor (3_28) (human) Formula C117H187N43O36S3 Sequence Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr(Disulfide bridge Cy

247 €
280 $
191 £

Catalog number: 100523
Product Quantity: 0.5mg
Supplier: GLSChina
MBP (68_82), gulinea pig; Myelin Basic Protein(68_82),guinea pig Formula C71H113N23O28 Sequence Tyr_Gly_Ser_Leu_Pro_Gln_Lys_Ser_Gln_Arg_Ser_Gln_Asp_Glu_Asn

159 €
180 $
123 £

Catalog number: 52279
Product Quantity: 1mg
Supplier: GLSChina
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C197H300N54O59S; MW 4400

1665 €
1890 $
1292 £

Catalog number: 431-98181-3
Product Quantity: 10 mg
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C197H300N54O59S; MW 4400

475 €
539 $
368 £

Catalog number: 431-98181-1
Product Quantity: 1mg
Sequence Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gln-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val; MF C197H300N54O59S; MW 4400

1018 €
1156 $
790 £

Catalog number: 431-98181-2
Product Quantity: 5 mg
Elcatonin Acetate (AA: Ser-Asn-Leu-Ser-Thr-Asu-Val-Leu-Gly-Lys-Leu-Ser-Gln-Glu-Leu-His-Lys-Leu-Gln-Thr-Tyr-Pro-Arg-Thr-Asp-Val-Gly-Ala-Gly-Thr-Pro (Lactam bridge: Ser1-Asu6)) (MW: 3363.8)

724 €
822 $
561 £

Catalog number: SP-61717-1
Product Quantity: 1 mg
Supplier: ADI
[Nle13, Glu14] Motilin, human, porcine [Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Nle-Glu-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MW 1012.13]

223 €
253 $
173 £

Catalog number: SP-88930-1
Product Quantity: 1 mg
Supplier: ADI
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Gln-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MF C129H216N42O42; MW 3027.42

857 €
972 $
664 £

Catalog number: 431-64118-3
Product Quantity: 10 mg
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Gln-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MF C129H216N42O42; MW 3027.42

307 €
348 $
238 £

Catalog number: 431-64118-1
Product Quantity: 1mg
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Gln-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MF C129H216N42O42; MW 3027.42

594 €
675 $
461 £

Catalog number: 431-64118-2
Product Quantity: 5 mg
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Nle-Glu-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C44H61N13O13S; MW 1012.13

274 €
312 $
213 £

Catalog number: 431-97818-1
Product Quantity: 1mg
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Nle-Glu-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C44H61N13O13S; MW 1012.13

679 €
771 $
527 £

Catalog number: 431-97818-3
Product Quantity: 10 mg
Sequence Phe-Val-Pro-Ile-Phe-Thr-Tyr-Gly-Glu-Leu-Gln-Arg-Nle-Glu-Glu-Lys-Glu-Arg-Asn-Lys-Gly-Gln; MF C44H61N13O13S; MW 1012.13

475 €
539 $
368 £

Catalog number: 431-97818-2
Product Quantity: 5 mg
Sequence Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys

3464 €
3932 $
2687 £

Catalog number: 431-97279-3
Product Quantity: 10 mg
Sequence Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys

2409 €
2734 $
1869 £

Catalog number: 431-97279-2
Product Quantity: 5 mg
Sequence Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys

921 €
1045 $
714 £

Catalog number: 431-97279-1
Product Quantity: 1mg
Leucokinin III (AA: Asp-Gln-Gly-Phe-Asn-Ser-Trp-Gly-NH2) (MW: 908.9)

306 €
347 $
237 £

Catalog number: SP-100541-5
Product Quantity: 5 mg
Supplier: ADI
MF C46H64N14O14 ; MW 1037.09 ; FSWGAEGQR , Phe-Ser-Trp-Gly-Ala-Glu-Gly-Gln-Arg

307 €
348 $
238 £

Catalog number: RB-PP-0639
Product Quantity: 1 mg

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45 | Gentaur

Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411 | Gentaur



9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017


Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925 | Gentaur

Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123

GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897 | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U

tel:0911876558 | Gentaur

ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: | Gentaur
IBAN: BG11FINV91501014771636

GENTAUR Poland Sp. z o.o.

ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48       | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556


Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94 | Gentaur