GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc 6017 Snell Ave, Ste 357, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, sales@genprice.com

Full view Results
Aldosterone Secretion Inhibiting Factor (1-35) (bovine) (AA: Ala-Leu-Arg-Gly-Pro-Lys-Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr

724 €
822 $
561 £

Catalog number: SP-100519-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Ala-Leu-Arg-Gly-Pro-Lys-Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr

1148 €
1303 $
890 £

Catalog number: 431-109407-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ala-Leu-Arg-Gly-Pro-Lys-Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr

543 €
616 $
421 £

Catalog number: 431-109407-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ala-Leu-Arg-Gly-Pro-Lys-Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr

1992 €
2261 $
1545 £

Catalog number: 431-109407-3
Product Quantity: 10 mg
Category:
Supplier:
BNP-32 ,porcine (AA: Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr (Disulfide bridge:Cys10-Cys26)) (MW: 3570.17)

390 €
443 $
302 £

Catalog number: SP-89385-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
BNP_26 (porcine) Formula C120H198N42O36S2 Sequence Asp_Ser_Gly_Cys_Phe_Gly_Arg_Arg_Leu_Asp_Arg_Ile_Gly_Ser_Leu_Ser_Gly_Leu_Gly_Cys_Asn_Val_Leu_Arg_Arg_Tyr(Disulfide bridge Cys4_Cys5)

224 €
255 $
174 £

Catalog number: 89383
Product Quantity: 1mg
Category:
Supplier: GLSChina
Aldosterone Secretion Inhibiting Factor (1_35) (bovine) Formula C164H278N58O45S4 Sequence Ala_Leu_Arg_Gly_Pro_Lys_Met_Met_Arg_Asp_Ser_Gly_Cys_Phe_Gly_Arg_Arg_Leu_Asp_Arg_Ile_Gly_Ser_Leu_Ser_Gly_Leu_

433 €
491 $
336 £

Catalog number: 100519
Product Quantity: 1mg
Category:
Supplier: GLSChina
Osteogenic Growth Peptide [Ala-Leu-Lys-Arg-Gln-Gly-Arg-Thr-Leu-Tyr-Gly-Phe-Gly-Gly-Arg-Thr-Leu-TyrGly-Phe-Gly-Gly-OH; MW: 1523.74]

451 €
512 $
350 £

Catalog number: SP-60903-1
Product Quantity: 1 mg
Category:
Supplier: ADI
BNP_32 ,porcine Formula C149H250N52O44S3 Sequence Ser_Pro_Lys_Thr_Met_Arg_Asp_Ser_Gly_Cys_Phe_Gly_Arg_Arg_Leu_Asp_Arg_Ile_Gly_Ser_Leu_Ser_Gly_Leu_Gly_Cys_Asn_Val_Leu_Arg_Arg_Tyr(Disulfide bridge Cys

240 €
273 $
186 £

Catalog number: 89385
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
BNP-26 (porcine) (AA: Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr (Disulfide bridge:Cys4-Cys5)) (MW: 2869.30)

223 €
253 $
173 £

Catalog number: SP-89383-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr

323 €
366 $
250 £

Catalog number: 431-98273-1
Product Quantity: 500
Category:
Supplier:
Sequence Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr

662 €
751 $
513 £

Catalog number: 431-98273-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ser-Pro-Lys-Thr-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr

440 €
500 $
341 £

Catalog number: 431-98273-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Leu-Leu-Phe-Leu-Lys-Glu-Gly-Gly-Leu; MF C87H148N26O24; MW 1942.31

407 €
462 $
316 £

Catalog number: 431-64048-2
Product Quantity: 5 mg
Category:
Supplier:
CKS_17 Formula C87H148N26O24 Sequence Leu_Gln_Asn_Arg_Arg_Gly_Leu_Asp_Leu_Leu_Phe_Leu_Lys_Glu_Gly_Gly_Leu

167 €
190 $
130 £

Catalog number: 55160
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Leu-Leu-Phe-Leu-Lys-Glu-Gly-Gly-Leu; MF C87H148N26O24; MW 1942.31

594 €
675 $
461 £

Catalog number: 431-64048-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Leu-Leu-Phe-Leu-Lys-Glu-Gly-Gly-Leu; MF C87H148N26O24; MW 1942.31

257 €
292 $
200 £

Catalog number: 431-64048-1
Product Quantity: 1mg
Category:
Supplier:
a-ANF (1-28), Human [Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cus-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MW: 3080.46]

390 €
443 $
302 £

Catalog number: SP-52223-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Osteogenic Growth Peptide Formula C68H110N22O18 Sequence Ala_Leu_Lys_Arg_Gln_Gly_Arg_Thr_Leu_Tyr_Gly_Phe_Gly_Gly

279 €
316 $
216 £

Catalog number: 60903
Product Quantity: 1mg
Category:
Supplier: GLSChina
CKS-17 [H-Leu-Gln-Asn-Arg-Arg-Gly-Leu-Asp-Leu-Leu-Phe-Leu-Lys-Glu-Gly-Gly-Leu-OH; MW: 1942.31]

190 €
216 $
147 £

Catalog number: SP-55160-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Ala-Leu-Lys-Arg-Gln-Gly-Arg-Thr-Leu-Tyr-Gly-Phe-Gly-Gly; MF C68H110N22O18; MW 1523.74

355 €
403 $
275 £

Catalog number: 431-69791-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ala-Leu-Lys-Arg-Gln-Gly-Arg-Thr-Leu-Tyr-Gly-Phe-Gly-Gly; MF C68H110N22O18; MW 1523.74

257 €
292 $
200 £

Catalog number: 431-69791-2
Product Quantity:
Category:
Supplier:
Sequence Ala-Leu-Lys-Arg-Gln-Gly-Arg-Thr-Leu-Tyr-Gly-Phe-Gly-Gly; MF C68H110N22O18; MW 1523.74

257 €
292 $
200 £

Catalog number: 431-69791-3
Product Quantity:
Category:
Supplier:
Sequence Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr

921 €
1045 $
714 £

Catalog number: 431-98271-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr

594 €
675 $
461 £

Catalog number: 431-98271-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Leu-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Leu-Gly-Cys-Asn-Val-Leu-Arg-Arg-Tyr

323 €
366 $
250 £

Catalog number: 431-98271-1
Product Quantity: 1mg
Category:
Supplier:
Hypocretin (70_98) (human) Formula C125H214N44O37S1 Sequence Arg_Ser_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_Gly

220 €
250 $
170 £

Catalog number: 100438
Product Quantity: 1mg
Category:
Supplier: GLSChina
á_ANF(1_28), human Formula C127H203N45O39S3 Sequence Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr (Disulfide bridge Cys7_Cys23)

266 €
302 $
206 £

Catalog number: 52223
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Vasonatrin Peptide (VNP) Formula C124H198N36O36S3 Sequence Gly_Leu_Ser_Lys_Gly_Cys_Phe_Gly_Leu_Lys_Leu_Asp_Arg_Ile_Gly_Ser_Met_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr ((Disulfide bridge Cys6_Cys22)

247 €
280 $
191 £

Catalog number: 89551
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C127H203N45O39S3; MW 3080.46

475 €
539 $
368 £

Catalog number: 431-61111-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C127H203N45O39S3; MW 3080.46

355 €
403 $
275 £

Catalog number: 431-61111-1
Product Quantity: 500
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C127H203N45O39S3; MW 3080.46

727 €
825 $
564 £

Catalog number: 431-61111-3
Product Quantity: 2.5 mg
Category:
Supplier:
Z_Leu_Arg_Gly_Gly_MCA

292 €
331 $
226 £

Catalog number: 3176-v
Product Quantity: 5mg
Category:
Supplier: Sceti K.K.
Orexin B, canine Formula C125H214N44O34S1 Sequence Arg_Pro_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

215 €
244 $
166 £

Catalog number: 55233
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly; MF C125H214N44O37S; MW 2957.4

594 €
675 $
461 £

Catalog number: 431-109326-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly; MF C125H214N44O37S; MW 2957.4

323 €
366 $
250 £

Catalog number: 431-109326-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly; MF C125H214N44O37S; MW 2957.4

857 €
972 $
664 £

Catalog number: 431-109326-3
Product Quantity: 10 mg
Category:
Supplier:
Vasonatrin Peptide (VNP) (AA: Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr ((Disulfide bridge: Cys6-Cys22)) (MW: 2865.37)

390 €
443 $
302 £

Catalog number: SP-89551-1
Product Quantity: 1 mg
Category:
Supplier: ADI
SMAP 29, Sheep Myeloid Antimicrobial Peptide 29 Formula C146H260N52O32 Sequence Arg_Gly_Leu_Arg_Arg_Leu_Gly_Arg_Lys_Ile_Ala_His_Gly_Val_Lys_Lys_Tyr_Gly_Pro_Thr_Val_Leu_Arg_Ile_Ile_Arg_Ile_Ala_Gly

220 €
250 $
170 £

Catalog number: 85560
Product Quantity: 1mg
Category:
Supplier: GLSChina
C_Type Natriuretic Peptide,Chicken Formula C93H157N29O29S3 Sequence Gly_Leu_Ser_Arg_Ser_Cys_Phe_Gly_Val_Lys_Leu_Asp_Arg_Ile_Gly_Ser_Met_Ser_Gly_Leu_Gly_Cys(Disulfide bridge Cys6_Cys22)

202 €
229 $
156 £

Catalog number: 55271
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Urodilatin CCC ANP-95-126 [Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (Disfulide brdige Cys11-Cys27); MW: 356]

665 €
755 $
516 £

Catalog number: SP-52313-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Gly-Leu-Ser-Arg-Ser-Cys-Phe-Gly-Val-Lys-Leu-Asp-Arg- Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(Disulfide bridge Cys6-Cys22); MF C93H157N29O29S3; MW 2241.66

307 €
348 $
238 £

Catalog number: 431-64159-1
Product Quantity: 500
Category:
Supplier:
Sequence Gly-Leu-Ser-Arg-Ser-Cys-Phe-Gly-Val-Lys-Leu-Asp-Arg- Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(Disulfide bridge Cys6-Cys22); MF C93H157N29O29S3; MW 2241.66

355 €
403 $
275 £

Catalog number: 431-64159-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Leu-Ser-Arg-Ser-Cys-Phe-Gly-Val-Lys-Leu-Asp-Arg- Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(Disulfide bridge Cys6-Cys22); MF C93H157N29O29S3; MW 2241.66

543 €
616 $
421 £

Catalog number: 431-64159-3
Product Quantity: 2.5 mg
Category:
Supplier:
Urodilatin CCC_ANP_95_126 Formula C145H234N52O44S3 Sequence Thr_Ala_Pro_Arg_Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr(Disulfide

383 €
434 $
297 £

Catalog number: 52313
Product Quantity: 1mg
Category:
Supplier: GLSChina
C-Type Natriuretic Peptide, Chicken [H-Gly-Leu-Ser-Arg-Ser-Cys-Phe-Gly-Val-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH (Cys6-Cys22); MW: 2241.66]

306 €
347 $
237 £

Catalog number: SP-55271-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C125H214N44O34S; MW 2909.44

576 €
654 $
447 £

Catalog number: 431-64121-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C125H214N44O34S; MW 2909.44

307 €
348 $
238 £

Catalog number: 431-64121-1
Product Quantity: 500
Category:
Supplier:
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C125H214N44O34S; MW 2909.44

373 €
423 $
289 £

Catalog number: 431-64121-2
Product Quantity: 1mg
Category:
Supplier:
Enkephalin_Arg_Gly_Leu _Methionine (Tyr_Gly_Gly_Phe_Met_Arg_Gly_Leu) _ 1mg

124 €
140 $
96 £

Catalog number: 024-49
Product Quantity: 1 mg
Category:
Supplier: Phoenix Peptide
Orexin B, human Formula C123H212N44O35S1 Sequence Arg_Ser_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

215 €
244 $
166 £

Catalog number: 54422
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Atrial Natriuretic Peptide Substrate, [pS6] ANF 1-28 (AA: Ser-Leu-Arg-Arg-Ser-pSer-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys7-Cys23

390 €
443 $
302 £

Catalog number: SP-101376-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Hypocretin (70-98) (human) (AA: Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-Gly) (MW: 2957.4)

390 €
443 $
302 £

Catalog number: SP-100438-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Biotin_Atrial Natriuretic Peptide (1_28), human,porcine Formula C137H217N47O41S4 Sequence Biotin_Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_P

291 €
330 $
225 £

Catalog number: 101108
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ser-Leu-Arg-Arg-Ser-pSer-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H206N45PO42S2; MW 3143.5

679 €
771 $
527 £

Catalog number: 431-110264-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-pSer-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H206N45PO42S2; MW 3143.5

440 €
500 $
341 £

Catalog number: 431-110264-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-pSer-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H206N45PO42S2; MW 3143.5

339 €
384 $
263 £

Catalog number: 431-110264-1
Product Quantity: 500
Category:
Supplier:
Atrial Natriuretic Peptide Substrate, [pS6] ANF 1 – 28 Formula C128H206N49O38S2P Sequence Ser_Leu_Arg_Arg_Ser_pSer_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg

247 €
280 $
191 £

Catalog number: 101376
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
C_Type Natriuretic Peptide (1_22), human Formula C93H157N27O28S3 Sequence Gly_Leu_Ser_Lys_Gly_Cys_Phe_Gly_Leu_Lys_Leu_Asp_Arg_Ile_Gly_Ser_Met_Ser_Gly_Leu_Gly_Cys(Disulfide bridge Cys6_Cys22)

207 €
235 $
161 £

Catalog number: 52233
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
[Tyr0]_C_Type Natriuretic Peptide (32_53) (human, porcine, rat) Formula C102H166N28O30S3 Sequence Tyr_Gly_Leu_Ser_Lys_Gly_Cys_Phe_Gly_Leu_Lys_Leu_Asp_Arg_Ile_Gly_Ser_Met_Ser_Gly_Leu_Gly_Cys (Disulf

203 €
230 $
157 £

Catalog number: 89550
Product Quantity: 1mg
Category:
Supplier: GLSChina
[Tyr0]-C-Type Natriuretic Peptide (32-53) (human, porcine, rat) [Tyr-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge: Cys7-Cys23); MW 2360.8

306 €
347 $
237 £

Catalog number: SP-89550-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Orexin B, Canine [H-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 299.44]

318 €
361 $
247 £

Catalog number: SP-55233-5
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Tyr-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge Cys7-Cys23); MF C102H166N28O30S3; MW 2360.82

594 €
675 $
461 £

Catalog number: 431-98438-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge Cys7-Cys23); MF C102H166N28O30S3; MW 2360.82

307 €
348 $
238 £

Catalog number: 431-98438-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys (Disulfide bridge Cys7-Cys23); MF C102H166N28O30S3; MW 2360.82

775 €
880 $
601 £

Catalog number: 431-98438-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C123H212N44O35S; MW 2899.4

373 €
423 $
289 £

Catalog number: 431-63310-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C123H212N44O35S; MW 2899.4

307 €
348 $
238 £

Catalog number: 431-63310-1
Product Quantity: 500
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C123H212N44O35S; MW 2899.4

576 €
654 $
447 £

Catalog number: 431-63310-3
Product Quantity: 2.5 mg
Category:
Supplier:
SMAP 29, Sheep Myeloid Antimicrobial Peptide 29 (AA: Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-Arg-Ile-Ala-Gly) (MW: 3256.03)

390 €
443 $
302 £

Catalog number: SP-85560-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(Disulfide bridge Cys6-Cys22); MF C93H157N27O28S3; MW 2197.64

355 €
403 $
275 £

Catalog number: 431-61121-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(Disulfide bridge Cys6-Cys22); MF C93H157N27O28S3; MW 2197.64

307 €
348 $
238 £

Catalog number: 431-61121-1
Product Quantity: 500
Category:
Supplier:
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys(Disulfide bridge Cys6-Cys22); MF C93H157N27O28S3; MW 2197.64

576 €
654 $
447 £

Catalog number: 431-61121-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Biotin-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

1116 €
1266 $
865 £

Catalog number: 431-109996-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Biotin-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

775 €
880 $
601 £

Catalog number: 431-109996-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Biotin-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

355 €
403 $
275 £

Catalog number: 431-109996-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys11- Cys 27); MF C145H234N52O44S3; MW 350

257 €
292 $
200 £

Catalog number: 431-61201-3
Product Quantity:
Category:
Supplier:
Sequence Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys11- Cys 27); MF C145H234N52O44S3; MW 350

475 €
539 $
368 £

Catalog number: 431-61201-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys11- Cys 27); MF C145H234N52O44S3; MW 350

257 €
292 $
200 £

Catalog number: 431-61201-2
Product Quantity:
Category:
Supplier:
Atrial Natriuretic Peptide (1-28), rat (AA: Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp- Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg -Tyr (Disulfide bridge:Cys7-Cys23)(MW: 3062

390 €
443 $
302 £

Catalog number: SP-55278-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Biotin-Atrial Natriuretic Peptide (1-28), human, porcine (AA: Biotin-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridg

472 €
536 $
366 £

Catalog number: SP-101108-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Biotin_Atrial Natriuretic Peptide (1_28), human, porcine (AA Biotin_Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr (Disulfide bridge

523 €
593 $
405 £

Catalog number: SP-101108-1
Product Quantity: 1 mg
Category:
Supplier: Alpha Dia
[Ala11,D_Leu15]_Orexin B (human) Formula C120H206N44O35S Sequence Arg_Ser_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Ala_Gln_Arg_Leu_D_Leu_Gln_Ala_Ser_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

247 €
280 $
191 £

Catalog number: 100439
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp- Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H205N45O39S2; MW 3062.47

679 €
771 $
527 £

Catalog number: 431-64166-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp- Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H205N45O39S2; MW 3062.47

440 €
500 $
341 £

Catalog number: 431-64166-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp- Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys7-Cys23); MF C128H205N45O39S2; MW 3062.47

339 €
384 $
263 £

Catalog number: 431-64166-1
Product Quantity: 500
Category:
Supplier:
Sequence Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C145H238N48O38S2; MW 3325.9

970 €
1101 $
752 £

Catalog number: 431-110016-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C145H238N48O38S2; MW 3325.9

679 €
771 $
527 £

Catalog number: 431-110016-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C145H238N48O38S2; MW 3325.9

339 €
384 $
263 £

Catalog number: 431-110016-1
Product Quantity: 1mg
Category:
Supplier:
Orexin B, rat, mouse Formula C126H215N45O34S1 Sequence Arg_Pro_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Asn_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

215 €
244 $
166 £

Catalog number: 55234
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Apelin_36, human Formula C184H297N69O43S Sequence Leu_Val_Gln_Pro_Arg_Gly_Ser_Arg_Asn_Gly_Pro_Gly_Pro_Trp_Gln_Gly_Gly_Arg_Arg_Lys_Phe_Arg_Arg_Gln_Arg_Pro_Arg_Leu_Ser_His_Lys_Gly_Pro_Met_Pro_Phe

253 €
287 $
196 £

Catalog number: 71114
Product Quantity: 1mg
Category:
Supplier: GLSChina
Orexin-B, Human [Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 2899.4]

390 €
443 $
302 £

Catalog number: SP-54422-5
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Atrial Natriuretic Peptide (1_28),rat Formula C128H205N45O39S2 Sequence Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr

247 €
280 $
191 £

Catalog number: 55278
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Biotin_[Tyr0]_Orexin B, mouse,rat Formula C145H238N48O38S2 Sequence Biotin_Tyr_Arg_Pro_Gly_Pro_Pro_Gly_Leu_Gln_Gly_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Ala_Asn_Gly_Asn_His_Ala_Ala_Gly_Ile_Leu_Thr_Met_NH2

241 €
274 $
187 £

Catalog number: 101128
Product Quantity: 1mg
Category:
Supplier: GLSChina
C-Type Natriuretic Peptide (1-22), Human [H-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-OH; MW: 2197.64]

306 €
347 $
237 £

Catalog number: SP-52233-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
[Ala11, D-Leu15]-Orexin B (human) [Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 2857.28]

390 €
443 $
302 £

Catalog number: SP-100439-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe; MF C184H297N69O43S; MW 4195.92

339 €
384 $
263 £

Catalog number: 431-80002-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe; MF C184H297N69O43S; MW 4195.92

986 €
1119 $
765 £

Catalog number: 431-80002-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe; MF C184H297N69O43S; MW 4195.92

695 €
789 $
539 £

Catalog number: 431-80002-2
Product Quantity: 5 mg
Category:
Supplier:
Atrial Natriuretic Factor (3-28) (human) (AA: Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys5-Cys21 )) (MW: 2880.3)

390 €
443 $
302 £

Catalog number: SP-100523-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Atrial Natriuretic Factor (3_28) (human) Formula C117H187N43O36S3 Sequence Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr(Disulfide bridge Cy

247 €
280 $
191 £

Catalog number: 100523
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-Arg-Ile-Ala-Gly; MF C146H260N52O32; MW 3256.03

323 €
366 $
250 £

Catalog number: 431-94448-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-Arg-Ile-Ala-Gly; MF C146H260N52O32; MW 3256.03

594 €
675 $
461 £

Catalog number: 431-94448-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-Arg-Ile-Ala-Gly; MF C146H260N52O32; MW 3256.03

857 €
972 $
664 £

Catalog number: 431-94448-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Me

775 €
880 $
601 £

Catalog number: 431-98437-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Me

1245 €
1413 $
966 £

Catalog number: 431-98437-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Me

576 €
654 $
447 £

Catalog number: 431-98437-1
Product Quantity: 500
Category:
Supplier:
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

339 €
384 $
263 £

Catalog number: 431-98439-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

679 €
771 $
527 £

Catalog number: 431-98439-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Lys-Leu-Asp-Arg-Ile-Gly-Ser-Met-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

970 €
1101 $
752 £

Catalog number: 431-98439-3
Product Quantity: 10 mg
Category:
Supplier:
Biotin-[Tyr0]-Orexin B, mouse, rat (AA: Biotin-Tyr-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2) (MW: 3325.9)

390 €
443 $
302 £

Catalog number: SP-101128-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C120H206N44O35S; MW 2857.28

679 €
771 $
527 £

Catalog number: 431-109327-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C120H206N44O35S; MW 2857.28

339 €
384 $
263 £

Catalog number: 431-109327-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Ala-Gln-Arg-Leu-D-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C120H206N44O35S; MW 2857.28

970 €
1101 $
752 £

Catalog number: 431-109327-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg- Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C126H215N45O34S; MW 2936.46

373 €
423 $
289 £

Catalog number: 431-64122-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg- Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C126H215N45O34S; MW 2936.46

576 €
654 $
447 £

Catalog number: 431-64122-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg- Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MF C126H215N45O34S; MW 2936.46

307 €
348 $
238 £

Catalog number: 431-64122-1
Product Quantity: 500
Category:
Supplier:
Orexin B, Rat, Mouse [H-Arg-Pro-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Asn-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH2; MW: 2936.46]

318 €
361 $
247 £

Catalog number: SP-55234-5
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C162H268N50O54; MW 3780.24

695 €
789 $
539 £

Catalog number: 431-98433-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C162H268N50O54; MW 3780.24

339 €
384 $
263 £

Catalog number: 431-98433-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C162H268N50O54; MW 3780.24

986 €
1119 $
765 £

Catalog number: 431-98433-3
Product Quantity: 10 mg
Category:
Supplier:
Atrial Natriuretic Peptide (1_28), rat (AA Ser_Leu_Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_ Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg _Tyr

430 €
488 $
333 £

Catalog number: SP-55278-05
Product Quantity: 0.5 mg
Category:
Supplier: Alpha Dia
Lytic Peptide, Shiva_1 Formula C155H269N53O39S Sequence Met_Pro_Arg_Leu_Phe_Arg_Arg_Ile_Asp_Arg_Val_Gly_Lys_Gln_Gly_Ile_Leu_Arg_Ala_Gly_Pro_Ala_Ile_Ala_Leu_Val_Gly_Asp_Ala_Arg_Ala_Val_Gly

289 €
329 $
224 £

Catalog number: 88327
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-Lys(Biotin); MF C130H220N44O40; MW 3039.5

339 €
384 $
263 £

Catalog number: 431-110217-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Biotin-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MF C140H234N46O42S; MW 5465.80

613 €
695 $
475 £

Catalog number: 431-110157-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Biotin-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MF C140H234N46O42S; MW 5465.80

323 €
366 $
250 £

Catalog number: 431-110157-1
Product Quantity: 1mg
Category:
Supplier:
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-Lys(Biotin); MF C130H220N44O40; MW 3039.5

727 €
825 $
564 £

Catalog number: 431-110217-2
Product Quantity: 5 mg
Category:
Supplier:
Secretin, human Formula C130H220N44O40 Sequence His_Ser_Asp_Gly_Thr_Phe_Thr_Ser_Glu_Leu_Ser_Arg_Leu_Arg_Glu_Gly_Ala_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Gly_Leu_Val_NH2

216 €
245 $
167 £

Catalog number: 52309
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-Lys(Biotin); MF C130H220N44O40; MW 3039.5

1018 €
1156 $
790 £

Catalog number: 431-110217-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Biotin-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MF C140H234N46O42S; MW 5465.80

921 €
1045 $
714 £

Catalog number: 431-110157-3
Product Quantity: 10 mg
Category:
Supplier:
Apelin-36, human (AA: Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe) (MW: 4195.92)

390 €
443 $
302 £

Catalog number: SP-71114-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Intermedin_53 (human) Formula C247H397N83O73S3 Sequence His_Ser_Gly_Pro_Arg_Arg_Thr_Gln_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Met_Gly_Pr

414 €
469 $
321 £

Catalog number: 89208
Product Quantity: 1mg
Category:
Supplier: GLSChina
HIV_1 env Protein gp41 (1_23) amide (isolates BRU_JRCSF) Formula C95H155N27O26S Sequence Ala_Val_Gly_Ile_Gly_Ala_Leu_Phe_Leu_Gly_Phe_Leu_Gly_Ala_Ala_Gly_Ser_Thr_Met_Gly_Ala_Arg_Ser_NH2

199 €
225 $
154 £

Catalog number: 58843
Product Quantity: 1mg
Category:
Supplier: GLSChina
HIV-1 env Protein gp41 (1-23) amide (isolates BRU JRCSF) (AA: Ala-Val-Gly-Ile-Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Arg-Ser--NH2) (MW: 2123.52)

223 €
253 $
173 £

Catalog number: SP-58843-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg; MF C142H239N47O46; MW 3340.78

355 €
403 $
275 £

Catalog number: 431-97126-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg; MF C142H239N47O46; MW 3340.78

775 €
880 $
601 £

Catalog number: 431-97126-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg; MF C142H239N47O46; MW 3340.78

1116 €
1266 $
865 £

Catalog number: 431-97126-3
Product Quantity: 10 mg
Category:
Supplier:
Proinsulin C - Peptide (31 - 63), porcine (AA: Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg) (MW: 3340.78)

472 €
536 $
366 £

Catalog number: SP-88238-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MF C130H220N44O40; MW 3039.47

594 €
675 $
461 £

Catalog number: 431-61197-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MF C130H220N44O40; MW 3039.47

307 €
348 $
238 £

Catalog number: 431-61197-1
Product Quantity: 1mg
Category:
Supplier:
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MF C130H220N44O40; MW 3039.47

857 €
972 $
664 £

Catalog number: 431-61197-3
Product Quantity: 10 mg
Category:
Supplier:
MF C146H260N52O32 ; MW 3255.97 ; RGLRRLGRKIAHGVKKYGPTVLRIIRIAG, Arg-Gly-Leu-Arg-Arg-Leu-Gly-Arg-Lys-Ile-Ala-His-Gly-Val-Lys-Lys-Tyr-Gly-Pro-Thr-Val-Leu-Arg-Ile-Ile-Arg-Ile-Ala-Gly

355 €
403 $
275 £

Catalog number: RB-PP-1451
Product Quantity: 1 mg
Category:
Supplier:
Tyr_Proinsulin C_Peptide (55_89) (human) Formula C162H268N50O54 Sequence Tyr_Arg_Arg_Glu_Ala_Glu_Asp_Leu_Gln_Val_Gly_Gln_Val_Glu_Leu_Gly_Gly_Gly_Pro_Gly_Ala_Gly_Ser_Leu_Gln_Pro_Leu_Ala_Leu_Glu_Gly_S

253 €
287 $
196 £

Catalog number: 89545
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys7-Cys23 ); MF C112H175N39O35S3; MW 2724.06

373 €
423 $
289 £

Catalog number: 431-109413-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys7-Cys23 ); MF C112H175N39O35S3; MW 2724.06

307 €
348 $
238 £

Catalog number: 431-109413-1
Product Quantity: 500
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge Cys7-Cys23 ); MF C112H175N39O35S3; MW 2724.06

594 €
675 $
461 £

Catalog number: 431-109413-3
Product Quantity: 2.5 mg
Category:
Supplier:
Proinsulin C _ peptide (55 _89), human Formula C153H259N49O52 Sequence Arg_Arg_Glu_Ala_Glu_Asp_Leu_Gln_Val_Gly_Gln_Val_Glu_Leu_Gly_Gly_Gly_Pro_Gly_Ala_Gly_Ser_Leu_Gln_Pro_Leu_Ala_Leu_Glu_Gly_Ser_Leu

300 €
341 $
233 £

Catalog number: 88239
Product Quantity: 1mg
Category:
Supplier: GLSChina
Atrial Natriuretic Factor (4-28) (human) (AA: Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys7-Cys23 )) (MW: 2724.06)

390 €
443 $
302 £

Catalog number: SP-100525-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Atrial Natriuretic Factor (4_28) (human) Formula C112H175N39O35S3 Sequence Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Met_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr(Disulfide bridge Cys7_C

215 €
244 $
166 £

Catalog number: 100525
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C153H259N49O52; MW 3617.07

1148 €
1303 $
890 £

Catalog number: 431-97127-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C153H259N49O52; MW 3617.07

373 €
423 $
289 £

Catalog number: 431-97127-1
Product Quantity: 1mg
Category:
Supplier:
Proinsulin C - peptide (55 - 89), human (AA: Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg) (MW: 3617.07)

390 €
443 $
302 £

Catalog number: SP-88239-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg; MF C153H259N49O52; MW 3617.07

857 €
972 $
664 £

Catalog number: 431-97127-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

679 €
771 $
527 £

Catalog number: 431-109411-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

440 €
500 $
341 £

Catalog number: 431-109411-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

339 €
384 $
263 £

Catalog number: 431-109411-1
Product Quantity: 500
Category:
Supplier:
Neuron Specific Peptide Formula C161H262N52O51S4 Sequence Asp_Val_Ser_Asp_Gly_Ser_Ala_Glu_Arg_Arg_Pro_Tyr_Thr_Arg_Met_Gly_Ser_Gly_Gly_Leu_Lys_Leu_His_Cys_Val_His_Pro_Ala_Asn_Cys_Pro_Gly_Gly_Leu_Met_

311 €
353 $
241 £

Catalog number: 89052
Product Quantity: 1mg
Category:
Supplier: GLSChina
Neuropeptide EI_Gly_Arg_Arg_MCH (human, mouse, rat) Formula C182H282N54O52S4 Sequence Glu_Ile_Gly_Asp_Glu_Glu_Asn_Ser_Ala_Lys_Phe_Pro_Ile_Gly_Arg_Arg_Asp_Phe_Asp_Met_Leu_Arg_Cys_Met_Leu_Gly_Arg_Val_

344 €
391 $
267 £

Catalog number: 89914
Product Quantity: 1mg
Category:
Supplier: GLSChina
[CysCys21] Atrial Natriuretic Factor (3-28), Rat [Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge:Cys7-Cys23 ); MW: 2862.20]

390 €
443 $
302 £

Catalog number: SP-101754-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Proinsulin C _ Peptide (31 _63), porcine Formula C142H239N47O46 Sequence Arg_Arg_Glu_Ala_Glu_Asn_Pro_Gln_Ala_Gly_Ala_Val_Glu_Leu_Gly_Gly_Gly_Leu_Gly_Gly_Leu_Gln_Ala_Leu_Ala_Leu_Glu_Gly_Pro_Pro_Gln_L

289 €
329 $
224 £

Catalog number: 88238
Product Quantity: 1mg
Category:
Supplier: GLSChina
[CysCys21] Atrial Natriuretic Factor (3_28), Rat Formula C119H189N43O36S2 Sequence Arg_Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr (Disulfide

180 €
205 $
140 £

Catalog number: 101754
Product Quantity: 1mg
Category:
Supplier: GLSChina
Secretin, Human [H-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2; MW: 339.47]

318 €
361 $
247 £

Catalog number: SP-52309-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Lytic Peptide, Shiva – 1 (AA: Met-Pro-Arg-Leu-Phe-Arg-Arg-Ile-Asp-Arg-Val-Gly-Lys-Gln-Gly-Ile-Leu-Arg-Ala-Gly-Pro-Ala-Ile-Ala-Leu-Val-Gly-Asp-Ala-Arg-Ala-Val-Gly) (MW: 3531.27)

472 €
536 $
366 £

Catalog number: SP-88327-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Met-Pro-Arg-Leu-Phe-Arg-Arg-Ile-Asp-Arg-Val-Gly-Lys-Gln-Gly-Ile-Leu-Arg-Ala-Gly-Pro-Ala-Ile-Ala-Leu-Val-Gly-Asp-Ala-Arg-Ala-Val-Gly; MF C155H269N53O39S; MW 3531.27

355 €
403 $
275 £

Catalog number: 431-97215-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Met-Pro-Arg-Leu-Phe-Arg-Arg-Ile-Asp-Arg-Val-Gly-Lys-Gln-Gly-Ile-Leu-Arg-Ala-Gly-Pro-Ala-Ile-Ala-Leu-Val-Gly-Asp-Ala-Arg-Ala-Val-Gly; MF C155H269N53O39S; MW 3531.27

1116 €
1266 $
865 £

Catalog number: 431-97215-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Met-Pro-Arg-Leu-Phe-Arg-Arg-Ile-Asp-Arg-Val-Gly-Lys-Gln-Gly-Ile-Leu-Arg-Ala-Gly-Pro-Ala-Ile-Ala-Leu-Val-Gly-Asp-Ala-Arg-Ala-Val-Gly; MF C155H269N53O39S; MW 3531.27

775 €
880 $
601 £

Catalog number: 431-97215-2
Product Quantity: 5 mg
Category:
Supplier:
Biotin_Secretin, human Formula C140H234N46O42S Sequence Biotin_His_Ser_Asp_Gly_Thr_Phe_Thr_Ser_Glu_Leu_Ser_Arg_Leu_Arg_Glu_Gly_Ala_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Gly_Leu_Val_NH2

225 €
256 $
175 £

Catalog number: 101269
Product Quantity: 1mg
Category:
Supplier: GLSChina
Tyr-Proinsulin C-Peptide (55-89) (human) (AA: Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-Gln-Lys-Arg) (MW: 3780

390 €
443 $
302 £

Catalog number: SP-89545-1
Product Quantity: 1 mg
Category:
Supplier: ADI
MF C142H239N47O46 ; MW 3340.72; RREAENPQAGAVELGGGLGGLQALALEGPPQKR, Arg-Arg-Glu-Ala-Glu-Asn-Pro-Gln-Ala-Gly-Ala-Val-Glu-Leu-Gly-Gly-Gly-Leu-Gly-Gly-Leu-Gln-Ala-Leu-Ala-Leu-Glu-Gly-Pro-Pro-Gln-Lys-Arg

509 €
578 $
395 £

Catalog number: RB-PP-1297
Product Quantity: 1 mg
Category:
Supplier:
Sequence Ala-Val-Gly-Ile-Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Arg-Ser--NH2; MF C95H155N27O26S; MW 2123.52

509 €
578 $
395 £

Catalog number: 431-67731-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ala-Val-Gly-Ile-Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Arg-Ser--NH2; MF C95H155N27O26S; MW 2123.52

307 €
348 $
238 £

Catalog number: 431-67731-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ala-Val-Gly-Ile-Gly-Ala-Leu-Phe-Leu-Gly-Phe-Leu-Gly-Ala-Ala-Gly-Ser-Thr-Met-Gly-Ala-Arg-Ser--NH2; MF C95H155N27O26S; MW 2123.52

727 €
825 $
564 £

Catalog number: 431-67731-3
Product Quantity: 10 mg
Category:
Supplier:
BAM 3200 Peptide E Formula C147H207N41O34S2 Sequence Tyr_Gly_Gly_Phe_Met_Arg_Arg_Val_Gly_Arg_Pro_Glu_Trp_Trp_Met_Asp_Tyr_Gln_Lys_Arg_Tyr_Gly_Gly_Phe_Leu

203 €
230 $
157 £

Catalog number: 88226
Product Quantity: 1mg
Category:
Supplier: GLSChina
CAP _ 18, rabbit Formula C202H356N64O47 Sequence Gly_Leu_Arg_Lys_Arg_Leu_Arg_Lys_Phe_Arg_Asn_Lys_Ile_Lys_Glu_Lys_Leu_Lys_Lys_Ile_Gly_Gln_Lys_Ile_Gln_Gly_Leu_Leu_Pro_Lys_Leu_Ala_Pro_Arg_Thr_Asp_Tyr

315 €
358 $
244 £

Catalog number: 88322
Product Quantity: 1mg
Category:
Supplier: GLSChina
[Tyr0]-BNP-32 (human) [Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His (Disulfide bridge: Cys11-Cys27); MW 3627.28]

390 €
443 $
302 £

Catalog number: SP-89384-1
Product Quantity: 1 mg
Category:
Supplier: ADI
[Tyr0]_BNP_32 (human) Formula C152H253N51O44S4 Sequence Tyr_Ser_Pro_Lys_Met_Val_Gln_Gly_Ser_Gly_Cys_Phe_Gly_Arg_Lys_Met_Asp_Arg_Ile_Ser_Ser_Ser_Ser_Gly_Leu_Gly_Cys_Lys_Val_Leu_Arg_Arg_His (Disulfide

219 €
248 $
170 £

Catalog number: 89384
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg- Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys- Val-Leu-Arg-Arg-His(Disulfide bridge Cys10-Cys26); MF C143H244N50O42S4; MW 346

440 €
500 $
341 £

Catalog number: 431-65474-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg- Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys- Val-Leu-Arg-Arg-His(Disulfide bridge Cys10-Cys26); MF C143H244N50O42S4; MW 346

323 €
366 $
250 £

Catalog number: 431-65474-1
Product Quantity: 500
Category:
Supplier:
Sequence Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His(Disulfide bridge Cys11-Cys27); MF C152H253N51O44S4; MW

323 €
366 $
250 £

Catalog number: 431-98272-1
Product Quantity: 1mg
Category:
Supplier:
BNP_32, human Formula C143H244N50O42S4 Sequence Ser_Pro_Lys_Met_Val_Gln_Gly_Ser_Gly_Cys_Phe_Gly_Arg_Lys_Met_Asp_Arg_Ile_Ser_Ser_Ser_Ser_Gly_Leu_Gly_Cys_Lys_Val_Leu_Arg_Arg_His(Disulfide bridge Cys10

240 €
273 $
186 £

Catalog number: 56586
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg- Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys- Val-Leu-Arg-Arg-His(Disulfide bridge Cys10-Cys26); MF C143H244N50O42S4; MW 346

662 €
751 $
513 £

Catalog number: 431-65474-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His(Disulfide bridge Cys11-Cys27); MF C152H253N51O44S4; MW

594 €
675 $
461 £

Catalog number: 431-98272-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His(Disulfide bridge Cys11-Cys27); MF C152H253N51O44S4; MW

857 €
972 $
664 £

Catalog number: 431-98272-3
Product Quantity: 10 mg
Category:
Supplier:
C-TypeNatriureticPept(1-53) human (AA:Asp-Leu-Arg-Val-Asp-Thr-Lys-Ser-Arg-Ala-Ala-Trp-Ala-Arg-Leu-Leu-Gln-Glu-His-Pro-Asn-Ala-Arg-Lys-Tyr-Lys-Gly-Ala-Asn-Lys-Lys-Gly-Leu-Ser-Lys-Gly-Cys-Phe-Gly-Leu-Ly

724 €
822 $
561 £

Catalog number: SP-89549-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Atrial Natriuretic Peptide (126_150) (rat) Formula C113H177N39O35S2 Sequence Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr (Disulfide bridge Cy

240 €
273 $
186 £

Catalog number: 55277
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Atrial Natriuretic Peptide (126-150) (rat) (AA: Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr (Disulfide bridge: Cys4-Cys20)) (MW: 2706.04)

390 €
443 $
302 £

Catalog number: SP-55277-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
26Rfa, Hypothalamic Peptide, human Formula C127H195N37O37 Sequence Thr_Ser_Gly_Pro_Leu_Gly_Asn_Leu_Ala_Glu_Glu_Leu_Asn_Gly_Tyr_Ser_Arg_Lys_Lys_Gly_Gly_Phe_Ser_Phe_Arg_Phe_NH2

212 €
241 $
165 £

Catalog number: 67811
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu-Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu; MF C147H207N41O34S2; MW 3156.67

543 €
616 $
421 £

Catalog number: 431-97114-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu-Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu; MF C147H207N41O34S2; MW 3156.67

307 €
348 $
238 £

Catalog number: 431-97114-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu-Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu; MF C147H207N41O34S2; MW 3156.67

775 €
880 $
601 £

Catalog number: 431-97114-3
Product Quantity: 10 mg
Category:
Supplier:
BAM 3200 Peptide E (AA: Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu-Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu) (MW: 3156.67)

306 €
347 $
237 £

Catalog number: SP-88226-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr; MF C202H356N64O47; MW 4433.49

373 €
423 $
289 £

Catalog number: 431-97210-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr; MF C202H356N64O47; MW 4433.49

1277 €
1449 $
991 £

Catalog number: 431-97210-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr; MF C202H356N64O47; MW 4433.49

921 €
1045 $
714 £

Catalog number: 431-97210-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Gly-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala; MF C118H202N34O31S2; MW 2657.25

509 €
578 $
395 £

Catalog number: 431-63726-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Gly-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala; MF C118H202N34O31S2; MW 2657.25

727 €
825 $
564 £

Catalog number: 431-63726-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Gly-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala; MF C118H202N34O31S2; MW 2657.25

307 €
348 $
238 £

Catalog number: 431-63726-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys4-Cys20); MF C113H177N39O35S2; MW 2706.04

323 €
366 $
250 £

Catalog number: 431-64165-1
Product Quantity: 500
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys4-Cys20); MF C113H177N39O35S2; MW 2706.04

662 €
751 $
513 £

Catalog number: 431-64165-3
Product Quantity: 2.5 mg
Category:
Supplier:
Atrial Natriuretic Peptide (126_149) (rat) Formula C104H168N38O33S2 Sequence Arg_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg

240 €
273 $
186 £

Catalog number: 55276
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys4-Cys20); MF C113H177N39O35S2; MW 2706.04

440 €
500 $
341 £

Catalog number: 431-64165-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Leu-Ser-Trp-Asp-Leu-Pro-Glu-Pro-Arg-Ser-Arg-Ala-Gly-Lys-Ile-Arg-Val-His-Pro-Arg-Gly-Asn-Leu-Trp-Ala-Thr-Gly-His-Phe-Met-NH2; MF C157H243N51O38S; MW 3485.07

613 €
695 $
475 £

Catalog number: 431-97929-2
Product Quantity: 5 mg
Category:
Supplier:
Neuromedin (B_30) Formula C157H243N51O38S Sequence Leu_Ser_Trp_Asp_Leu_Pro_Glu_Pro_Arg_Ser_Arg_Ala_Gly_Lys_Ile_Arg_Val_His_Pro_Arg_Gly_Asn_Leu_Trp_Ala_Thr_Gly_His_Phe_Met_NH2

231 €
262 $
179 £

Catalog number: 89041
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Leu-Ser-Trp-Asp-Leu-Pro-Glu-Pro-Arg-Ser-Arg-Ala-Gly-Lys-Ile-Arg-Val-His-Pro-Arg-Gly-Asn-Leu-Trp-Ala-Thr-Gly-His-Phe-Met-NH2; MF C157H243N51O38S; MW 3485.07

921 €
1045 $
714 £

Catalog number: 431-97929-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Leu-Ser-Trp-Asp-Leu-Pro-Glu-Pro-Arg-Ser-Arg-Ala-Gly-Lys-Ile-Arg-Val-His-Pro-Arg-Gly-Asn-Leu-Trp-Ala-Thr-Gly-His-Phe-Met-NH2; MF C157H243N51O38S; MW 3485.07

323 €
366 $
250 £

Catalog number: 431-97929-1
Product Quantity: 1mg
Category:
Supplier:
Biotin-Secretin, human (AA: Biotin-His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2) (MW: 5465.80)

306 €
347 $
237 £

Catalog number: SP-101269-1
Product Quantity: 1 mg
Category:
Supplier: ADI
C_TypeNatriureticPept(1_53)hum(AA Asp_Leu_Arg_Val_Asp_Thr_Lys_Ser_Arg_Ala_Ala_Trp_Ala_Arg_Leu_Leu_Gln_Glu_His_Pro_Asn_Ala_Arg_Lys_Tyr_Lys_Gly_Ala_Asn_Lys_Lys_Gly_Leu_Ser_Lys_Gly_Cys_Phe_Gly_Leu_Lys_Le

802 €
910 $
622 £

Catalog number: SP-89549-05
Product Quantity: 0.5 mg
Category:
Supplier: Alpha Dia
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys4-Cys20); MF C104H168N38O33S2; MW 2542.86

440 €
500 $
341 £

Catalog number: 431-64164-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys4-Cys20); MF C104H168N38O33S2; MW 2542.86

662 €
751 $
513 £

Catalog number: 431-64164-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys4-Cys20); MF C104H168N38O33S2; MW 2542.86

323 €
366 $
250 £

Catalog number: 431-64164-1
Product Quantity: 500
Category:
Supplier:
Galanin (1_13)_Neuropeptide Y (25_36), amide (M32) Formula C136H209N41O34 Sequence Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_Arg_His_Tyr_Ile_Asn_Leu_Ile_Thr_Arg_Gln_Arg_Tyr_NH2

207 €
235 $
161 £

Catalog number: 101036
Product Quantity: 1mg
Category:
Supplier: GLSChina
MF C147H207N41O34S2 ; MW 3156.62 ; YGGFMRRVGRPEWWMDYQKRYGGFL, Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu-Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu

339 €
384 $
263 £

Catalog number: RB-PP-0293
Product Quantity: 1 mg
Category:
Supplier:
á_Conotoxin GS Formula C139H232N52O47S7 Sequence Ala_Cys_Ser_Gly_Arg_Gly_Ser_Arg_Cys_Hyp_Hyp_Gln_Cys_Cys_Met_Gly_Leu_Arg_Cys_Gly_Arg_Gly_Asn_Pro_Gln_Lys_Cys_Ile_Gly_Ala_His_Gla_Asp_Val

184 €
208 $
142 £

Catalog number: 103042
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val; MF C139H232N52O47S7; MW 3624.11

475 €
539 $
368 £

Catalog number: 431-111930-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val; MF C139H232N52O47S7; MW 3624.11

274 €
312 $
213 £

Catalog number: 431-111930-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val; MF C139H232N52O47S7; MW 3624.11

679 €
771 $
527 £

Catalog number: 431-111930-3
Product Quantity: 10 mg
Category:
Supplier:
Biotin_Intermedin (human) Formula C229H353N71O68S4 Sequence Biotin_Thr_Gln_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Met_Gly_Pro_Ala_Gly_Arg

257 €
292 $
200 £

Catalog number: 89205
Product Quantity: 1mg
Category:
Supplier: GLSChina
26Rfa, Hypothalamic Peptide, rat Formula C126H195N37O37 Sequence Ala_Ser_Gly_Pro_Leu_Gly_Thr_Leu_Ala_Glu_Glu_Leu_Ser_Ser_Tyr_Ser_Arg_Arg_Lys_Gly_Gly_Phe_Ser_Phe_Arg_Phe_NH2

212 €
241 $
165 £

Catalog number: 88344
Product Quantity: 1mg
Category:
Supplier: GLSChina
CAP - 18, rabbit (AA: Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-Pro-Arg-Thr-Asp-Tyr) (MW: 4433.49)

472 €
536 $
366 £

Catalog number: SP-88322-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Gly-Asp-Gly-Arg-Leu-Tyr-Ala-Phe-Gly-Leu-NH2; MF C49H74N14O13; MW 1067.2

407 €
462 $
316 £

Catalog number: 431-109388-2
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Asp-Gly-Arg-Leu-Tyr-Ala-Phe-Gly-Leu-NH2; MF C49H74N14O13; MW 1067.2

323 €
366 $
250 £

Catalog number: 431-109388-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Asp-Gly-Arg-Leu-Tyr-Ala-Phe-Gly-Leu-NH2; MF C49H74N14O13; MW 1067.2

695 €
789 $
539 £

Catalog number: 431-109388-3
Product Quantity: 25 mg
Category:
Supplier:
Allatostatin II Formula C49H74N14O13 Sequence Gly_Asp_Gly_Arg_Leu_Tyr_Ala_Phe_Gly_Leu_NH2

237 €
269 $
184 £

Catalog number: 100500
Product Quantity: 5mg
Category:
Supplier: GLSChina
26Rfa, Hypothalamic Peptide, human [Thr-Ser-Gly-Pro-Leu-Gly-Asn-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Ser-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MW: 2832.20]

306 €
347 $
237 £

Catalog number: SP-67811-1
Product Quantity: 1 mg
Category:
Supplier: ADI
26Rfa, Hypothalamic Peptide, frog Formula C127H197N37O36 Sequence Val_Gly_Thr_Ala_Leu_Gly_Ser_Leu_Ala_Glu_Glu_Leu_Asn_Gly_Tyr_Asn_Arg_Lys_Lys_Gly_Gly_Phe_Ser_Phe_Arg_Phe_NH2

212 €
241 $
165 £

Catalog number: 88343
Product Quantity: 1mg
Category:
Supplier: GLSChina
Alytesin [pGlu-Gly-Arg-Leu-Gly-Thr-Gln-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MW: 1535.8]

190 €
216 $
147 £

Catalog number: SP-55151-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Allatostatin II (AA: Gly-Asp-Gly-Arg-Leu-Tyr-Ala-Phe-Gly-Leu-NH2) (MW: 1067.2)

390 €
443 $
302 £

Catalog number: SP-100500-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Galanin (1-13)-Neuropeptide Y (25-36), amide (M32) (AA: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2) (MW: 2962.4)

306 €
347 $
237 £

Catalog number: SP-101036-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Dynorphin A (1_12), porcine Formula C69H114N22O14 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro_Lys_Leu

252 €
286 $
195 £

Catalog number: 88370
Product Quantity: 5mg
Category:
Supplier: GLSChina
Secretin_Lys(Biotin), human Formula C130H220N44O40 Sequence His_Ser_Asp_Gly_Thr_Phe_Thr_Ser_Glu_Leu_Ser_Arg_Leu_Arg_Glu_Gly_Ala_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Gly_Leu_Val_Lys(Biotin)

262 €
297 $
203 £

Catalog number: 101329
Product Quantity: 1mg
Category:
Supplier: GLSChina
Intermedin (human) Formula C219H351N69O66S3 Sequence Thr_Gln_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Met_Gly_Pro_Ala_Gly_Arg_Gln_Asp_Ser_A

378 €
429 $
293 £

Catalog number: 54832
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu; MF C69H114N22O14; MW 1475.82

339 €
384 $
263 £

Catalog number: 431-97258-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu; MF C69H114N22O14; MW 1475.82

727 €
825 $
564 £

Catalog number: 431-97258-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu; MF C69H114N22O14; MW 1475.82

440 €
500 $
341 £

Catalog number: 431-97258-2
Product Quantity: 10 mg
Category:
Supplier:
Dynorphin A (2_12), porcine Formula C60H105N21O12 Sequence Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro_Lys_Leu

237 €
269 $
184 £

Catalog number: 88375
Product Quantity: 5mg
Category:
Supplier: GLSChina
BNP (1-32), Human [H-Ser-Pro-Lys-Met-Val-Gln-Gly-Ser-Gly-Cys-Phe-Gly-Arg-Lys-Met-Asp-Arg-Ile-Ser-Ser-Ser-Ser-Gly-Leu-Gly-Cys-Lys-Val-Leu-Arg-Arg-His-OH(Cys10-Cys26); MW: 3464.1]

390 €
443 $
302 £

Catalog number: SP-56586-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
AGRP (25_51) Formula C130H221N37O35S1 Sequence Leu_Ala_Pro_Met_Glu_Gly_Ile_Arg_Arg_Pro_Asp_Gln_Ala_Leu_Leu_Pro_Glu_Leu_Pro_Gly_Leu_Gly_Leu_Arg_Ala_Pro_Leu

212 €
241 $
165 £

Catalog number: 100829
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu; MF C130H221N37O35S; MW 2894.5

576 €
654 $
447 £

Catalog number: 431-109717-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu; MF C130H221N37O35S; MW 2894.5

857 €
972 $
664 £

Catalog number: 431-109717-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu; MF C130H221N37O35S; MW 2894.5

307 €
348 $
238 £

Catalog number: 431-109717-1
Product Quantity: 1mg
Category:
Supplier:
MF C162H268N50O54 ; MW 3780.18 ; YRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR, Tyr-Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-

407 €
462 $
316 £

Catalog number: RB-PP-1561
Product Quantity: 1 mg
Category:
Supplier:
α-Conotoxin GS (AA: Ala-Cys-Ser-Gly-Arg-Gly-Ser-Arg-Cys-Hyp-Hyp-Gln-Cys-Cys-Met-Gly-Leu-Arg-Cys-Gly-Arg-Gly-Asn-Pro-Gln-Lys-Cys-Ile-Gly-Ala-His-Gla-Asp-Val) (MW: 3624.11)

223 €
253 $
173 £

Catalog number: SP-103042-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Thr-Ser-Gly-Pro-Leu-Gly-Asn-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Ser-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MF C127H195N37O37; MW 2832.20

576 €
654 $
447 £

Catalog number: 431-76699-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Thr-Ser-Gly-Pro-Leu-Gly-Asn-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Ser-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MF C127H195N37O37; MW 2832.20

307 €
348 $
238 £

Catalog number: 431-76699-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Thr-Ser-Gly-Pro-Leu-Gly-Asn-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Ser-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MF C127H195N37O37; MW 2832.20

857 €
972 $
664 £

Catalog number: 431-76699-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Pyr-Gly-Arg-Leu-Gly-Thr-Gln-Trp-Ala-Val-Gly-His-Leu-Met- NH2; MF C68H106N22O17S; MW 1535.8

509 €
578 $
395 £

Catalog number: 431-64039-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Pyr-Gly-Arg-Leu-Gly-Thr-Gln-Trp-Ala-Val-Gly-His-Leu-Met- NH2; MF C68H106N22O17S; MW 1535.8

339 €
384 $
263 £

Catalog number: 431-64039-2
Product Quantity: 10 mg
Category:
Supplier:
Sequence Pyr-Gly-Arg-Leu-Gly-Thr-Gln-Trp-Ala-Val-Gly-His-Leu-Met- NH2; MF C68H106N22O17S; MW 1535.8

274 €
312 $
213 £

Catalog number: 431-64039-1
Product Quantity: 5 mg
Category:
Supplier:
Alytesin Formula C68H106N22O17S Sequence Pyr_Gly_Arg_Leu_Gly_Thr_Gln_Trp_Ala_Val_Gly_His_Leu_Met_NH2

189 €
214 $
146 £

Catalog number: 55151
Product Quantity: 5mg
Category:
Supplier: GLSChina
Preprogalanin 28_67, rat Formula C198H312N62O58 Sequence Thr_Lys_Glu_Lys_Arg_Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_His_Ala_Ile_Asp_Asn_His_Arg_Ser_Phe_Ser_Asp_Lys_His_Gly_Leu_Thr_Gly_L

331 €
376 $
257 £

Catalog number: 88484
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; MF C136H209N41O34; MW 2962.4

307 €
348 $
238 £

Catalog number: 431-109924-1
Product Quantity: 1mg
Category: Peptides
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; MF C136H209N41O34; MW 2962.4

576 €
654 $
447 £

Catalog number: 431-109924-2
Product Quantity: 5 mg
Category: Peptides
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2; MF C136H209N41O34; MW 2962.4

775 €
880 $
601 £

Catalog number: 431-109924-3
Product Quantity: 10 mg
Category: Peptides
Supplier:
MF C69H114N22O14 ; MW 1475.79 ; YGGFLRRIRPKL , Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu

323 €
366 $
250 £

Catalog number: RB-PP-0581
Product Quantity: 1 mg
Category:
Supplier:
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu; MF C60H105N21O12; MW 1312.64

407 €
462 $
316 £

Catalog number: 431-97263-2
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu; MF C60H105N21O12; MW 1312.64

695 €
789 $
539 £

Catalog number: 431-97263-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu; MF C60H105N21O12; MW 1312.64

323 €
366 $
250 £

Catalog number: 431-97263-1
Product Quantity: 5 mg
Category:
Supplier:
Dynorphin A (1-12), porcine (AA: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu) (MW: 1475.82)

390 €
443 $
302 £

Catalog number: SP-88370-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Atrial Natriuretic Factor (1_29) (chicken) Formula C124H211N47O40S5 Sequence Met_Met_Arg_Asp_Ser_Gly_Cys_Phe_Gly_Arg_Arg_Ile_Asp_Arg_Ile_Gly_Ser_Leu_Ser_Gly_Met_Gly_Cys_Asn_Gly_Ser_Arg_Lys_Asn(Disul

247 €
280 $
191 £

Catalog number: 100522
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Atrial Natriuretic Factor (1-29) (chicken) (AA: Met-Met-Arg-Asp-Ser-Gly-Cys-Phe-Gly-Arg-Arg-Ile-Asp-Arg-Ile-Gly-Ser-Leu-Ser-Gly-Met-Gly-Cys-Asn-Gly-Ser-Arg-Lys-Asn (Disulfide bridge Cys7-Cys23 )) (MW

390 €
443 $
302 £

Catalog number: SP-100522-05
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Boc_Leu_Gly_Arg_MCA

274 €
312 $
213 £

Catalog number: 3102-v
Product Quantity: 5mg
Category:
Supplier: Sceti K.K.
Glycoprotein IIb Fragment (300_312) Formula C57H94N18O18 Sequence Gly_Asp_Gly_Arg_His_Asp_Leu_Leu_Val_Gly_Ala_Pro_Leu

266 €
302 $
206 £

Catalog number: 89078
Product Quantity: 5mg
Category:
Supplier: GLSChina
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

662 €
751 $
513 £

Catalog number: 431-110642-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

274 €
312 $
213 £

Catalog number: 431-110642-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

440 €
500 $
341 £

Catalog number: 431-110642-2
Product Quantity: 5 mg
Category:
Supplier:
26Rfa, Hypothalamic Peptide, rat [Ala-Ser-Gly-Pro-Leu-Gly-Thr-Leu-Ala-Glu-Glu-Leu-Ser-Ser-Tyr-Ser-Arg-Arg-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MW: 2820.18]

306 €
347 $
237 £

Catalog number: SP-88344-1
Product Quantity: 1 mg
Category:
Supplier: ADI
26Rfa, Hypothalamic Peptide, frog [Val-Gly-Thr-Ala-Leu-Gly-Ser-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Asn-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MW: 2818.21]

306 €
347 $
237 £

Catalog number: SP-88343-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Glycoprotein IIb Fragment (300-312) (AA: Gly-Asp-Gly-Arg-His-Asp-Leu-Leu-Val-Gly-Ala-Pro-Leu) (MW: 1319.49)

390 €
443 $
302 £

Catalog number: SP-89078-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence Biotin-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser; MF C149H224N44O45S; MW 3383.78

339 €
384 $
263 £

Catalog number: 431-96350-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Biotin-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser; MF C149H224N44O45S; MW 3383.78

970 €
1101 $
752 £

Catalog number: 431-96350-3
Product Quantity: 10 mg
Category:
Supplier:
Galanin, human Formula C139H210N42O43 Sequence Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_His_Ala_Val_Gly_Asn_His_Arg_Ser_Phe_Ser_Asp_Lys_Asn_Gly_Leu_Thr_Ser

225 €
256 $
175 £

Catalog number: 52250
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Biotin-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser; MF C149H224N44O45S; MW 3383.78

679 €
771 $
527 £

Catalog number: 431-96350-2
Product Quantity: 5 mg
Category:
Supplier:
Dynorphin A (2-12), porcine (AA: Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu) (MW: 1312.64)

390 €
443 $
302 £

Catalog number: SP-88375-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence Ser-Ser-Cys-Tyr-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

576 €
654 $
447 £

Catalog number: 431-109997-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Ser-Ser-Cys-Tyr-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

775 €
880 $
601 £

Catalog number: 431-109997-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Ser-Ser-Cys-Tyr-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

307 €
348 $
238 £

Catalog number: 431-109997-1
Product Quantity: 1mg
Category:
Supplier:
MF C153H259N49O52 ; MW 3617.01 ; RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR, Arg-Arg-Glu-Ala-Glu-Asp-Leu-Gln-Val-Gly-Gln-Val-Glu-Leu-Gly-Gly-Gly-Pro-Gly-Ala-Gly-Ser-Leu-Gln-Pro-Leu-Ala-Leu-Glu-Gly-Ser-Leu-G

509 €
578 $
395 £

Catalog number: RB-PP-1299
Product Quantity: 1 mg
Category:
Supplier:
Orexin A, Bovine, Human, mouse, Rat [pGlu-Pro-Leu-Pro-Asp-Cys-Cys-Arg-Gln-Lys-Thr-Cys-Ser-Cys-Arg-Leu-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu-NH2 (Cys6-Cys12, Cys7-Cys14);

1119 €
1270 $
868 £

Catalog number: SP-54421-5
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Pyr-Pro-Leu-Pro-Asp-Cys-Cys-Arg-Gln-Lys-Thr-Cys-Ser-Cys-Arg-Leu-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu-NH2(Disulfide bridge Cys6-Cys12, Cys7-Cys14); MF C152H24

2060 €
2338 $
1598 £

Catalog number: 431-63309-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Pyr-Pro-Leu-Pro-Asp-Cys-Cys-Arg-Gln-Lys-Thr-Cys-Ser-Cys-Arg-Leu-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu-NH2(Disulfide bridge Cys6-Cys12, Cys7-Cys14); MF C152H24

576 €
654 $
447 £

Catalog number: 431-63309-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Pyr-Pro-Leu-Pro-Asp-Cys-Cys-Arg-Gln-Lys-Thr-Cys-Ser-Cys-Arg-Leu-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu-NH2(Disulfide bridge Cys6-Cys12, Cys7-Cys14); MF C152H24

1245 €
1413 $
966 £

Catalog number: 431-63309-2
Product Quantity: 5 mg
Category:
Supplier:
[Tyr0]_Atriopeptin II (rat) Formula C107H165N35O34S2 Sequence Tyr_Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg (Disulfide bridge Cys4_Cys20 )

203 €
230 $
157 £

Catalog number: 100529
Product Quantity: 1mg
Category:
Supplier: GLSChina
Atriopeptin III (rat) Formula C107H165N35O34S2 Sequence Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg_Tyr(Disulfide bridge Cys3_Cys19)

240 €
273 $
186 £

Catalog number: 55275
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Atriopeptin II (rat, rabbit,mouse) Formula C98H156N34O32S2 Sequence Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg(Disulfide bridge Cys3_Cys18)

253 €
287 $
196 £

Catalog number: 55274
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser; MF C139H210N42O43; MW 3157.44

323 €
366 $
250 £

Catalog number: 431-61138-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser; MF C139H210N42O43; MW 3157.44

613 €
695 $
475 £

Catalog number: 431-61138-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser; MF C139H210N42O43; MW 3157.44

921 €
1045 $
714 £

Catalog number: 431-61138-3
Product Quantity: 10 mg
Category:
Supplier:
Auriculin A [H-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-OH (Cys7-Cys23); MW: 2542.86]

390 €
443 $
302 £

Catalog number: SP-55276-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys3-Cys19); MF C107H165N35O34S2; MW 2549.85

323 €
366 $
250 £

Catalog number: 431-64163-1
Product Quantity: 500
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys3-Cys19); MF C107H165N35O34S2; MW 2549.85

440 €
500 $
341 £

Catalog number: 431-64163-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr(Disulfide bridge Cys3-Cys19); MF C107H165N35O34S2; MW 2549.85

662 €
751 $
513 £

Catalog number: 431-64163-3
Product Quantity: 2.5 mg
Category:
Supplier:
[Tyr0]-Atriopeptin II (rat) [Tyr-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg (Disulfide bridge:Cys4-Cys20 ); MW 2549.9]

306 €
347 $
237 £

Catalog number: SP-100529-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Val-Gly-Thr-Ala-Leu-Gly-Ser-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Asn-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MF C127H197N37O36; MW 2818.21

307 €
348 $
238 £

Catalog number: 431-97231-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Val-Gly-Thr-Ala-Leu-Gly-Ser-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Asn-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MF C127H197N37O36; MW 2818.21

576 €
654 $
447 £

Catalog number: 431-97231-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Val-Gly-Thr-Ala-Leu-Gly-Ser-Leu-Ala-Glu-Glu-Leu-Asn-Gly-Tyr-Asn-Arg-Lys-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MF C127H197N37O36; MW 2818.21

857 €
972 $
664 £

Catalog number: 431-97231-3
Product Quantity: 10 mg
Category:
Supplier:
Neuron Specific Peptide(AA: Asp-Val-Ser-Asp-Gly-Ser-Ala-Glu-Arg-Arg-Pro-Tyr-Thr-Arg-Met-Gly-Ser-Gly-Gly-Leu-Lys-Leu-His-Cys-Val-His-Pro-Ala-Asn-Cys-Pro-Gly-Gly-Leu-Met-Val-Thr) (MW: 3870.44)

472 €
536 $
366 £

Catalog number: SP-89052-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Asp-Val-Ser-Asp-Gly-Ser-Ala-Glu-Arg-Arg-Pro-Tyr-Thr-Arg-Met-Gly-Ser-Gly-Gly-Leu-Lys-Leu-His-Cys-Val-His-Pro-Ala-Asn-Cys-Pro-Gly-Gly-Leu-Met-Val-Thr; MF C161H262N52O51S4; MW 3870.44

373 €
423 $
289 £

Catalog number: 431-97940-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Asp-Val-Ser-Asp-Gly-Ser-Ala-Glu-Arg-Arg-Pro-Tyr-Thr-Arg-Met-Gly-Ser-Gly-Gly-Leu-Lys-Leu-His-Cys-Val-His-Pro-Ala-Asn-Cys-Pro-Gly-Gly-Leu-Met-Val-Thr; MF C161H262N52O51S4; MW 3870.44

1277 €
1449 $
991 £

Catalog number: 431-97940-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Asp-Val-Ser-Asp-Gly-Ser-Ala-Glu-Arg-Arg-Pro-Tyr-Thr-Arg-Met-Gly-Ser-Gly-Gly-Leu-Lys-Leu-His-Cys-Val-His-Pro-Ala-Asn-Cys-Pro-Gly-Gly-Leu-Met-Val-Thr; MF C161H262N52O51S4; MW 3870.44

921 €
1045 $
714 £

Catalog number: 431-97940-2
Product Quantity: 5 mg
Category:
Supplier:
Human AGRP (25-51) (AA: Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu) (MW: 2894.5)

306 €
347 $
237 £

Catalog number: SP-100829-1
Product Quantity: 1 mg
Category:
Supplier: ADI
sHNG, [Gly14] _ HN, [Gly14] –Humanin Formula C118H202N34O31S2 Sequence Met_Ala_Pro_Arg_Gly_Phe_Ser_Cys_Leu_Leu_Leu_Leu_Thr_Gly_Glu_Ile_Asp_Leu_Pro_Val_Lys_Arg_Arg_Ala

199 €
225 $
154 £

Catalog number: 54838
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys3-Cys18); MF C98H156N34O32S2; MW 2386.67

339 €
384 $
263 £

Catalog number: 431-64162-1
Product Quantity: 500
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys3-Cys18); MF C98H156N34O32S2; MW 2386.67

475 €
539 $
368 £

Catalog number: 431-64162-2
Product Quantity: 1mg
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg(Disulfide bridge Cys3-Cys18); MF C98H156N34O32S2; MW 2386.67

695 €
789 $
539 £

Catalog number: 431-64162-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ala-Ser-Gly-Pro-Leu-Gly-Thr-Leu-Ala-Glu-Glu-Leu-Ser-Ser-Tyr-Ser-Arg-Arg-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MF C126H195N37O37; MW 2820.18

307 €
348 $
238 £

Catalog number: 431-97232-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Ala-Ser-Gly-Pro-Leu-Gly-Thr-Leu-Ala-Glu-Glu-Leu-Ser-Ser-Tyr-Ser-Arg-Arg-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MF C126H195N37O37; MW 2820.18

857 €
972 $
664 £

Catalog number: 431-97232-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Ala-Ser-Gly-Pro-Leu-Gly-Thr-Leu-Ala-Glu-Glu-Leu-Ser-Ser-Tyr-Ser-Arg-Arg-Lys-Gly-Gly-Phe-Ser-Phe-Arg-Phe-NH2; MF C126H195N37O37; MW 2820.18

576 €
654 $
447 £

Catalog number: 431-97232-2
Product Quantity: 5 mg
Category:
Supplier:
sHNG, [Gly14] - HN, [Gly14] – Humanin (AA: Met-Ala-Pro-Arg-Gly-Phe-Ser-Cys-Leu-Leu-Leu-Leu-Thr-Gly-Glu-Ile-Asp-Leu-Pro-Val-Lys-Arg-Arg-Ala) (MW: 2657.25)

306 €
347 $
237 £

Catalog number: SP-54838-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Gly-Asp-Gly-Arg-His-Asp-Leu-Leu-Val-Gly-Ala-Pro-Leu; MF C57H94N18O18; MW 1319.49

355 €
403 $
275 £

Catalog number: 431-97966-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Asp-Gly-Arg-His-Asp-Leu-Leu-Val-Gly-Ala-Pro-Leu; MF C57H94N18O18; MW 1319.49

775 €
880 $
601 £

Catalog number: 431-97966-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Gly-Asp-Gly-Arg-His-Asp-Leu-Leu-Val-Gly-Ala-Pro-Leu; MF C57H94N18O18; MW 1319.49

475 €
539 $
368 £

Catalog number: 431-97966-2
Product Quantity: 10 mg
Category:
Supplier:
Secretin-Lys(Biotin), human (AA: His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Glu-Gly-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-Lys(Biotin)) (MW: 3039.5)

390 €
443 $
302 £

Catalog number: SP-101329-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Galanin, Human [Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-OH; MW: 3157.44]

731 €
830 $
567 £

Catalog number: SP-52550-1
Product Quantity: 1 mg
Category:
Supplier: ADI
[D_Arg8] _ Dynorphin A (1 _13), porcine Formula C75H127N27O15 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Arg_D_Arg_Arg_Pro_Lys_Leu_Lys

281 €
319 $
218 £

Catalog number: 100515
Product Quantity: 5mg
Category:
Supplier: GLSChina
MF C202H356N64O47 ; MW 4433.41 ; GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY, Gly-Leu-Arg-Lys-Arg-Leu-Arg-Lys-Phe-Arg-Asn-Lys-Ile-Lys-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Gln-Gly-Leu-Leu-Pro-Lys-Leu-Ala-

543 €
616 $
421 £

Catalog number: RB-PP-0427
Product Quantity: 1 mg
Category:
Supplier:
Neuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat) (AA: Glu-Ile-Gly-Asp-Glu-Glu-Asn-Ser-Ala-Lys-Phe-Pro-Ile-Gly-Arg-Arg-Asp-Phe-Asp-Met-Leu-Arg-Cys-Met-Leu-Gly-Arg-Val-Tyr-Arg-Pro-Cys-Trp-Gln-Val (D

557 €
632 $
432 £

Catalog number: SP-89914-1
Product Quantity: 1 mg
Category:
Supplier: ADI
[Arg14,20,21, Leu16]-PACAP (1-27)-Gly-Lys-Arg, amide, human, ovine, rat [His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Arg-Gln-Leu-Ala-Val-Arg-Arg-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-NH2; MW

390 €
443 $
302 £

Catalog number: SP-101260-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-Gly-Lys-Arg-Glu-Leu-Pro; MF C198H312N62O58; MW 4489.

407 €
462 $
316 £

Catalog number: 431-97372-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-Gly-Lys-Arg-Glu-Leu-Pro; MF C198H312N62O58; MW 4489.

954 €
1083 $
740 £

Catalog number: 431-97372-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-Gly-Lys-Arg-Glu-Leu-Pro; MF C198H312N62O58; MW 4489.

1407 €
1596 $
1091 £

Catalog number: 431-97372-3
Product Quantity: 10 mg
Category:
Supplier:
M35 [H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Pro-Pro-Gly-Phe-Ser-Pro-Arg-NH2; MW2233.58]

318 €
361 $
247 £

Catalog number: SP-55214-5
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Atriopeptin I (rat) Formula C83H135N29O30S2 Sequence Ser_Ser_Cys_Phe_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser(Disulfide bridge Cys3_Cys19)

202 €
229 $
156 £

Catalog number: 55273
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser(Disulfide bridge Cys3-Cys19); MF C83H135N29O30S2; MW 2083.31

543 €
616 $
421 £

Catalog number: 431-64161-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser(Disulfide bridge Cys3-Cys19); MF C83H135N29O30S2; MW 2083.31

307 €
348 $
238 £

Catalog number: 431-64161-1
Product Quantity: 500
Category:
Supplier:
Sequence Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser(Disulfide bridge Cys3-Cys19); MF C83H135N29O30S2; MW 2083.31

355 €
403 $
275 £

Catalog number: 431-64161-2
Product Quantity: 1mg
Category:
Supplier:
MF C57H94N18O18 ; MW 1319.47 ; GDGRHDLLVGAPL , Gly-Asp-Gly-Arg-His-Asp-Leu-Leu-Val-Gly-Ala-Pro-Leu

307 €
348 $
238 £

Catalog number: RB-PP-0685
Product Quantity: 1 mg
Category:
Supplier:
Atriopeptin III [H-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-As-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr-OH (Cys7-Cys23); MW: 2549.85]

390 €
443 $
302 £

Catalog number: SP-55275-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Intermedin-53(human)(AA:His-Ser-Gly-Pro-Arg-Arg-Thr-Gln-Ala-Gln-Leu-Leu-Arg-Val-Gly-Cys-Val-Leu-Gly-Thr-Cys-Gln-Val-Gln-Asn-Leu-Ser-His-Arg-Leu-Trp-Gln-Leu-Met-Gly-Pro-Ala-Gly-Arg-Gln-Asp-Ser-Ala-Pro-

724 €
822 $
561 £

Catalog number: SP-89208-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Preprogalanin 28-67, rat (AA: Thr-Lys-Glu-Lys-Arg-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-Gly-Lys-Arg-Glu-Leu-Pro) (MW: 4489

390 €
443 $
302 £

Catalog number: SP-88484-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Biotin_Galanin, human Formula C149H224N44O45S Sequence Biotin_Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_His_Ala_Val_Gly_Asn_His_Arg_Ser_Phe_Ser_Asp_Lys_Asn_Gly_Leu_Thr_Ser

241 €
274 $
187 £

Catalog number: 87462
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-D-Arg-Arg-Pro-Lys-Leu-Lys; MF C75H127N27O15; MW 1647.01

857 €
972 $
664 £

Catalog number: 431-109403-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-D-Arg-Arg-Pro-Lys-Leu-Lys; MF C75H127N27O15; MW 1647.01

509 €
578 $
395 £

Catalog number: 431-109403-2
Product Quantity: 10 mg
Category:
Supplier:
[D-Arg8] - Dynorphin A (1 - 13), porcine [Tyr-Gly-Gly-Phe-Leu-Arg-Arg-D-Arg-Arg-Pro-Lys-Leu-Lys; MW: 1647.01]

390 €
443 $
302 £

Catalog number: SP-100515-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-D-Arg-Arg-Pro-Lys-Leu-Lys; MF C75H127N27O15; MW 1647.01

355 €
403 $
275 £

Catalog number: 431-109403-1
Product Quantity: 5 mg
Category:
Supplier:
AGRP (25_51) (AA Leu_Ala_Pro_Met_Glu_Gly_Ile_Arg_Arg_Pro_Asp_Gln_Ala_Leu_Leu_Pro_Glu_Leu_Pro_Gly_Leu_Gly_Leu_Arg_Ala_Pro_Leu) (MW 2894.5)

337 €
382 $
261 £

Catalog number: SP-100829-1
Product Quantity: 1 mg
Category:
Supplier: Alpha Dia
Intermedin (rat) Formula C226H361N75O64S2 Sequence Pro_His_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Val_Arg_Pro_Ser_Gly_Arg_Arg_Asp_Ser_Ala

378 €
429 $
293 £

Catalog number: 89206
Product Quantity: 1mg
Category:
Supplier: GLSChina
Experimental Autoimmune Encephalomyelitis Complementary Peptide (AA: Val-Phe-Ile-Leu-Gly-Pro-Leu-Arg-Leu-Leu-Gly) (MW: 1197.54)

390 €
443 $
302 £

Catalog number: SP-86569-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Atriopeptin I [H-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-OH(Cys7-Cys23); MW: 2083.31]

306 €
347 $
237 £

Catalog number: SP-55273-1
Product Quantity: 0.5 mg
Category:
Supplier: ADI
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin); MF C155H237N46O46S; MW 3511.95

373 €
423 $
289 £

Catalog number: 431-109920-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin); MF C155H237N46O46S; MW 3511.95

1148 €
1303 $
890 £

Catalog number: 431-109920-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin); MF C155H237N46O46S; MW 3511.95

857 €
972 $
664 £

Catalog number: 431-109920-2
Product Quantity: 5 mg
Category:
Supplier:
Biotin_Intermedin (rat) Formula C236H377N77O66S3 Sequence Biotin_Pro_His_Ala_Gln_Leu_Leu_Arg_Val_Gly_Cys_Val_Leu_Gly_Thr_Cys_Gln_Val_Gln_Asn_Leu_Ser_His_Arg_Leu_Trp_Gln_Leu_Val_Arg_Pro_Ser_Gly_Arg_A

257 €
292 $
200 £

Catalog number: 89207
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Val-Phe-Ile-Leu-Gly-Pro-Leu-Arg-Leu-Leu-Gly; MF C59H100N14O12; MW 1197.54

407 €
462 $
316 £

Catalog number: 431-95457-2
Product Quantity: 10 mg
Category:
Supplier:
Sequence Val-Phe-Ile-Leu-Gly-Pro-Leu-Arg-Leu-Leu-Gly; MF C59H100N14O12; MW 1197.54

323 €
366 $
250 £

Catalog number: 431-95457-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence Val-Phe-Ile-Leu-Gly-Pro-Leu-Arg-Leu-Leu-Gly; MF C59H100N14O12; MW 1197.54

695 €
789 $
539 £

Catalog number: 431-95457-3
Product Quantity: 25 mg
Category:
Supplier:
[Tyr8]-Atrial Natriuretic Peptide (5-27), rat; [Tyr8]-Atriopeptin II, rat [Ser-Ser-Cys-Tyr-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg Disulfide bridge:Cys3-Cys19 ); M

306 €
347 $
237 £

Catalog number: SP-101109-1
Product Quantity: 1 mg
Category:
Supplier: ADI
[Tyr8]_Atrial Natriuretic Peptide (5_27), rat; [Tyr8]_Atriopeptin II, rat Formula C98H156N34O33S2 Sequence Ser_Ser_Cys_Tyr_Gly_Gly_Arg_Ile_Asp_Arg_Ile_Gly_Ala_Gln_Ser_Gly_Leu_Gly_Cys_Asn_Ser_Phe_Arg

209 €
238 $
162 £

Catalog number: 101109
Product Quantity: 1mg
Category:
Supplier: GLSChina
Dynorphin A (2_17), porcine Formula C90H146N30O21 Sequence Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro_Lys_Leu_Lys_Trp_Asp_Asn_Gln

162 €
184 $
126 £

Catalog number: 88376
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-NH2; MF C90H147N31O20; MW 1983.37

594 €
675 $
461 £

Catalog number: 431-97254-3
Product Quantity: 10 mg
Category:
Supplier:
MF C99H155N31O23 ; MW 2147.49 ; YGGFLRRIRPKLKWDNQ, Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-NH2

307 €
348 $
238 £

Catalog number: RB-PP-0607
Product Quantity: 1 mg
Category:
Supplier:
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-NH2; MF C90H147N31O20; MW 1983.37

407 €
462 $
316 £

Catalog number: 431-97254-2
Product Quantity: 5 mg
Category:
Supplier:
MF C99H155N31O23 ; MW 2147.49 ; YGGFLRRIRPKLKWDNQ, bio-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln

307 €
348 $
238 £

Catalog number: RB-PP-0345
Product Quantity: 1 mg
Category:
Supplier:
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-NH2; MF C90H147N31O20; MW 1983.37

257 €
292 $
200 £

Catalog number: 431-97254-1
Product Quantity: 1mg
Category:
Supplier:
Dynorphin (2-17), amide, porcine (AA: Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-NH2) (MW: 1983.37)

223 €
253 $
173 £

Catalog number: SP-88366-1
Product Quantity: 1 mg
Category:
Supplier: ADI
MF C90H146N30O21 ; MW 1984.32 ; GGFLRRIRPKLKWDNQ, Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-NH2

307 €
348 $
238 £

Catalog number: RB-PP-0571
Product Quantity: 1 mg
Category:
Supplier:
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln; MF C90H146N30O21; MW 1984.36

257 €
292 $
200 £

Catalog number: 431-97264-1
Product Quantity: 1mg
Category:
Supplier:
Dynorphin A (1_13), amide,porcine Formula C75H127N25O14 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro_Lys_Leu_Lys_NH2

281 €
319 $
218 £

Catalog number: 88371
Product Quantity: 5mg
Category:
Supplier: GLSChina
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln; MF C90H146N30O21; MW 1984.36

373 €
423 $
289 £

Catalog number: 431-97264-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln; MF C90H146N30O21; MW 1984.36

576 €
654 $
447 £

Catalog number: 431-97264-3
Product Quantity: 10 mg
Category:
Supplier:
MF C99H155N31O23 ; MW 2147.49 ; YGGFLRRIRPKLKWDNQ, Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln

355 €
403 $
275 £

Catalog number: RB-PP-0591
Product Quantity: 1 mg
Category:
Supplier:
Experimental Autoimmune Encephalomyelitis Complementary Peptide Formula C59H100N14O12 Sequence Val_Phe_Ile_Leu_Gly_Pro_Leu_Arg_Leu_Leu_Gly

237 €
269 $
184 £

Catalog number: 86569
Product Quantity: 5mg
Category:
Supplier: GLSChina
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-NH2; MF C99H156N32O22; MW 2146.55

407 €
462 $
316 £

Catalog number: 431-97271-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-NH2; MF C99H156N32O22; MW 2146.55

613 €
695 $
475 £

Catalog number: 431-97271-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-NH2; MF C99H156N32O22; MW 2146.55

257 €
292 $
200 £

Catalog number: 431-97271-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Biotin-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln; MF C109H169N33O25S; MW 2373.83

274 €
312 $
213 £

Catalog number: 431-109404-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Biotin-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln; MF C109H169N33O25S; MW 2373.83

662 €
751 $
513 £

Catalog number: 431-109404-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Biotin-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln; MF C109H169N33O25S; MW 2373.83

440 €
500 $
341 £

Catalog number: 431-109404-2
Product Quantity: 5 mg
Category:
Supplier:
Dynorphin A amide, porcine (AA: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-NH2) (MW: 2146.55)

223 €
253 $
173 £

Catalog number: SP-88383-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Dynorphin A (2-17), porcine (AA: Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln) (MW: 1984.36)

223 €
253 $
173 £

Catalog number: SP-88376-1
Product Quantity: 1 mg
Category:
Supplier: ADI
MF C90H146N30O21 ; MW 1984.32 ; GGFLRRIRPKLKWDNQ, Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln

307 €
348 $
238 £

Catalog number: RB-PP-0599
Product Quantity: 1 mg
Category:
Supplier:
[D_Arg6] _ Dynorphin A (1 _13), porcine Formula C75H126N24O15 Sequence Tyr_Gly_Gly_Phe_Leu_D_Arg_Arg_Ile_Arg_Pro_Lys_Leu_Lys

266 €
302 $
206 £

Catalog number: 100514
Product Quantity: 5mg
Category:
Supplier: GLSChina
MF C59H100N14O12 ; MW 1197.52 ; VFILGPLRLLG , Val-Phe-Ile-Leu-Gly-Pro-Leu-Arg-Leu-Leu-Gly

307 €
348 $
238 £

Catalog number: RB-PP-0641
Product Quantity: 1 mg
Category:
Supplier:
Biotin-Galanin, human (AA: Biotin-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser) (MW: 3383.78)

390 €
443 $
302 £

Catalog number: SP-87462-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Dynorphin A (1-17), (Prodynorphin 209-225), Porcine (AA: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln) (MW: 2147.53)

223 €
253 $
173 £

Catalog number: SP-82939-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Dynorphin (2_17), amide,porcine Formula C90H147N31O20 Sequence Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro_Lys_Leu_Lys_Trp_Asp_Asn_Gln_NH2

167 €
190 $
130 £

Catalog number: 88366
Product Quantity: 1mg
Category:
Supplier: GLSChina
BNP_32, rat Formula C146H239N47O44S3 Sequence Asn_Ser_Lys_Met_Ala_His_Ser_Ser_Ser_Cys_Phe_Gly_Gln_Lys_Ile_Asp_Arg_Ile_Gly_Ala_Val_Ser_Arg_Leu_Gly_Cys_Asp_ Gly_Leu_Arg_Leu_Phe(Disulfide bridge Cys10_

240 €
273 $
186 £

Catalog number: 55422
Product Quantity: 0.5mg
Category:
Supplier: GLSChina
Sequence Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp- Gly-Leu-Arg-Leu-Phe(Disulfide bridge Cys10-Cys26); MF C146H239N47O44S3; MW 3453

662 €
751 $
513 £

Catalog number: 431-64310-3
Product Quantity: 2.5 mg
Category:
Supplier:
Sequence Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp- Gly-Leu-Arg-Leu-Phe(Disulfide bridge Cys10-Cys26); MF C146H239N47O44S3; MW 3453

323 €
366 $
250 £

Catalog number: 431-64310-1
Product Quantity: 500
Category:
Supplier:
Sequence Asn-Ser-Lys-Met-Ala-His-Ser-Ser-Ser-Cys-Phe-Gly-Gln-Lys-Ile-Asp-Arg-Ile-Gly-Ala-Val-Ser-Arg-Leu-Gly-Cys-Asp- Gly-Leu-Arg-Leu-Phe(Disulfide bridge Cys10-Cys26); MF C146H239N47O44S3; MW 3453

440 €
500 $
341 £

Catalog number: 431-64310-2
Product Quantity: 1mg
Category:
Supplier:
MF C75H127N27O15 ; MW 1646.99; YGGFLRRRRPKLK, Tyr-Gly-Gly-Phe-Leu-Arg-Arg-D-Arg-Arg-Pro-Lys-Leu-Lys

475 €
539 $
368 £

Catalog number: RB-PP-0583
Product Quantity: 1 mg
Category:
Supplier:
Secretin, porcine Formula C130H220N44O41 Sequence His_Ser_Asp_Gly_Thr_Phe_Thr_Ser_Glu_Leu_Ser_Arg_Leu_Arg_Asp_Ser_Ala_Arg_Leu_Gln_Arg_Leu_Leu_Gln_Gly_Leu_Val_NH2

216 €
245 $
167 £

Catalog number: 52310
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-NH2; MF C75H127N25O14; MW 1603.01

509 €
578 $
395 £

Catalog number: 431-97259-2
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-NH2; MF C75H127N25O14; MW 1603.01

355 €
403 $
275 £

Catalog number: 431-97259-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-NH2; MF C75H127N25O14; MW 1603.01

857 €
972 $
664 £

Catalog number: 431-97259-3
Product Quantity: 25 mg
Category:
Supplier:
Dynorphin A (1_13), porcine Formula C75H126N24O15 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro_Lys_Leu_Lys

266 €
302 $
206 £

Catalog number: 68567
Product Quantity: 5mg
Category:
Supplier: GLSChina
Dynorphin A (1-13), amide, porcine (AA: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-NH2) (MW: 1603.01)

390 €
443 $
302 £

Catalog number: SP-88371-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu-NH2; MF C61H94N18O16; MW 1335.54

323 €
366 $
250 £

Catalog number: 431-64025-2
Product Quantity: 5 mg
Category:
Supplier:
Allatostatin I Formula C61H94N18O16 Sequence Ala_Pro_Ser_Gly_Ala_Gln_Arg_Leu_Tyr_Gly_Phe_Gly_Leu_NH2

227 €
258 $
176 £

Catalog number: 55137
Product Quantity: 5mg
Category:
Supplier: GLSChina
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu-NH2; MF C61H94N18O16; MW 1335.54

257 €
292 $
200 £

Catalog number: 431-64025-1
Product Quantity: 2mg
Category:
Supplier:
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu-NH2; MF C61H94N18O16; MW 1335.54

407 €
462 $
316 £

Catalog number: 431-64025-3
Product Quantity: 10 mg
Category:
Supplier:
Allatostatin I (free acid) (AA: Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu) (MW: 1335.5)

390 €
443 $
302 £

Catalog number: SP-100832-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu; MF C61H94N18O16; MW 1335.5

475 €
539 $
368 £

Catalog number: 431-109720-2
Product Quantity: 10 mg
Category:
Supplier:
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu; MF C61H94N18O16; MW 1335.5

775 €
880 $
601 £

Catalog number: 431-109720-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-Tyr-Gly-Phe-Gly-Leu; MF C61H94N18O16; MW 1335.5

355 €
403 $
275 £

Catalog number: 431-109720-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence (Prodynorphin 209-225) Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln; MF C99H155N31O23; MW 2147.53

257 €
292 $
200 £

Catalog number: 431-91827-1
Product Quantity: 1mg
Category:
Supplier:
Sequence (Prodynorphin 209-225) Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln; MF C99H155N31O23; MW 2147.53

594 €
675 $
461 £

Catalog number: 431-91827-3
Product Quantity: 10 mg
Category:
Supplier:
Dynorphin A amide, porcine Formula C99H156N32O22 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro_Lys_Leu_Lys_Trp_Asp_Asn_Gln_NH2

173 €
196 $
134 £

Catalog number: 88383
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence (Prodynorphin 209-225) Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln; MF C99H155N31O23; MW 2147.53

407 €
462 $
316 £

Catalog number: 431-91827-2
Product Quantity: 5 mg
Category:
Supplier:
Allatostatin I (free acid) Formula C61H94N18O16 Sequence Ala_Pro_Ser_Gly_Ala_Gln_Arg_Leu_Tyr_Gly_Phe_Gly_Leu

266 €
302 $
206 £

Catalog number: 100832
Product Quantity: 5mg
Category:
Supplier: GLSChina
Activity_Dependent Neurotrophic Factor_14 Formula C58H103N17O17 Sequence Val_Leu_Gly_Gly_Gly_Ser_Ala_Leu_Leu_Arg_Ser_Ile_Pro_Ala

281 €
319 $
218 £

Catalog number: 86552
Product Quantity: 5mg
Category:
Supplier: GLSChina
Allatostatin [H-Ala-Pro-Ser-Gly-Ala-Gln-Arg-Leu-tyr-Gly-Phe-Gly-Leu-NH2; MW: 1335.54]

390 €
443 $
302 £

Catalog number: SP-55137-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Tyr-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

307 €
348 $
238 £

Catalog number: 431-109417-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Tyr-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

775 €
880 $
601 £

Catalog number: 431-109417-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Ile-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg

594 €
675 $
461 £

Catalog number: 431-109417-2
Product Quantity: 5 mg
Category:
Supplier:
M35 Formula C107H153N27O26 Sequence Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_Pro_Pro_Gly_Phe_Ser_Pro_Phe_Arg_NH2

190 €
216 $
147 £

Catalog number: 55214
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-NH2; MF C107H153N27O26; MW 2233.58

475 €
539 $
368 £

Catalog number: 431-64102-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-NH2; MF C107H153N27O26; MW 2233.58

274 €
312 $
213 £

Catalog number: 431-64102-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-NH2; MF C107H153N27O26; MW 2233.58

695 €
789 $
539 £

Catalog number: 431-64102-3
Product Quantity: 10 mg
Category:
Supplier:
Gastrin Releasing Peptide,human Formula C130H204N38O31S2 Sequence Val_Pro_Leu_Pro_Ala_Gly_Gly_Gly_Thr_Val_Leu_Thr_Lys_Met_Tyr_Pro_Arg_Gly_Asn_His_Trp_Ala_Val_Gly_His_Leu_Met_NH2

216 €
245 $
167 £

Catalog number: 52254
Product Quantity: 1mg
Category:
Supplier: GLSChina
Dynorphin A (1_17),(Prodynorphin 209_225),Porcine Formula C99H155N31O23 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro_Lys_Leu_Lys_Trp_Asp_Asn_Gln

167 €
190 $
130 £

Catalog number: 82939
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MF C75H126N24O15; MW 1603.99

475 €
539 $
368 £

Catalog number: 431-77455-2
Product Quantity: 10 mg
Category:
Supplier:
MF C75H126N24O15 ; MW 1603.96 ; YGGFLRRIRPKLK, Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-NH2

440 €
500 $
341 £

Catalog number: RB-PP-0589
Product Quantity: 1 mg
Category: Peptides
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MF C75H126N24O15; MW 1603.99

775 €
880 $
601 £

Catalog number: 431-77455-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MF C75H126N24O15; MW 1603.99

355 €
403 $
275 £

Catalog number: 431-77455-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-D-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MF C75H126N24O15; MW 1603.98

355 €
403 $
275 £

Catalog number: 431-109402-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-D-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MF C75H126N24O15; MW 1603.98

475 €
539 $
368 £

Catalog number: 431-109402-2
Product Quantity: 10 mg
Category:
Supplier:
Dynorphin A (2 _ 13), porcine Formula C66H117N23O13 Sequence Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro_Lys_Leu_Lys

252 €
286 $
195 £

Catalog number: 100518
Product Quantity: 5mg
Category:
Supplier: GLSChina
Sequence Tyr-Gly-Gly-Phe-Leu-D-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MF C75H126N24O15; MW 1603.98

775 €
880 $
601 £

Catalog number: 431-109402-3
Product Quantity: 25 mg
Category:
Supplier:
[D-Arg6] - Dynorphin A (1 - 13), porcine [Tyr-Gly-Gly-Phe-Leu-D-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MW: 1603.98]

390 €
443 $
302 £

Catalog number: SP-100514-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2 ; MF C130H220N44O41; MW 3055.41

594 €
675 $
461 £

Catalog number: 431-61198-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2 ; MF C130H220N44O41; MW 3055.41

307 €
348 $
238 £

Catalog number: 431-61198-1
Product Quantity: 1mg
Category:
Supplier:
Sequence His-Ser-Asp-Gly-Thr-Phe-Thr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Gly-Leu-Val-NH2 ; MF C130H220N44O41; MW 3055.41

857 €
972 $
664 £

Catalog number: 431-61198-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu; MF C41H61N11O10S; MW 900.08

576 €
654 $
447 £

Catalog number: 431-97343-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu; MF C41H61N11O10S; MW 900.08

355 €
403 $
275 £

Catalog number: 431-97343-2
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu; MF C41H61N11O10S; MW 900.08

307 €
348 $
238 £

Catalog number: 431-97343-1
Product Quantity: 5 mg
Category:
Supplier:
Activity-Dependent Neurotrophic Factor-14 [Val-Leu-Gly-Gly-Gly-Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala (MW: 1310.57)]

390 €
443 $
302 £

Catalog number: SP-86552-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Galanin, rat Formula C141H211N43O41 Sequence Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_His_Ala_Ile_Asp_Asn_His_Arg_Ser_Phe_Ser_Asp_Lys_His_Gly_Leu_Thr_NH2

225 €
256 $
175 £

Catalog number: 52251
Product Quantity: 1mg
Category:
Supplier: GLSChina
Galanin, porcine Formula C146H213N43O40 Sequence Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_His_Ala_Ile_Asp_Asn_His_Arg_Ser_Phe_His_Asp_Lys_Tyr_Gly_Leu_Ala_NH2

225 €
256 $
175 £

Catalog number: 52252
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Biotin-Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C140H218N40O33S3; MW 3085.74

339 €
384 $
263 £

Catalog number: 431-97029-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Biotin-Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C140H218N40O33S3; MW 3085.74

970 €
1101 $
752 £

Catalog number: 431-97029-3
Product Quantity: 10 mg
Category:
Supplier:
Gastrin Releasing Peptide, Human [Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MW: 2859.40]

564 €
641 $
438 £

Catalog number: SP-52254-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Biotin-Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C140H218N40O33S3; MW 3085.74

679 €
771 $
527 £

Catalog number: 431-97029-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Cys-Arg-Pro-Lys-Leu-Cys-NH2

257 €
292 $
200 £

Catalog number: 431-110657-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MF C66H117N23O13; MW 1440.81

727 €
825 $
564 £

Catalog number: 431-109406-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Cys-Arg-Pro-Lys-Leu-Cys-NH2

576 €
654 $
447 £

Catalog number: 431-110657-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MF C66H117N23O13; MW 1440.81

440 €
500 $
341 £

Catalog number: 431-109406-2
Product Quantity: 10 mg
Category:
Supplier:
MF C75H126N24O15 ; MW 1603.96 ; YGGFLRRIRPKLK, Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys

440 €
500 $
341 £

Catalog number: RB-PP-0584
Product Quantity: 1 mg
Category: Peptides
Supplier:
Dynorphin A (1-13), porcine (AA: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys) (MW: 1603.99)

390 €
443 $
302 £

Catalog number: SP-68567-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Cys-Arg-Pro-Lys-Leu-Cys-NH2

407 €
462 $
316 £

Catalog number: 431-110657-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys; MF C66H117N23O13; MW 1440.81

339 €
384 $
263 £

Catalog number: 431-109406-1
Product Quantity: 5 mg
Category:
Supplier:
Neuropeptide W_30 (human) Formula C165H249N49O37S Sequence Trp_Tyr_Lys_His_Val_Ala_Ser_Pro_Arg_Tyr_His_Thr_Val_Gly_Arg_Ala_Ala_Gly_Leu_Leu_Met_Gly_Leu_Arg_Arg_Ser_Pro_Tyr_Leu_Trp

225 €
256 $
175 £

Catalog number: 54843
Product Quantity: 1mg
Category:
Supplier: GLSChina
Neuropeptide W_30 (rat) Formula C165H249N49O38S Sequence Trp_Tyr_Lys_His_Val_Ala_Ser_Pro_Arg_Tyr_His_Thr_Val_Gly_Arg_Ala_Ser_Gly_Leu_Leu_Met_Gly_Leu_Arg_Arg_Ser_Pro_Tyr_Leu_Trp

225 €
256 $
175 £

Catalog number: 100057
Product Quantity: 1mg
Category:
Supplier: GLSChina
Pre_S2 (1_26) Formula C131H199N39O37S Sequence Met_Gln_Trp_Asn_Ser_Thr_Ala_Phe_His_Gln_Thr_Leu_Gln_Asp_Pro_Arg_Val_Arg_Gly_Leu_Tyr_Leu_Pro_Ala_Gly_Gly

207 €
235 $
161 £

Catalog number: 89124
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly; MF C131H199N39O37S; MW 2944.35

576 €
654 $
447 £

Catalog number: 431-98012-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly; MF C131H199N39O37S; MW 2944.35

775 €
880 $
601 £

Catalog number: 431-98012-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly; MF C131H199N39O37S; MW 2944.35

307 €
348 $
238 £

Catalog number: 431-98012-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2; MF C141H211N43O41; MW 3164.48

921 €
1045 $
714 £

Catalog number: 431-61139-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2; MF C146H213N43O40; MW 3210.55

613 €
695 $
475 £

Catalog number: 431-61140-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2; MF C146H213N43O40; MW 3210.55

921 €
1045 $
714 £

Catalog number: 431-61140-3
Product Quantity: 10 mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2; MF C141H211N43O41; MW 3164.48

613 €
695 $
475 £

Catalog number: 431-61139-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-His-Asp-Lys-Tyr-Gly-Leu-Ala-NH2; MF C146H213N43O40; MW 3210.55

323 €
366 $
250 £

Catalog number: 431-61140-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2; MF C141H211N43O41; MW 3164.48

323 €
366 $
250 £

Catalog number: 431-61139-1
Product Quantity: 1mg
Category:
Supplier:
2B-(S) [Biotin-Arg-Arg-Ala-Ala-Gly-Gly-Leu-asp-Ser-Arg-Ala-Gly-Ser-Pro-Gln-Leu-OH; MW: 2000.24]

277 €
314 $
214 £

Catalog number: SP-55158-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Sequence Val-Leu-Gly-Gly-Gly-Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala; MF C58H103N17O17; MW 1310.57

509 €
578 $
395 £

Catalog number: 431-95440-2
Product Quantity: 10 mg
Category:
Supplier:
Sequence Val-Leu-Gly-Gly-Gly-Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala; MF C58H103N17O17; MW 1310.57

355 €
403 $
275 £

Catalog number: 431-95440-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence Val-Leu-Gly-Gly-Gly-Ser-Ala-Leu-Leu-Arg-Ser-Ile-Pro-Ala; MF C58H103N17O17; MW 1310.57

857 €
972 $
664 £

Catalog number: 431-95440-3
Product Quantity: 25 mg
Category:
Supplier:
[Met5,Arg6,Gly7,Leu8] Enkephalin [Tyr-Gly-Gly-Phe-Met-Arg-Gly-Leu; MW 900.08]

223 €
253 $
173 £

Catalog number: SP-88455-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C130H204N38O31S2; MW 2859.40

594 €
675 $
461 £

Catalog number: 431-61142-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C130H204N38O31S2; MW 2859.40

307 €
348 $
238 £

Catalog number: 431-61142-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2; MF C130H204N38O31S2; MW 2859.40

857 €
972 $
664 £

Catalog number: 431-61142-3
Product Quantity: 10 mg
Category:
Supplier:
Dynorphin A (1_9), porcine Formula C52H84N18O11 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg

212 €
241 $
165 £

Catalog number: 88374
Product Quantity: 5mg
Category:
Supplier: GLSChina
MF C57H91N19O12 ; MW 1234.46; YGGFLRRIRP , Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2

274 €
312 $
213 £

Catalog number: RB-PP-0575
Product Quantity: 1 mg
Category:
Supplier:
MF C63H103N21O13 ; MW 1362.63 ; YGGFLRRIRPK , Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-D-Pro-Lys

307 €
348 $
238 £

Catalog number: RB-PP-0577
Product Quantity: 1 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro; MF C57H91N19O12; MW 1234.48

679 €
771 $
527 £

Catalog number: 431-97256-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro; MF C57H91N19O12; MW 1234.48

407 €
462 $
316 £

Catalog number: 431-97256-2
Product Quantity: 10 mg
Category:
Supplier:
MF C63H103N21O13 ; MW 1362.63 ; YGGFLRRIRPK , Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys

307 €
348 $
238 £

Catalog number: RB-PP-0578
Product Quantity: 1 mg
Category:
Supplier:
Dynorphin A (1-11), porcine (AA: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys) (MW: 1362.66)

390 €
443 $
302 £

Catalog number: SP-88369-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro; MF C57H91N19O12; MW 1234.48

323 €
366 $
250 £

Catalog number: 431-97256-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-D-Pro-Lys; MF C63H103N21O13; MW 1362.66

323 €
366 $
250 £

Catalog number: 431-110656-1
Product Quantity: 5 mg
Category:
Supplier:
[D-Pro10]-Dynorphin A (1-11), porcine [Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-D-Pro-Lys; MW: 1362.66]

390 €
443 $
302 £

Catalog number: SP-101768-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Dynorphin A (1_10), porcine Formula C57H91N19O12 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro

227 €
258 $
176 £

Catalog number: 88368
Product Quantity: 5mg
Category:
Supplier: GLSChina
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-D-Pro-Lys; MF C63H103N21O13; MW 1362.66

695 €
789 $
539 £

Catalog number: 431-110656-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-D-Pro-Lys; MF C63H103N21O13; MW 1362.66

407 €
462 $
316 £

Catalog number: 431-110656-2
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2; MF C57H92N20O11; MW 1233.50

407 €
462 $
316 £

Catalog number: 431-97255-2
Product Quantity: 10 mg
Category:
Supplier:
Dynorphin A (1-10), amide, porcine (AA: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2) (MW: 1233.50)

390 €
443 $
302 £

Catalog number: SP-88367-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys; MF C63H103N21O13; MW 1362.66

323 €
366 $
250 £

Catalog number: 431-97257-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys; MF C63H103N21O13; MW 1362.66

407 €
462 $
316 £

Catalog number: 431-97257-2
Product Quantity: 10 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2; MF C57H92N20O11; MW 1233.50

323 €
366 $
250 £

Catalog number: 431-97255-1
Product Quantity: 5 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys; MF C63H103N21O13; MW 1362.66

695 €
789 $
539 £

Catalog number: 431-97257-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-NH2; MF C57H92N20O11; MW 1233.50

695 €
789 $
539 £

Catalog number: 431-97255-3
Product Quantity: 25 mg
Category:
Supplier:
[Tyr0] Fibrinopeptide A, human Formula C72H106N20O28 Sequence Tyr_Ala_Asp_Ser_Gly_Glu_Gly_Asp_Phe_Leu_Ala_Glu_Gly_Gly_Gly_Val_Arg

167 €
190 $
130 £

Catalog number: 88475
Product Quantity: 1mg
Category:
Supplier: GLSChina
Secretin, Porcine [H-His-Ser-Asp-Gly-Thr-Phe-THr-Ser-Glu-Leu-Ser-Arg-Leu-Arg-Asp-Ser-Ala-Arg-Leu-Gln-Arg-Leu-Leu-gln-Gly-Leu-Val-NH2; MW: 355.47]

826 €
937 $
640 £

Catalog number: SP-52310-1
Product Quantity: 5 mg
Category:
Supplier: ADI
Prepro TRH (83_106) Formula C115H176N34O45 Sequence Glu_Glu_Glu_Glu_Lys_Asp_Ile_Glu_Ala_Glu_Glu_Arg_Gly_Asp_Leu_Gly_Glu_Gly_Gly_Ala_Trp_Arg_Leu_His

199 €
225 $
154 £

Catalog number: 87354
Product Quantity: 1mg
Category:
Supplier: GLSChina
Galanin, Porcine [Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-Nh2; MW: 3210.55]

731 €
830 $
567 £

Catalog number: SP-52252-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Dynorphin A (1_11), porcine Formula C63H103N21O13 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro_Lys

237 €
269 $
184 £

Catalog number: 88369
Product Quantity: 5mg
Category:
Supplier: GLSChina
Galanin (1_13)_Spantide I Formula C138H199N35O30 Sequence Gly_Trp_Thr_Leu_Asn_Ser_Ala_Gly_Tyr_Leu_Leu_Gly_Pro_D_Arg_Pro_Lys_Pro_Gln_Gln_D_Trp_Phe_D_Trp_Leu_Leu_NH2

239 €
272 $
185 £

Catalog number: 101037
Product Quantity: 1mg
Category:
Supplier: GLSChina
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg; MF C52H84N18O11; MW 1137.36

307 €
348 $
238 £

Catalog number: 431-97262-1
Product Quantity: 5 mg
Category:
Supplier:
MF C57H91N19O12 ; MW 1234.46; YGGFLRRIRP , Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro

274 €
312 $
213 £

Catalog number: RB-PP-0573
Product Quantity: 1 mg
Category:
Supplier:
Dynorphin A (1-10), porcine (AA: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro) (MW: 1234.48)

390 €
443 $
302 £

Catalog number: SP-88368-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg; MF C52H84N18O11; MW 1137.36

613 €
695 $
475 £

Catalog number: 431-97262-3
Product Quantity: 25 mg
Category:
Supplier:
Sequence Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg; MF C52H84N18O11; MW 1137.36

373 €
423 $
289 £

Catalog number: 431-97262-2
Product Quantity: 10 mg
Category:
Supplier:
Osteostatin amide (human) Formula C142H229N43O57 Sequence Thr_Arg_Ser_Ala_Trp_Leu_Asp_Ser_Gly_Val_Thr_Gly_Ser_Gly_Leu_Glu_Gly_Asp_His_Leu_Ser_Asp_Thr_Ser_Thr_Thr_Ser_Leu_Glu_Leu_Asp_Ser_Arg_NH2

294 €
333 $
228 £

Catalog number: 100081
Product Quantity: 1mg
Category:
Supplier: GLSChina
Pre-S2 (1-26) (AA: Met-Gln-Trp-Asn-Ser-Thr-Ala-Phe-His-Gln-Thr-Leu-Gln-Asp-Pro-Arg-Val-Arg-Gly-Leu-Tyr-Leu-Pro-Ala-Gly-Gly) (MW: 2944.35)

306 €
347 $
237 £

Catalog number: SP-89124-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Dynorphin A (2 - 13), porcine (AA: Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys) (MW: 1440.81)

390 €
443 $
302 £

Catalog number: SP-100518-5
Product Quantity: 5 mg
Category:
Supplier: ADI
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2; MF C138H199N35O30; MW 2828.34

323 €
366 $
250 £

Catalog number: 431-109925-1
Product Quantity: 1mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2; MF C138H199N35O30; MW 2828.34

662 €
751 $
513 £

Catalog number: 431-109925-2
Product Quantity: 5 mg
Category:
Supplier:
Sequence Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2; MF C138H199N35O30; MW 2828.34

954 €
1083 $
740 £

Catalog number: 431-109925-3
Product Quantity: 10 mg
Category:
Supplier:
[D_Pro10]_Dynorphin A (1_11), porcine Formula C63H103N21O13 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_D_Pro_Lys

237 €
269 $
184 £

Catalog number: 101768
Product Quantity: 5mg
Category:
Supplier: GLSChina
Dynorphin A (1_10), amide,porcine Formula C57H92N20O11 Sequence Tyr_Gly_Gly_Phe_Leu_Arg_Arg_Ile_Arg_Pro_NH2

237 €
269 $
184 £

Catalog number: 88367
Product Quantity: 5mg
Category:
Supplier: GLSChina
[Tyr0] Fibrinopeptide A, human [Tyr-Ala-Asp-Ser-Gly-Glu-Gly-Asp-Phe-Leu-Ala-Glu-Gly-Gly-Gly-Val-Arg; MW 1699.76]

390 €
443 $
302 £

Catalog number: SP-88475-1
Product Quantity: 1 mg
Category:
Supplier: ADI
Fibrinopeptide A, human Formula C63H97N19O26 Sequence Ala_Asp_Ser_Gly_Glu_Gly_Asp_Phe_Leu_Ala_Glu_Gly_Gly_Gly_Val_Arg

187 €
212 $
145 £

Catalog number: 75922
Product Quantity: 1mg
Category:
Supplier: GLSChina
 

GENTAUR Belgium BVBA BE0473327336
Voortstraat 49, 1910 Kampenhout BELGIUM
Tel 0032 16 58 90 45

Fax 0032 16 50 90 45
info@gentaur.com | Gentaur





GENTAUR Ltd.
Howard Frank Turnberry House
1404-1410 High Road
Whetstone London N20 9BH
Tel 020 3393 8531 Fax 020 8445 9411
uk@gentaur.com | Gentaur

 

 




GENTAUR France SARL
9, rue Lagrange, 75005 Paris
Tel 01 43 25 01 50

Fax 01 43 25 01 60
RCS Paris B 484 237 888

SIRET 48423788800017

BNP PARIBAS PARIS PL MAUBERT BIC BNPAFRPPPRG

france@gentaur.com | Gentaur

GENTAUR GmbH
Marienbongard 20
52062 Aachen Deutschland
Support Karolina Elandt
Tel: 0035929830070
Fax: (+49) 241 56 00 47 88

Logistic :0241 40 08 90 86
Bankleitzahl 39050000
IBAN lautet DE8839050000107569353
Handelsregister Aachen HR B 16058
Umsatzsteuer-Identifikationsnummer *** DE 815175831
Steuernummer 201/5961/3925
de@gentaur.com | Gentaur

GENTAUR U.S.A
Genprice Inc, Logistics
547, Yurok Circle
San Jose, CA 95123
CA 95123
Tel (408) 780-0908,
Fax (408) 780-0908,
sales@genprice.com

Genprice Inc, Invoices and accounting
6017 Snell Ave, Ste 357
San Jose, CA 95123




GENTAUR Nederland BV
NL850396268B01 KVK nummer 52327027
Kuiper 1
5521 DG Eersel Nederland
Tel:  0208-080893  Fax: 0497-517897
nl@gentaur.com | Gentaur
IBAN: NL04 RABO 0156 9854 62   SWIFT RABONL2U






GENTAUR Spain
tel:0911876558
spain@gentaur.com | Gentaur






ГЕНТАУЪР БЪЛГАРИЯ
ID # 201 358 931 /BULSTAT
София 1000, ул. "Граф Игнатиев" 53 вх. В, ет. 2
Tel 0035924682280 Fax 0035924808322
e-mail: Sofia@gentaur.com | Gentaur
IBAN: BG11FINV91501014771636
BIC: FINVBGSF

GENTAUR Poland Sp. z o.o.


ul. Grunwaldzka 88/A m.2
81-771 Sopot, Poland
TEL Gdansk 058 710 33 44 FAX  058 710 33 48              

poland@gentaur.com | Gentaur

Other countries

Österreich +43720880899

Canada Montreal +15149077481

Ceská republika Praha +420246019719

Danmark +4569918806

Finland Helsset +358942419041

Magyarország Budapest +3619980547

Ireland Dublin+35316526556

Luxembourg+35220880274

Norge Oslo+4721031366

Sverige Stockholm+46852503438

Schweiz Züri+41435006251

US New York+17185132983

GENTAUR Italy
SRL IVA IT03841300167
Piazza Giacomo Matteotti, 6
24122 Bergamo Tel 02 36 00 65 93
Fax 02 36 00 65 94
italia@gentaur.com | Gentaur