URL to share
Catalog-Num Product Name Quantity Price Supplier Category
20-272-191611 Adrenomedullin - Mouse monoclonal [HTA91a_G2] to Adrenomedullin; Monoclonal 0.1 mg 464-Eur GenWay monoclonal
20-272-191610 Adrenomedullin - Mouse monoclonal [HTA171_E8] to Adrenomedullin; Monoclonal 0.1 mg 464-Eur GenWay monoclonal
orb71360 Rat Adrenomedullin (11-50) peptide This is Rat Adrenomedullin (11-50) peptide. For research use only. 1 mg 446-Eur Biorb rat
orb71357 Rat Adrenomedullin (1-50) peptide This is Rat Adrenomedullin (1-50) peptide. For research use only. 1 mg 446-Eur Biorb rat
orb71359 Pig Adrenomedullin (1-52) peptide This is Pig Adrenomedullin (1-52) peptide. For research use only. 1 mg 446-Eur Biorb
orb71911 Rat Pro-Adrenomedullin N20 peptide This is Rat Pro-Adrenomedullin N20 peptide. For research use only. 1 mg 175-Eur Biorb rat
orb71362 Human, Pig Adrenomedullin (16-31) peptide This is Human, Pig Adrenomedullin (16-31) peptide. For research use only. 1 mg 297-Eur Biorb human
orb71358 Human Adrenomedullin (1-52) peptide This is Human Adrenomedullin (1-52) peptide. For research use only. 1 mg 446-Eur Biorb human
orb71363 Human Adrenomedullin (22-52) peptide This is Human Adrenomedullin (22-52) peptide. For research use only. 1 mg 241-Eur Biorb human
orb71361 Human Adrenomedullin (13-52) peptide This is Human Adrenomedullin (13-52) peptide. For research use only. 1 mg 446-Eur Biorb human
orb70408 Human Adrenomedullin (1-12) peptide This is Human Adrenomedullin (1-12) peptide. For research use only. 1 mg 175-Eur Biorb human
orb71910 Human Pro-Adrenomedullin N20 peptide This is Human Pro-Adrenomedullin N20 peptide. For research use only. 1 mg 175-Eur Biorb human
orb71364 Human Adrenomedullin (26-52) peptide This is Human Adrenomedullin (26-52) peptide. For research use only. 1 mg 203-Eur Biorb human
orb71900 Human Prepro-adrenomedullin (153-185) peptide This is Human Prepro-adrenomedullin (153-185) peptide. For research use only. 1 mg 278-Eur Biorb human
KP0193 Adrenomedullin (1 - 50), rat 1 mg 406-Eur KareBay
GTX109260 Adrenomedullin (ADM) 100 µl 297-Eur ACR
4422-s Adrenomedullin 2 (Rat) 0.1mg 480-Eur Sceti K.K. rat
4281-s Adrenomedullin (Rat) 0.1mg 539-Eur Sceti K.K. rat
4281-s Adrenomedullin (Rat) 0.1mg 539-Eur Sceti K.K. rat
4422-s Adrenomedullin 2 (Rat) 0.1mg 480-Eur Sceti K.K. rat
4422-s Adrenomedullin 2 (Rat) 0.1mg 480-Eur Sceti K.K. rat
4281-s Adrenomedullin (Rat) 0.1mg 539-Eur Sceti K.K. rat
GTX109260 Adrenomedullin (ADM) 100 µl 378-Eur ACR
DL-ADM-Ra Rat Adrenomedullin (ADM) ELISA Kit 96T 1033-Eur Yukichj Elisa kits
GTX18092 Adrenomedullin (ADM) 100 µg 459-Eur ACR
ELI-5283 Adrenomedullin (AM) 96 Wells 824-Eur Nal Von Minden
SP3152a Adrenomedullin (11-50), rat 0.1 mg 160-Eur Abgen rat
EUD6701 Adrenomedullin (ADM) (1_6) 50 µl 839-Eur ACR
GTX100641 Adrenomedullin (ADM) 100 µl 378-Eur ACR
SP3152a Adrenomedullin (11-50), rat 2 165-Eur Abgen
GTX18093 Adrenomedullin (ADM) 100 µg 664-Eur ACR
GTX18092 Adrenomedullin (ADM) 100 µg 601-Eur ACR
GTX100641 Adrenomedullin (ADM) 100 µl 297-Eur ACR
AP20574PU-N Adrenomedullin (ADM) 100 µg 446-Eur ACR
EUD6701 Adrenomedullin (ADM) (1_6) 50 µl 703-Eur ACR
SP3416a Adrenomedullin (1-50), rat 0.5 mg 223-Eur Abgen rat
SP3416a Adrenomedullin (1-50), rat 143-Eur Abgen
SP3152b Adrenomedullin (11-50), rat 0.5 mg 417-Eur Abgen rat
SP3416b Adrenomedullin (1-50), rat 223-Eur Abgen
SP3152b Adrenomedullin (11-50), rat 247-Eur Abgen
SP2520b Pro-Adrenomedullin (N-20), rat 555-Eur Abgen
SP2520a Pro-Adrenomedullin (N-20), rat 0.1 mg 596-Eur Abgen rat
SP2520a Pro-Adrenomedullin (N-20), rat 343-Eur Abgen
SP2520b Pro-Adrenomedullin (N-20), rat 0.2 mg 993-Eur Abgen rat
SP3416b Adrenomedullin (1-50), rat 1 mg 371-Eur Abgen rat
SP3106a Adrenomedullin (13-52), human 0.5 mg 371-Eur Abgen human
DL-ADM-Mu Mouse Adrenomedullin (ADM) ELISA Kit 96T 994-Eur Yukichj Elisa kits
E02A0047 Rat Adrenomedullin ELISA , AM 785-Eur Blue Gene Biotech Elisa kits
SP3106b Adrenomedullin (13-52), human 1 mg 596-Eur Abgen human
SP2655b Pro-Adrenomedullin (45-92), human 0.2 mg 284-Eur Abgen human
YHB0046Ra Rat adrenomedullin,ADM ELISA Kit 48T 425-Eur yehua Elisa kits
DL-ADM-Hu Human Adrenomedullin (ADM) ELISA Kit 96T 954-Eur Yukichj Elisa kits
DL-ADM-c Canine Adrenomedullin (ADM) ELISA Kit 96T 1073-Eur Yukichj Elisa kits
SP3127a Pro-Adrenomedullin (153-185), human 0.1 mg 192-Eur Abgen human
SP3127b Pro-Adrenomedullin (153-185), human 0.2 mg 285-Eur Abgen human
CK-E98140 Rat adrenomedullin,ADM ELISAkit ----Eur Glory Elisa kits
KN0925Ra Rat adrenomedullin,ADM ELISA Kit 96 WELLS 585-Eur KONO
SP3152b Adrenomedullin (11_50), rat 1.0 mg 311-Eur Abgen rat
DL-ADM-Eq Equine Adrenomedullin (ADM) ELISA Kit 96T 1073-Eur Yukichj Elisa kits
YHB0046Ra Rat adrenomedullin,ADM ELISA Kit 96T 721-Eur yehua Elisa kits
E0546Ra Rat adrenomedullin,ADM ELISA Kit 48T 440-Eur JING Elisa kits
SP2521a Pro-Adrenomedullin (N-20), porcine 0.5 mg 176-Eur Abgen porcine
RP11288-0.5 Adrenomedullin (AM) (1-52), human 0,5mg 385-Eur Genscript
SP2521b Pro-Adrenomedullin (N-20), porcine 1 mg 262-Eur Abgen porcine
E90220Eq ELISA Kit for Adrenomedullin (ADM) 96T/Kit 955-Eur USCNLife Elisa kits
SP2522a Pro-Adrenomedullin (N-20), human 0.5 mg 192-Eur Abgen human
SP2655a Pro-Adrenomedullin (45-92), human 0.1 mg 192-Eur Abgen human
RP11291-0.5 Adrenomedullin (AM) (13-52), human 0,5mg 336-Eur Genscript
SP2522b Pro-Adrenomedullin (N-20), human 1 mg 285-Eur Abgen human
SP-100047-1 Adrenomedullin (11-50) (rat) [Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; (Disu 1 mg 642-Eur ADI
ADNP ADM Gene adrenomedullin ----Eur Transposagen
RP11293-0.5 Adrenomedullin (AM) (22-52), human 0,5mg 207-Eur Genscript
SP2554a Adrenomedullin (16-31), human, pig 0.5 mg 176-Eur Abgen human
SP2554b Adrenomedullin (16-31), human, pig 1 mg 285-Eur Abgen human
EK-010-08 Adrenomedullin (AM_ADM)(1_50)(Rat) _ 96 well EIA Kit Kit 701-Eur Phoenix Peptide elisa
RP13758 Adrenomedullin (AM), canine 0,1mg 291-Eur Genscript
E0547Ra Rat adrenomedullin,ADM ELISA Kit 96T 678-Eur Eastbio Elisa kits
SP2655a Pro-Adrenomedullin (45-92), human 127-Eur Abgen
NBP1-19731 Adrenomedullin (ADM) 0.1 mg 554-Eur ACR
NB100-2631 Adrenomedullin (ADM) 0.1 mg 486-Eur ACR
NB100-2632 Adrenomedullin (ADM) 0.1 mg 486-Eur ACR
SP3414b Adrenomedullin (1-52), porcine 177-Eur Abgen
SP3106a Adrenomedullin (13-52), human 223-Eur Abgen
SP3415b Adrenomedullin (1-52), human 247-Eur Abgen
SP3106b Adrenomedullin (13-52), human 343-Eur Abgen
CSB-E10060r Rat adrenomedullin,ADM ELISA Kit 96T 1044-Eur Cusabio elisa
RP13758 Adrenomedullin (AM), canine 0.1mg 341-Eur Genscript dog
SP3127b Pro-Adrenomedullin (153-185), human 177-Eur Abgen
SP2655b Pro-Adrenomedullin (45-92), human 177-Eur Abgen
ADML11-S Adrenomedullin (ADM) (C_term) 0.1 ml 473-Eur ACR
SP2522a Pro-Adrenomedullin (N-20), human 127-Eur Abgen
NBP1-05165 Adrenomedullin 0.1 mg 595-Eur ACR
SP3127a Pro-Adrenomedullin (153-185), human 127-Eur Abgen
SP2521b Pro-Adrenomedullin (N-20), porcine 165-Eur Abgen
SP3206b Adrenomedullin (22-52), human 165-Eur Abgen
SP2522b Pro-Adrenomedullin (N-20), human 177-Eur Abgen
SP2554b Adrenomedullin (16-31), human, pig 177-Eur Abgen
E02A0047 Rat Adrenomedullin ELISA , AM 96 Tests/kit 685-Eur BGene Elisa kits
ADML11-A Adrenomedullin (ADM) (C_term) 0.1 mg 554-Eur ACR
SP3152a Adrenomedullin (11_50), rat 0.5 mg 87-Eur Abgen rat
201-11-0548 Rat adrenomedullin(ADM)ELISA Kit 96T 706-Eur SunBT Elisa kits
E0220r Rat adrenomedullin ELISA Kit 96T 860-Eur EIAab elisa
4325-v Adrenomedullin (Human 0.5mg 495-Eur Sceti K.K. human
4421-s Adrenomedullin 2 (Human) 0.1mg 480-Eur Sceti K.K. human
4302-v Adrenomedullin (Human 0.5mg 495-Eur Sceti K.K. human
4278-s Adrenomedullin (Human) 0.1mg 539-Eur Sceti K.K. human
QY-E11097 Rat adrenomedullin(ADM)ELISA Kit 96T 528-Eur SQBIO Elisa kits
U0220r Rat adrenomedullin CLIA KIT 96T 860-Eur EIAab assays
CK-E30105 Rat adrenomedullin,ADM ELISA Kit 96T 517-Eur Eastbio Elisa kits
SP-100047-1 Adrenomedullin (11-50) (rat) [Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; (Disu 1 mg Product tipe: Pure Peptide 642-Eur ADI
SP3413a Adrenomedullin (1-12), human 10 181-Eur Abgen
SP3416a Adrenomedullin (1_50), rat 0.5 mg 142-Eur Abgen rat
SP3416b Adrenomedullin (1_50), rat 1.0 mg 270-Eur Abgen rat
SP3414a Adrenomedullin (1-52), porcine 2 181-Eur Abgen
SP3206a Adrenomedullin (22-52), human 2 181-Eur Abgen
SP2554a Adrenomedullin (16-31), human, pig 2 181-Eur Abgen
SP2521a Pro-Adrenomedullin (N-20), porcine 2 181-Eur Abgen
SP3415a Adrenomedullin (1-52), human 2 165-Eur Abgen
SP3413b Adrenomedullin (1-12), human 3 143-Eur Abgen
E0547Ra Rat adrenomedullin,ADM ELISA Kit 48T 373-Eur Eastbio Elisa kits
E12410168 Rat Adrenomedullin (ADM)ELISA Kit 1 620-Eur Sincere
201-20-0202 ADM{adrenomedullin}rabbit.pAb 0.1ml 415-Eur Shanghai Sunred
4278-s Adrenomedullin (Human) 0.1mg 539-Eur Sceti K.K. human
201-11-0548 Rat adrenomedullin,ADM ELISA Kit 96T 558-Eur SunBT Elisa kits
22472 Rat adrenomedullin(ADM) Elisa Kit 96T 1002-Eur Bio-Medical elisa
E90220Hu ELISA Kit for Adrenomedullin (ADM) 96T/Kit 777-Eur USCNLife Elisa kits
CSB-E10060r Rat adrenomedullin,ADM ELISA Kit 96tests 1044-Eur Cusabio elisa
E90220Ca ELISA Kit for Adrenomedullin (ADM) 96T/Kit 889-Eur USCNLife Elisa kits
E90220Ra ELISA Kit for Adrenomedullin (ADM) 96T/Kit 844-Eur USCNLife Elisa kits
E90220Mu ELISA Kit for Adrenomedullin (ADM) 96T/Kit 800-Eur USCNLife Elisa kits
KP0195 Adrenomedullin (22 - 52), human 1 mg 246-Eur KareBay
ADML11-S Adrenomedullin (ADM) (C_term) 0.1 ml 537-Eur ACR
E1384041 Adrenomedullin (ADM) ELISA Kit 676-Eur Sincere
4302-v Adrenomedullin (Human 0.5mg 495-Eur Sceti K.K. human
4278-s Adrenomedullin (Human) 0.1mg 539-Eur Sceti K.K. human
E02A0462 Rat Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 867-Eur Other suppliers Elisa kits
4302-v Adrenomedullin (Human 0.5mg 495-Eur Sceti K.K. human
E02A0047 Rat Adrenomedullin elisa kit 96 Tests/kit 867-Eur Other suppliers Elisa kits
ER713 Adrenomedullin Elisa Kit 96T 389-Eur Wuhan Finetest
E1381334 Adrenomedullin (ADM) ELISA Kit 1 676-Eur Sincere
4325-v Adrenomedullin (Human 0.5mg 495-Eur Sceti K.K. human
4421-s Adrenomedullin 2 (Human) 0.1mg 480-Eur Sceti K.K. human
4421-s Adrenomedullin 2 (Human) 0.1mg 480-Eur Sceti K.K. human
ADML11-A Adrenomedullin (ADM) (C_term) 0.1 mg 664-Eur ACR
4325-v Adrenomedullin (Human 0.5mg 495-Eur Sceti K.K. human
NB100-2631 Adrenomedullin (ADM) 0.1 mg 585-Eur ACR
KP0194 Adrenomedullin (1 - 52), human 1 mg 406-Eur KareBay
NB100-2632 Adrenomedullin (ADM) 0.1 mg 585-Eur ACR
06-271-83046 Adrenomedullin (13-52) Human - 1 mg 869-Eur GenWay human
06-271-83046 Adrenomedullin (13-52) Human - 0.5 mg 588-Eur GenWay human
SL0035Ra Rat adrenomedullin,ADM ELISA Kit 96T 653-Eur Sunlog Elisa kits
E90220Po ELISA Kit for Adrenomedullin (ADM) 96T/Kit 933-Eur USCNLife Elisa kits
GWB-B348CC Adrenomedullin (AM) Canine 373-Eur GenWay
SP3415b Adrenomedullin (1-52), human 0.5 mg 417-Eur Abgen human
SP3415a Adrenomedullin (1-52), human 0.1 mg 160-Eur Abgen human
SP3414b Adrenomedullin (1-52), porcine 1 mg 285-Eur Abgen porcine
SP3414a Adrenomedullin (1-52), porcine 0.5 mg 176-Eur Abgen porcine
SP3413b Adrenomedullin (1-12), human 1 mg 114-Eur Abgen human
E02A0047 Rat Adrenomedullin ELISA 96T/kit 788-Eur Blue Gene Biotech Elisa kits
SP3413a Adrenomedullin (1-12), human 0.5 mg 83-Eur Abgen human
SP-100828-1 Pro-Adrenomedullin N20, rat (AA:Ala-Arg-Leu-Asp-Thr-Ser-Ser-Gln-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2) (MW: 2477.9) 1 mg 198-Eur ADI
SP3206b Adrenomedullin (22-52), human 1 mg 262-Eur Abgen human
SP3206a Adrenomedullin (22-52), human 0.5 mg 176-Eur Abgen human
06-271-83047 Adrenomedullin (1-52) Human - 0.5 mg 713-Eur GenWay human
06-271-83048 Adrenomedullin (22-52) Human - 1 mg 402-Eur GenWay human
06-271-83049 Adrenomedullin (AM) Canine - 0.1 mg 479-Eur GenWay dog
06-271-83048 Adrenomedullin (22-52) Human - 0.5 mg 277-Eur GenWay human
UB-E11097 Rat adrenomedullin(ADM)ELISA Kit 96T 556-Eur ubio
06-271-83047 Adrenomedullin (1-52) Human - 1 mg 1055-Eur GenWay human
CSB-E10060r Rat adrenomedullin,ADM ELISA Kit 96tests 976-Eur Cusabio elisa
E90220Bo ELISA Kit for Adrenomedullin (ADM) 96T/Kit 933-Eur USCNLife Elisa kits
orb51524 Rat Adrenomedullin ELISA Kit 96 well 1105-Eur Biorb elisa
orb51523 Porcine Adrenomedullin ELISA Kit 96 well 1202-Eur Biorb elisa
SP2554a Adrenomedullin (16_31), human, pig 0.5 mg 101-Eur Abgen human
SP3206a Adrenomedullin (22_52), human 1.0 mg 101-Eur Abgen human
SP3415b Adrenomedullin (1_52), human 1.0 mg 311-Eur Abgen human
SP3415a Adrenomedullin (1_52), human 0.5 mg 87-Eur Abgen human
SP3106a Adrenomedullin (13_52), human 0.5 mg 270-Eur Abgen human
SP3106b Adrenomedullin (13_52), human 1.0 mg 466-Eur Abgen human
SP3414b Adrenomedullin (1_52), porcine 1.0 mg 196-Eur Abgen porcine
SP3414a Adrenomedullin (1_52), porcine 0.5 mg 101-Eur Abgen porcine
SP3413b Adrenomedullin (1_12), human 1.0 mg 47-Eur Abgen human
SP3413a Adrenomedullin (1_12), human 0.5 mg 20-Eur Abgen human
SP3206b Adrenomedullin (22_52), human 5.0 mg 175-Eur Abgen human
SP2554b Adrenomedullin (16_31), human, pig 1.0 mg 196-Eur Abgen human
E07A0047 Porcine Adrenomedullin elisa kit 96 Tests/kit 878-Eur Other suppliers Elisa kits
E01A0047 Human Adrenomedullin elisa kit 96 Tests/kit 867-Eur Other suppliers Elisa kits
201-12-1025 Human adrenomedullin,ADM ELISA Kit 48T 336-Eur SunBT Elisa kits
201-12-1025 Human adrenomedullin,ADM ELISA Kit 96T 542-Eur SunBT Elisa kits
CSB-E09836c Dog adrenomedullin,ADM ELISA Kit SpeciesDog 96T 1119-Eur Cusabio Elisa kits
CSB-E10060r Rat adrenomedullin,ADM ELISA Kit SpeciesRat 96T 1119-Eur Cusabio Elisa kits
201-09-0164 Rabbit adrenomedullin,ADM ELISA Kit 96T 819-Eur SunBT Elisa kits
NBL1-07345 Adrenomedullin Lysate 0.1 mg 446-Eur ACR
14438-v Adrenomedullin 2 (Human, 1-7) Antiserum 50μl 612-Eur Sceti K.K.
14278-v Adrenomedullin (Human) Antiserum 50μl 612-Eur Sceti K.K.
E0220m Mouse adrenomedullin ELISA Kit 96T 842-Eur EIAab elisa
E01A0462 Human Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 867-Eur Other suppliers Elisa kits
E05A0047 Guinea Adrenomedullin elisa kit 96 Tests/kit 878-Eur Other suppliers Elisa kits
E05A0462 Guinea Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 878-Eur Other suppliers Elisa kits
E04A0462 Rabbit Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 867-Eur Other suppliers Elisa kits
E04A0047 Rabbit Adrenomedullin elisa kit 96 Tests/kit 867-Eur Other suppliers Elisa kits
E03A0462 Mouse Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 867-Eur Other suppliers Elisa kits
E03A0047 Mouse Adrenomedullin elisa kit 96 Tests/kit 867-Eur Other suppliers Elisa kits
E11A0462 Bovine Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 900-Eur Other suppliers Elisa kits
E11A0047 Bovine Adrenomedullin elisa kit 96 Tests/kit 900-Eur Other suppliers Elisa kits
E08A0462 Canine Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 900-Eur Other suppliers Elisa kits
E08A0047 Canine Adrenomedullin elisa kit 96 Tests/kit 900-Eur Other suppliers Elisa kits
E06A0462 Goat Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 878-Eur Other suppliers Elisa kits
E06A0047 Goat Adrenomedullin elisa kit 96 Tests/kit 878-Eur Other suppliers Elisa kits
CSB-EL001370PI Pig adrenomedullin (ADM) ELISA kit SpeciesPig 96T 1041-Eur Cusabio Elisa kits
18-461-10503 Adrenomedullin receptor - AM-R Polyclonal 0.05 ml 573-Eur GenWay recombinant
E08A0047 Canine Adrenomedullin ELISA , AM 815-Eur Blue Gene Biotech Elisa kits
E09A0047 Monkey Adrenomedullin ELISA , AM 815-Eur Blue Gene Biotech Elisa kits
E11A0047 Bovine Adrenomedullin ELISA , AM 815-Eur Blue Gene Biotech Elisa kits
E12A0047 Chicken Adrenomedullin ELISA , AM 815-Eur Blue Gene Biotech Elisa kits
Y050480 Anti_ADMR(adrenomedullin receptor) 100ug 497-Eur ABM recombinant
201-20-7144 ADM R{Adrenomedullin receptor}rabbit.pAb 0.1ml 415-Eur Shanghai Sunred
E14A0047 Sheep Adrenomedullin ELISA , AM 815-Eur Blue Gene Biotech Elisa kits
E1024Hu Human adrenomedullin,ADM ELISA Kit 96T 607-Eur Eastbio Elisa kits
E0174Mo Mouse adrenomedullin,ADM ELISA Kit     96T 678-Eur Eastbio Elisa kits
E1024Hu Human adrenomedullin,ADM ELISA Kit 48T 405-Eur Eastbio Elisa kits
E0174Mo Mouse adrenomedullin,ADM ELISA Kit     48T 373-Eur Eastbio Elisa kits
E07A0047 Porcine Adrenomedullin ELISA , AM 815-Eur Blue Gene Biotech Elisa kits
E06A0047 Goat Adrenomedullin ELISA , AM 815-Eur Blue Gene Biotech Elisa kits
18-461-10758 Adrenomedullin receptor - AM-R Polyclonal 0.05 ml 573-Eur GenWay recombinant
E96043Hu ELISA Kit for Adrenomedullin Receptor (AMR) 96T/Kit 777-Eur USCNLife Elisa kits
ADNP2 ADM2 Gene adrenomedullin 2 ----Eur Transposagen
E02A0462 Rat anti-Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 1240-Eur BlueGen elisa
E02A0047 Rat anti-Adrenomedullin elisa kit 96 Tests/kit 1240-Eur BlueGen elisa
E01A0047 Human Adrenomedullin ELISA , AM 785-Eur Blue Gene Biotech Elisa kits
UB-E70071 Canine adrenomedullin,ADM ELISA Kit 96T 652-Eur ubio
E03A0047 Mouse Adrenomedullin ELISA , AM 785-Eur Blue Gene Biotech Elisa kits
E04A0047 Rabbit Adrenomedullin ELISA , AM 785-Eur Blue Gene Biotech Elisa kits
UB-E80068 hicken adrenomedullin,ADM ELISA Kit 96T 652-Eur ubio
E05A0047 Guinea pig Adrenomedullin ELISA , AM 785-Eur Blue Gene Biotech Elisa kits
SP-AM0152-05 Peptides: Adrenomedullin (1-52) human 0.5 mg 790-Eur Innova
SP-AM0152-1 Peptides: Adrenomedullin (1-52) human 1 mg 1456-Eur Innova
22477 Mouse adrenomedullin(ADM )ELISA Kit 96T 1002-Eur Bio-Medical elisa
E0220h Human adrenomedullin ELISA Kit 96T 805-Eur EIAab elisa
E0220Ch Chicken adrenomedullin ELISA Kit 96T 957-Eur EIAab elisa
E0220c Canine adrenomedullin ELISA Kit 96T 957-Eur EIAab elisa
E0220Mo Monkey adrenomedullin ELISA Kit 96T 957-Eur EIAab elisa
SP-AM1352-1 Peptides: Adrenomedullin (13-52) human 1 mg 1338-Eur Innova
orb51518 Bovine Adrenomedullin ELISA Kit 96 well 1202-Eur Biorb elisa
SP-55425-1 Adrenomedullin(13-52), Human [H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-Nh2(Cys1 0.5 mg Product tipe: Pure Peptide 649-Eur ADI
orb51519 Canine Adrenomedullin ELISA Kit 96 well 1164-Eur Biorb elisa
orb51520 Equine Adrenomedullin ELISA Kit 96 well 1222-Eur Biorb elisa
orb51521 Human Adrenomedullin ELISA Kit 96 well 1047-Eur Biorb elisa
22471 Human Adrenomedullin ELISA Kit(ADM) 96T 741-Eur Bio-Medical elisa
E07A0462 Porcine Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 878-Eur Other suppliers Elisa kits
E14195h Human Adrenomedullin 2 ELISA Kit 96T 805-Eur EIAab elisa
U0220Rb Rabbit adrenomedullin CLIA KIT 96T 957-Eur EIAab polyclonal
U0220m Mouse adrenomedullin CLIA KIT 96T 842-Eur EIAab assays
U0220Mo Monkey adrenomedullin CLIA KIT 96T 957-Eur EIAab assays
U0220h Human adrenomedullin CLIA KIT 96T 805-Eur EIAab assays
U0220Ch Chicken adrenomedullin CLIA KIT 96T 957-Eur EIAab assays
U0220c Canine adrenomedullin CLIA KIT 96T 957-Eur EIAab assays
E0220Rb Rabbit adrenomedullin ELISA Kit 96T 957-Eur EIAab elisa
E13A0462 Anserine Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 900-Eur Other suppliers Elisa kits
E13A0047 Anserine Adrenomedullin elisa kit 96 Tests/kit 900-Eur Other suppliers Elisa kits
SP-AM1352-05 Peptides: Adrenomedullin (13-52) human 0.5 mg 730-Eur Innova
orb51522 Mouse Adrenomedullin ELISA Kit 96 well 1066-Eur Biorb elisa
14278-v Adrenomedullin (Human) Antiserum 50ìl 583-Eur Sceti K.K. human
UB-E01608 Human adrenomedullin(ADM)ELISA Kit 96T 556-Eur ubio
UB-E30278 Rabbit adrenomedullin,ADM ELISA Kit 96T 575-Eur ubio
UB-C80068 Chicken Adrenomedullin,ADM ELISA Kit 96T 689-Eur Unibio Elisa kits
GWB-4DF074 Adrenomedullin [HTA171 E8], Antibody 503-Eur GenWay
010-22 Adrenomedullin (AM_ADM)(24_50)(Rat) _ 100ug 100 µg 307-Eur Phoenix Peptide rat
010-23 Adrenomedullin (AM_ADM)(20_50)(Rat) _ 100ug 100 µg 324-Eur Phoenix Peptide rat
GWB-4DF074 Adrenomedullin [HTA171_E8], Antibody 503-Eur GenWay
E14A0047 Sheep Adrenomedullin ELISA 96T/kit 817-Eur Blue Gene Biotech Elisa kits
010-09 Adrenomedullin (AM_ADM)(11_50)(Rat) _ 100ug 100 µg 339-Eur Phoenix Peptide rat
010-08 Adrenomedullin (AM_ADM)(1_50)(Rat) _ 100ug 100 µg 371-Eur Phoenix Peptide rat
14438-v Adrenomedullin 2 (Human, 1_7) Antiserum 50ìl 583-Eur Sceti K.K. human
CSB-E04843Ch Chicken adrenomedullin,ADM ELISA Kit 96tests 1109-Eur Cusabio elisa
CSB-E09146h Human adrenomedullin,ADM ELISA Kit 96tests 976-Eur Cusabio elisa
CSB-E09836c Canine adrenomedullin,ADM ELISA Kit 96tests 1109-Eur Cusabio elisa
CSB-E09837Rb Rabbit adrenomedullin,ADM ELISA Kit 96tests 1109-Eur Cusabio elisa
CSB-E09838Mo Monkey adrenomedullin,ADM ELISA Kit 96tests 1109-Eur Cusabio elisa
CSB-E10061m Mouse adrenomedullin,ADM ELISA Kit 96tests 1022-Eur Cusabio elisa
UB-E20055 Mouse adrenomedullin(ADM)ELISA Kit 96T 556-Eur ubio
ICCBGP670-1 Adrenomedullin 1_6, Guinea pig anti_Rat 50 µl. 886-Eur Accu rat
010-27 Adrenomedullin (AM_ADM)(Canine) _ 100ug 100 µg 371-Eur Phoenix Peptide dog
010-28 Adrenomedullin (1_44) (Human) _ 100ug 100 µg 444-Eur Phoenix Peptide human
E06A0047 Goat Adrenomedullin ELISA 96T/kit 807-Eur Blue Gene Biotech Elisa kits
FEK-010-08 Adrenomedullin (AM_ADM)(1_50)(Rat) _ Fluorescent EIA Kit Kit 806-Eur Phoenix Peptide elisa
SL0007Ch Chicken adrenomedullin,ADM ELISA Kit 96T 703-Eur Sunlog Elisa kits
E12A0047 Chicken Adrenomedullin ELISA 96T/kit 817-Eur Blue Gene Biotech Elisa kits
E08A0047 Canine Adrenomedullin ELISA 96T/kit 807-Eur Blue Gene Biotech Elisa kits
E11A0047 Bovine Adrenomedullin ELISA 96T/kit 817-Eur Blue Gene Biotech Elisa kits
SP-55425-1 Adrenomedullin(13-52), Human [H-Ser-Phe-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-Nh2(Cys1 0.5 mg 649-Eur ADI
SP-100049-1 Adrenomedullin (26-52) (human) (AA: Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2) (MW: 3119.49) 1 mg 271-Eur ADI
E05A0047 Guinea Pig Adrenomedullin ELISA 96T/kit 807-Eur Blue Gene Biotech Elisa kits
E01A0047 Human Adrenomedullin ELISA 96T/kit 788-Eur Blue Gene Biotech Elisa kits
E04A0047 Rabbit Adrenomedullin ELISA 96T/kit 788-Eur Blue Gene Biotech Elisa kits
SP-100827-1 Pro-Adrenomedullin N20, human (AA: Ala-Arg-Leu-Asp-Val-Ala-Ala-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2) (MW: 2444.9) 1 mg 198-Eur ADI
E07A0047 Porcine Adrenomedullin ELISA 96T/kit 807-Eur Blue Gene Biotech Elisa kits
SL0027Mo Mouse adrenomedullin,ADM ELISA Kit 96T 653-Eur Sunlog Elisa kits
E03A0047 Mouse Adrenomedullin ELISA 96T/kit 788-Eur Blue Gene Biotech Elisa kits
E09A0047 Monkey Adrenomedullin ELISA 96T/kit 817-Eur Blue Gene Biotech Elisa kits
SL0075Hu Human adrenomedullin,ADM ELISA Kit 96T 605-Eur Sunlog Elisa kits
EK-010-01 Adrenomedullin (AM_ADM)(1_52)(Human) _ 96 well EIA Kit Kit 701-Eur Phoenix Peptide elisa
SP-100824-5 Adrenomedullin (1-12), human (AA: Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg) (MW: 1513.7) 5 mg 346-Eur ADI
14438-v Adrenomedullin 2 (Human, 1_7) Antiserum 50ìl 583-Eur Sceti K.K. human
BMAT4130 Adrenomedullin, Rabbit anti_Human 400 µg. 1340-Eur Accu polyclonal
E1385052 Fish Adrenomedullin (ADM) ELISA Kit 676-Eur Sincere
E1382011 Monkey adrenomedullin(ADM) ELISA Kit 676-Eur Sincere
E1383007 Chicken Adrenomedullin,ADM ELISA Kit 676-Eur Sincere
SP-55286-1 Adrenomedullin(22_52), Human 0.5 mg 456-Eur Alpha Dia human
SP-55425-1 Adrenomedullin(13_52), Human 0.5 mg 720-Eur Alpha Dia human
10371-05011 Adrenomedullin, anti_human 150 ug 207-Eur Assaypro human
10371-05015 Adrenomedullin, anti_human 400 ug 315-Eur Assaypro human
10371-05021 Adrenomedullin, anti_human 150 ug 228-Eur Assaypro human
A020255 Rabbit Anti-ADM per AM per Adrenomedullin Ab 200Ul 661-Eur KORIAN
ADML11-S Anti_Human Adrenomedullin antiserum 100 ul 464-Eur Alpha Dia human
BMAS3032 Adrenomedullin, Rabbit anti_Human, IF Kit kit 944-Eur Accu polyclonal
BMAT4131 Adrenomedullin, Rabbit anti_Human; IH 50 µl. 749-Eur Accu polyclonal
BMAT4129 Adrenomedullin, Rabbit anti_Human; RIA vial 1436-Eur Accu polyclonal
BMAT4137 Adrenomedullin, Rabbit anti_Rat 400 µg. 1340-Eur Accu polyclonal
BMAS3169 Adrenomedullin, Rabbit anti_Rat, IF Kit kit 944-Eur Accu polyclonal
BMAT4138 Adrenomedullin, Rabbit anti_Rat; IH 50 µl. 749-Eur Accu polyclonal
BMAT4136 Adrenomedullin, Rabbit anti_Rat; RIA vial 1436-Eur Accu polyclonal
ADML11-A Anti_Human Adrenomedullin IgG, aff. Pure 100 ug 547-Eur Alpha Dia human
10371-05025 Adrenomedullin, anti_human 400 ug 347-Eur Assaypro human
11701-05011 Adrenomedullin, anti_rat 150 ug 207-Eur Assaypro rat
11701-05015 Adrenomedullin, anti_rat 400 ug 315-Eur Assaypro rat
CSB-E09838Mo Monkey adrenomedullin,ADM ELISA Kit 96tests 1041-Eur Cusabio elisa
CSB-E09837Rb Rabbit adrenomedullin,ADM ELISA Kit 96tests 1041-Eur Cusabio elisa
CSB-E09836c Canine adrenomedullin,ADM ELISA Kit 96tests 1041-Eur Cusabio elisa
CSB-E09146h Human adrenomedullin,ADM ELISA Kit 96tests 908-Eur Cusabio elisa
CSB-E04843Ch Chicken adrenomedullin,ADM ELISA Kit 96tests 1041-Eur Cusabio elisa
E90220Bo ELISA Kit for Bovine Adrenomedullin(ADM) 96T 915-Eur USCNLife elisa
E90220Po ELISA Kit for Porcine Adrenomedullin(ADM) 96T 915-Eur USCNLife elisa
E90220Eq ELISA Kit for Equine Adrenomedullin(ADM) 96T 934-Eur USCNLife elisa
CSB-E10061m Mouse adrenomedullin,ADM ELISA Kit 96tests 954-Eur Cusabio elisa
11701-05011 Adrenomedullin, anti-rat 150 ug 190-Eur Assaypro
11701-05021 Adrenomedullin, anti_rat 150 ug 228-Eur Assaypro rat
11701-05025 Adrenomedullin, anti_rat 400 ug 347-Eur Assaypro rat
abx064348 Synthetic Adrenomedullin (22-52) Peptide 1 mg 409-Eur Abbexa
E15860078 Porcine Adrenomedullin (ADM)ELISA Kit 1 639-Eur Sincere
E13750078 Rabbit Adrenomedullin (ADM)ELISA Kit 1 676-Eur Sincere
E12530078 Mouse Adrenomedullin (ADM)ELISA Kit 1 612-Eur Sincere
E13650077 Human Adrenomedullin (ADM)ELISA Kit 1 612-Eur Sincere
11701-05021 Adrenomedullin, anti-rat 150 ug 220-Eur Assaypro
14278-v Adrenomedullin (Human) Antiserum 50ìl 583-Eur Sceti K.K. human
CSB-E10061m Mouse adrenomedullin,ADM ELISA Kit 96T 1022-Eur Cusabio elisa
14278-v Adrenomedullin (Human) Antiserum 50ìl 583-Eur Sceti K.K. human
CSB-EL001370BO Bovine adrenomedullin (ADM) ELISA kit 96T 770-Eur Cusabio Elisa kits
CSB-EL001370FI Fish adrenomedullin (ADM) ELISA kit 96T 770-Eur Cusabio Elisa kits
QY-E01608 Human adrenomedullin(ADM)ELISA Kit 96T 661-Eur SQBIO Elisa kits
201-09-0164 Rabbit adrenomedullin(ADM)ELISA Kit 96T 614-Eur Sunred Elisa kits
201-02-0175 Mouse adrenomedullin(ADM)ELISA Kit     96T 624-Eur Sunred Elisa kits
201-16-0068 Chicken adrenomedullin(ADM)ELISA Kit 96T 836-Eur Sunred Elisa kits
CK-E10656 Human adrenomedullin,ADM ELISA Kit 96T 829-Eur Eastbio Elisa kits
CK-E10660 Human adrenomedullin,ADM ELISA Kit 96T 829-Eur Eastbio Elisa kits
CK-E20131 Mouse adrenomedullin,ADM ELISA Kit 96T 517-Eur Eastbio Elisa kits
CK-E60060 Chicken adrenomedullin,ADM ELISA Kit 96T 517-Eur Eastbio Elisa kits
201-12-1025 Human adrenomedullin(ADM)ELISA Kit 96T 686-Eur SunBT Elisa kits
QY-E70071 Canine adrenomedullin,ADM ELISA Kit 96T 632-Eur SQBIO Elisa kits
14438-v Adrenomedullin 2 (Human, 1_7) Antiserum 50ìl 583-Eur Sceti K.K. human
QY-E20055 Mouse adrenomedullin(ADM)ELISA Kit 96T 528-Eur SQBIO Elisa kits
QY-E30278 Rabbit adrenomedullin,ADM ELISA Kit 96T 736-Eur SQBIO Elisa kits
11701-05015 Adrenomedullin, anti_rat IgG 400 ug 324-Eur Assaypro rat
SP-55286-1 Adrenomedullin (22-52), Human [H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; MW: 3576.06] 0.5 mg 412-Eur ADI
E14A0047 Sheep Adrenomedullin ELISA , AM 96 Tests/kit 709-Eur BGene Elisa kits
CSB-E09838Mo Monkey adrenomedullin,ADM ELISA Kit 96T 1109-Eur Cusabio elisa
CSB-E09837Rb Rabbit adrenomedullin,ADM ELISA Kit 96T 1109-Eur Cusabio elisa
CSB-E09836c Canine adrenomedullin,ADM ELISA Kit 96T 1109-Eur Cusabio elisa
CSB-E09146h Human adrenomedullin,ADM ELISA Kit 96T 770-Eur Cusabio elisa
CSB-E04843Ch Chicken adrenomedullin,ADM ELISA Kit 96T 1044-Eur Cusabio elisa
RP11293 Adrenomedullin (AM) (22_52), human 0.5mg 198-Eur Genscript human
RP11291 Adrenomedullin (AM) (13_52), human 0.5mg 417-Eur Genscript human
RP11288 Adrenomedullin (AM) (1_52), human 0.5mg 499-Eur Genscript human
E01A0047 Human Adrenomedullin ELISA , AM 96 Tests/kit 685-Eur BGene Elisa kits
E03A0047 Mouse Adrenomedullin ELISA ,AM 96 Tests/kit 685-Eur BGene Elisa kits
E04A0047 Rabbit Adrenomedullin ELISA , AM 96 Tests/kit 685-Eur BGene Elisa kits
E06A0047 Goat Adrenomedullin ELISA , AM 96 Tests/kit 693-Eur BGene Elisa kits
E07A0047 Porcine Adrenomedullin ELISA , AM 96 Tests/kit 693-Eur BGene Elisa kits
E08A0047 Canine Adrenomedullin ELISA , AM 96 Tests/kit 709-Eur BGene Elisa kits
E09A0047 Monkey Adrenomedullin ELISA , AM 96 Tests/kit 709-Eur BGene Elisa kits
E11A0047 Bovine Adrenomedullin ELISA , AM 96 Tests/kit 709-Eur BGene Elisa kits
E12A0047 Chicken Adrenomedullin ELISA , AM 96 Tests/kit 709-Eur BGene Elisa kits
11701-05011 Adrenomedullin, anti_rat IgG 150 ug 211-Eur Assaypro rat
E-EL-H0275 Human ADM (Adrenomedullin) ELISA Kit 96T 664-Eur Elabscience Elisa kits
10371-05015 Adrenomedullin, anti_human IgG 400 ug 324-Eur Assaypro human
E-EL-Ch1869 Chicken ADM (Adrenomedullin) ELISA Kit 96T 736-Eur Elabscience Elisa kits
ELI-5283 Adrenomedullin (AM), Tumor Diagnosis 10 kits 6910-Eur Nal
CK-E98947 Chicken adrenomedullin,ADM ELISAkit ----Eur Glory Elisa kits
E-EL-MK0024 Monkey ADM (Adrenomedullin) ELISA Kit 96T 736-Eur Elabscience Elisa kits
CK-E97628 Mouse adrenomedullin,ADM ELISAkit ----Eur Glory Elisa kits
CK-E96466 Human adrenomedullin,ADM ELISAkit ----Eur Glory Elisa kits
CK-E96462 Human adrenomedullin,ADM ELISAkit ----Eur Glory Elisa kits
CK-E95375 Human adrenomedullin (ADM) ELISA Kit 96T 829-Eur Glory Elisa kits
CK-E94791 Human Adrenomedullin(ADM) ELISA Kit. 96T 829-Eur Glory Elisa kits
E-EL-P1678 Porcine ADM (Adrenomedullin) ELISA Kit 96T 736-Eur Elabscience Elisa kits
DL-AMR-Hu Human Adrenomedullin Receptor (AMR) ELISA Kit 96T 954-Eur Yukichj Elisa kits
E0173Mo Mouse adrenomedullin,ADM ELISA Kit     48T 440-Eur JING Elisa kits
YHB0049Mo Mouse adrenomedullin,ADM ELISA Kit     96T 721-Eur yehua Elisa kits
YHB0117Hu Human adrenomedullin,ADM ELISA Kit 96T 629-Eur yehua Elisa kits
10371-05011 Adrenomedullin, anti_human IgG 150 ug 211-Eur Assaypro human
YHB0049Mo Mouse adrenomedullin,ADM ELISA Kit     48T 425-Eur yehua Elisa kits
YHB0117Hu Human adrenomedullin,ADM ELISA Kit 48T 395-Eur yehua Elisa kits
A-0802 Adrenomedullin (rat) 98 percent C242H381N77O75S5 CAS: 161383-47-7 5mg 930-Eur Other suppliers
A-0803 Adrenomedullin (11-50) (rat) 98 percent C194H304N58O59S4 CAS: 163648-32-6 5mg 848-Eur Other suppliers
5-42047 Adrenomedullin (22-52), human, peptide reagents 2.5 mg 628-Eur CHI
SP-100826-1 Prepro-adrenomedullin (153 - 185), human (AA: Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu) (MW: 3219.6) 1 mg 271-Eur ADI
5-42040 Adrenomedullin (1-52), human, peptide reagents 1 mg 736-Eur CHI
5-42044 Adrenomedullin (13-52), human, peptide reagents 2.5 mg 1008-Eur CHI
5-42043 Adrenomedullin (13-52), human, peptide reagents 1 mg 596-Eur CHI
5-42041 Adrenomedullin (1-52), human, peptide reagents 2.5 mg 1256-Eur CHI
CSB-EL001371HU Human adrenomedullin 2 (ADM2) ELISA kit 96T 770-Eur Cusabio
abx101058 Polyclonal Rabbit Adrenomedullin Antibody 100 μg 409-Eur Abbexa
abx101059 Polyclonal Rabbit Adrenomedullin Antibody 100 μg 409-Eur Abbexa
CSB-E09837Rb Rabbit adrenomedullin,ADM ELISA Kit SpeciesRabbit 96T 1119-Eur Cusabio Elisa kits
YF-MA17711 anti-Adrenomedullin Receptor L1 (3B10) 100 ug 434-Eur Abfron
A020256 Rabbit Anti-ADM per Adrenomedullin (ProAM-N20) Ab 200Ul 661-Eur KORIAN
03-16001 Polyclonal antibody Anti-Adrenomedullin 1-6 50 μl 357-Eur ARP
5-42039 Adrenomedullin (1-52), human, peptide reagents 0.5 mg 457-Eur CHI
5-42046 Adrenomedullin (22-52), human, peptide reagents 1 mg 380-Eur CHI
IRAPKT2045 Human Adrenomedullin N-20, Pro_PAMP-20 Prodepin EIA Kit 1 kit(96 Wells) 805-Eur Innovative
GWB-E7D114 Anti- Adrenomedullin receptor Antibody 514-Eur GenWay
GWB-F2A1A7 Anti- Adrenomedullin receptor Antibody 514-Eur GenWay
201-12-3105 Human Adrenomedullin 2(ADM2)ELISA Kit 96T 686-Eur SunBT Elisa kits
IRAPKT2045-1 Kit Human Adrenomedullin N20, Pro_PAMP20 Prodepin EIA Kit 1 Kit 1 Kit 846-Eur Innovative
201-12-3106 Human Adrenomedullin Receptor(AMR)ELISA Kit 96T 686-Eur SunBT Elisa kits
'EUD6701 Adrenomedullin (ADM) (1-6) antibody Ab host: Guinea Pig 50 Вµl 590-Eur ACR
A-0807 Adrenomedullin (26-52) (human) n) 98 percent C139H216N40O42 CAS: 5mg 474-Eur Other suppliers
'AP20574PU-N Adrenomedullin (ADM) antibody Ab host: Rabbit 0.1 mg 389-Eur ACR
UB-E01606 Human Adrenomedullin Receptor(AMR)ELISA Kit 96T 556-Eur ubio
10371-05011 Adrenomedullin, anti-human 150 ug 190-Eur Assaypro
AE63127HU Human Adrenomedullin 2 (ADM2) ELISA Kit 48T 630-Eur abelisa
SP-100828-1 Pro-Adrenomedullin N20, rat (AA:Ala-Arg-Leu-Asp-Thr-Ser-Ser-Gln-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2) (MW: 2477.9) Species Reactivity: 1 mg Product tipe: Pure Peptide 197-Eur ADI
CEA220Ra ELISA Kit for Adrenomedullin (ADM) Rattus norvegicus (Rat) 96T 769-Eur USCNLife Elisa kits
CEA220Mu ELISA Kit for Adrenomedullin (ADM) Mus musculus (Mouse) 96T 734-Eur USCNLife Elisa kits
5-42042 Adrenomedullin (13-52), human, peptide reagents 0.5 mg 373-Eur CHI
QY-E01606 Human Adrenomedullin Receptor(AMR)ELISA Kit 96T 661-Eur SQBIO Elisa kits
abx101056 Polyclonal Rabbit Adrenomedullin Antibody 100 μg 389-Eur Abbexa
abx101055 Polyclonal Rabbit Adrenomedullin Antibody 100 μg 389-Eur Abbexa
QY-E01607 Human Adrenomedullin 2(ADM2)ELISA Kit 96T 661-Eur SQBIO Elisa kits
5-42045 Adrenomedullin (22-52), human, peptide reagents 0.5 mg 247-Eur CHI
AP20574PU-N Adrenomedullin (ADM) Rabbit antibody Ab Aff - Purified 0.1 mg 362-Eur ACR
GTX100641 Adrenomedullin (ADM) Rabbit antibody Ab Aff - Purified 0.1 ml 239-Eur ACR
10371-05021 Adrenomedullin, anti-human 150 ug 220-Eur Assaypro
GTX109260 Adrenomedullin (ADM) Rabbit antibody Ab Aff - Purified 0.1 ml 239-Eur ACR
GTX18092 Adrenomedullin (ADM) Mouse IgM antibody Ab Purified 0.1 mg 393-Eur ACR
CEA220Po ELISA Kit for Adrenomedullin (ADM) Sus scrofa; Porcine (Pig) 96T 837-Eur USCNLife Elisa kits
UB-E01607 Human Adrenomedullin 2(ADM2)ELISA Kit 96T 556-Eur ubio
ADML11-P Adrenomedullin (ADM) (C_term) control peptide 0.1 mg 256-Eur ACR
E03A0047 Mouse anti-Adrenomedullin elisa kit 96 Tests/kit 1240-Eur BlueGen elisa
E03A0462 Mouse anti-Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 1240-Eur BlueGen elisa
E04A0047 Rabbit anti-Adrenomedullin elisa kit 96 Tests/kit 1240-Eur BlueGen elisa
E04A0462 Rabbit anti-Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 1240-Eur BlueGen elisa
E07A0047 Porcine anti-Adrenomedullin elisa kit 96 Tests/kit 1255-Eur BlueGen elisa
E07A0462 Porcine anti-Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 1255-Eur BlueGen elisa
E13A0047 Anserine anti - Adrenomedullin elisa kit 96 Tests/kit 1286-Eur BlueGen elisa
E13A0462 Anserine anti - Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 1286-Eur BlueGen elisa
EK-010-05 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Human) _ 96 well EIA Kit Kit 701-Eur Phoenix Peptide elisa
010-38 Adrenomedullin (13_53)_Gly (Human) _ 100µg 100 µg 404-Eur Phoenix Peptide human
010-37 Adrenomedullin (AM_ADM)[Gly53](Human) _ 100ug 100 µg 492-Eur Phoenix Peptide human
010-32 Adrenomedullin (AM_ADM)(24_50)(Mouse) _ 100ug 100 µg 307-Eur Phoenix Peptide mouse
010-31 Adrenomedullin (AM_ADM)(1_50)(Mouse) _ 100ug 100 µg 371-Eur Phoenix Peptide mouse
010-20 Adrenomedullin (AM_ADM)(34_52)(Human) _ 100ug 100 µg 275-Eur Phoenix Peptide human
010-19 Adrenomedullin (AM_ADM)(34_52)(Porcine) _ 100ug 100 µg 202-Eur Phoenix Peptide porcine
010-18 Adrenomedullin (AM_ADM)(26_52)(Porcine) _ 100ug 100 µg 219-Eur Phoenix Peptide porcine
E08A0462 Canine anti-Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 1286-Eur BlueGen elisa
E08A0047 Canine anti-Adrenomedullin elisa kit 96 Tests/kit 1286-Eur BlueGen elisa
E06A0462 Goat anti-Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 1255-Eur BlueGen elisa
11701-05025 Adrenomedullin, anti_rat Biotin_IgG 400 ug 358-Eur Assaypro rat
11701-05021 Adrenomedullin, anti_rat Biotin_IgG 150 ug 234-Eur Assaypro rat
10371-05025 Adrenomedullin, anti_human Biotin_IgG 400 ug 358-Eur Assaypro human
10371-05021 Adrenomedullin, anti_human Biotin_IgG 150 ug 234-Eur Assaypro human
WBK-010-09 Adrenomedullin (AM_ADM)(11_50)(Rat) _ Western Blot Kit Kit 1031-Eur Phoenix Peptide assays
WBK-010-08 Adrenomedullin (AM_ADM)(1_50)(Rat) _ Western Blot Kit Kit 1031-Eur Phoenix Peptide assays
T-010-03 Adrenomedullin (AM _ ADM) (13_52) (Human) I_125 Labeled 10 µCi 789-Eur Phoenix Peptide labeled
ADML15-P Adrenomedullin (ADM) (1_52), full length 0.1 mg 527-Eur ACR
E12307h Human Adrenomedullin Receptor ELISA Kit 96T 805-Eur EIAab elisa
YMPS255 Adrenomedullin 1_6, Guinea pig anti_Rat; frozen, IH 50 µl. 1702-Eur Accu rat
FEK-010-01 Adrenomedullin (AM_ADM)(1_52)(Human) _ Fluorescent EIA Kit Kit 806-Eur Phoenix Peptide elisa
EK-010-06 Adrenomedullin (AM_ADM) _Pro (45_92)(Human) _ 96 well EIA Kit Kit 701-Eur Phoenix Peptide elisa
E01A0047 Human Anti-Adrenomedullin elisa kit 96 Tests/kit 1240-Eur BlueGen elisa
E01A0462 Human Anti-Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 1240-Eur BlueGen elisa
E05A0462 Guinea anti-Adrenomedullin Elisa Kit (ADM) 96 Tests/kit 1255-Eur BlueGen elisa
E06A0047 Goat anti-Adrenomedullin elisa kit 96 Tests/kit 1255-Eur BlueGen elisa
E05A0047 Guinea anti-Adrenomedullin elisa kit 96 Tests/kit 1255-Eur BlueGen elisa
010-17 Adrenomedullin (AM_ADM)(26_52)(Human) _ 100ug 100 µg 307-Eur Phoenix Peptide human
'EUD6701 Adrenomedullin (ADM) (1-6) antibody Host Guinea Pig 50 798-Eur ACR
CSB-E04843Ch Chicken adrenomedullin,ADM ELISA Kit SpeciesChicken 96T 1119-Eur Cusabio Elisa kits
CSB-EL001370BO Bovine adrenomedullin (ADM) ELISA kit SpeciesBovine 96T 1041-Eur Cusabio Elisa kits
CSB-E10061m Mouse adrenomedullin,ADM ELISA Kit SpeciesMouse 96T 1094-Eur Cusabio Elisa kits
010-03 Adrenomedullin (AM_ADM)(13_52)(Human) _ 100ug 100 µg 339-Eur Phoenix Peptide human
CSB-E09146h Human adrenomedullin,ADM ELISA Kit SpeciesHuman 96T 1041-Eur Cusabio Elisa kits
ADML11-P Human Adrenomedullin Control_blocking peptide 100 ug 216-Eur Alpha Dia human
010-02 Adrenomedullin (AM_ADM)(1_12)(Human) _ 200ug 200 µg 126-Eur Phoenix Peptide human
010-01 Adrenomedullin (AM_ADM)(1_52)(Human) _ 100ug 100 µg 371-Eur Phoenix Peptide human
ADML15-P Adrenomedullin (ADM) (1_52), full length 0.1 mg 632-Eur ACR
ADML11-P Adrenomedullin (ADM) (C_term) control peptide 0.1 mg 314-Eur ACR elisa
S-2059.0001 Adrenomedullin (rat) _ RIA Kit, Host Rabbit 1kit 1132-Eur Bach polyclonal
A-0805 Adrenomedullin (16-31) (human, pig) 98 percent C82H129N25O21S2 CAS: 5mg 460-Eur Other suppliers
SP-100049-1 Adrenomedullin (26_52) (human) (AA Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr_Asp_Lys_Asp_Lys_Asp_Asn_Val_Ala_Pro_Arg_Ser_Lys_Ile_Ser_Pro_Gln_Gly_Tyr_NH2) (MW 3119.49) 1 mg 299-Eur Alpha Dia human
'GTX100641 Adrenomedullin (ADM) antibody Host rabbit 0.1 ml 347-Eur ACR
'GTX109260 Adrenomedullin (ADM) antibody Host Rabbit 0.1 ml 347-Eur ACR
010-10 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Rat) _ 200ug 200 µg 299-Eur Phoenix Peptide rat
010-11 Adrenomedullin (AM_ADM)(1_52)(Porcine) _ 20ug 20 µg 202-Eur Phoenix Peptide porcine
010-13 Adrenomedullin (AM_ADM)[Mpr14](14_50)(Rat) _ 100ug 100 µg 339-Eur Phoenix Peptide rat
010-15 Adrenomedullin (AM_ADM)(1_21)(Human) _ 100ug 100 µg 292-Eur Phoenix Peptide human
010-16 Adrenomedullin (AM_ADM)(16_52)(Human) _ 100ug 100 µg 339-Eur Phoenix Peptide human
CSB-E09838Mo Monkey adrenomedullin,ADM ELISA Kit SpeciesMonkey 96T 1119-Eur Cusabio Elisa kits
'AP20574PU-N Adrenomedullin (ADM) antibody Host Rabbit 100 533-Eur ACR
A-0806 Adrenomedullin (22-52) (human) 98 percent C159H252N46O48 CAS: 159899-65-7 5mg 532-Eur Other suppliers
E90220Ra ELISA Kit for Adrenomedullin (ADM) Organism Rattus norvegicus (Rat) 96T 780-Eur USCNLife elisa
T-010-10 Adrenomedullin N_20, Pro _ PAMP_20 _ Prodepin (Rat) I_125 Labeled 10 µCi 789-Eur Phoenix Peptide labeled
GS-0042a adrenomedullin primary antibody, Host: Rabbit 200ul 902-Eur Glory
E90220Mu ELISA Kit for Adrenomedullin (ADM) Organism Mus musculus (Mouse) 96T 745-Eur USCNLife elisa
SP-100046-1 Adrenomedullin (1_50), rat (AA see antigen, sequence too long) 1 mg 712-Eur Alpha Dia rat
RK-010-08 Adrenomedullin (AM_ADM)(1_50)(Rat) _ Iodine 125 labeled RIA Kit _ 1.5uCi 125 RIA tubes 909-Eur Phoenix Peptide assays
E3213Hu Human mid-regional pro-adrenomedullin,MR-ProADM ELISA Kit 48T 406-Eur JING Elisa kits
YHB2021Hu Human mid-regional pro-adrenomedullin,MR-ProADM ELISA Kit 48T 395-Eur yehua Elisa kits
H-010-28 Adrenomedullin (1_44) (Human) _ Antibody for Immunohistochemistry _ 100ul 100 µl 628-Eur Phoenix Peptide human
YHB2021Hu Human mid-regional pro-adrenomedullin,MR-ProADM ELISA Kit 96T 629-Eur yehua Elisa kits
SEA220Bo ELISA Kit for Adrenomedullin (ADM) Bos taurus; Bovine (Cattle) 96T 837-Eur USCNLife Elisa kits
CEA220Ca ELISA Kit for Adrenomedullin (ADM) Canis familiaris; Canine (Dog) 96T 803-Eur USCNLife Elisa kits
E90220Po ELISA Kit for Adrenomedullin (ADM) Organism Sus scrofa (Porcine; Pig) 96T 850-Eur USCNLife elisa
A-0804 Adrenomedullin (13-52) (human) 98 percent C200H308N58O59S2 CAS: 154765-05-6 5mg 848-Eur Other suppliers
S-2059.0001 Adrenomedullin (rat) - RIA Kit, Host: Rabbit, CE-marked 1.0kit 1242-Eur Bach
A-0801 Adrenomedullin (human) 98 percent C264H406N80O77S3 CAS: 148498-78-6 5mg 972-Eur Other suppliers
E90220Po ELISA Kit for Adrenomedullin (ADM) Organism: Sus scrofa; Porcine (Pig) 96T 767-Eur USCNLife Elisa kits
E90220Ra ELISA Kit for Adrenomedullin (ADM) Organism: Rattus norvegicus (Rat) 96T 704-Eur USCNLife Elisa kits
G-010-08 Adrenomedullin (AM_ADM)(1_50)(Rat) _ Purified IgG Antibody _ 400ug 400 µg 628-Eur Phoenix Peptide rat
100046 Adrenomedullin (1_50), rat Formula C248H381N77O75S5 Sequence Tyr_Arg_Gln_Ser_Met_Asn_Gln_Gly_Ser_Arg_Ser_Thr_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Met_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr_Asp_Lys_A 1mg 384-Eur GLSChina rat
WBK-010-10 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Rat) _ Western Blot Kit Kit 1031-Eur Phoenix Peptide assays
E90220Mu ELISA Kit for Adrenomedullin (ADM) Organism: Mus musculus (Mouse) 96T 673-Eur USCNLife Elisa kits
100047 Adrenomedullin (11_50) (rat) Formula C194H304N58O59S4 Sequence Ser_Thr_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Met_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr_Asp_Lys_Asp_Lys_Asp_Gly_Met_Ala_Pro_Arg_Asn_Lys 1mg 384-Eur GLSChina rat
100825 Adrenomedullin (1_ 52),porcine Formula C262H403N79O76S3 Sequence Tyr_Arg_Gln_Ser_Met_Asn_Asn_Phe_Gln_Gly_Leu_Arg_Ser_Phe_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Val_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_T 1mg 384-Eur GLSChina porcine
CEA220Hu ELISA Kit for Adrenomedullin (ADM) Homo sapiens (Human) 96T 717-Eur USCNLife Elisa kits
E3214Hu Human mid-regional pro-adrenomedullin,MR-ProADM ELISA Kit 96T 607-Eur JING Elisa kits
H-010-08 Adrenomedullin (AM_ADM)(1_50)(Rat) _ Antibody for Immunohistochemistry _ 50ul 50 µl 628-Eur Phoenix Peptide rat
B-010-08 Adrenomedullin (AM_ADM)(1_50)(Rat) _ Biotin Labeled _ 100ug 100 µg 468-Eur Phoenix Peptide labeled
010-07 Adrenomedullin (AM_ADM) _Pro (153_185)(Human) _ 200ug 200 µg 404-Eur Phoenix Peptide human
010-33 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)[Tyr0](Rat) _ 50ug 50 µg 492-Eur Phoenix Peptide rat
010-12 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Porcine) _ 200ug 200 µg 316-Eur Phoenix Peptide porcine
010-25 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Mouse) _ 200ug 200 µg 316-Eur Phoenix Peptide mouse
010-24 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Canine) _ 200ug 200 µg 316-Eur Phoenix Peptide dog
010-21 Adrenomedullin (AM_ADM)[D_Ala40](34_52)(Human) _ 100ug 100 µg 275-Eur Phoenix Peptide human
010-14 Adrenomedullin (AM_ADM) Ac_(16_21)_Amide (Human) _ 100ug 100 µg 219-Eur Phoenix Peptide human
E3214Hu Human mid-regional pro-adrenomedullin,MR-ProADM ELISA Kit 48T 373-Eur Btlab Elisa kits
bs-0007R-Cy5 Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 303-Eur Bioss
bs-0007R-Cy3 Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 303-Eur Bioss
bs-0007R Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 228-Eur Bioss
H-5122.0010 ([125I]-Tyr)-Adrenomedullin (rat), CE-marked, Liquid 10.0 1361-Eur Bach
H-6866.0010 ([125I]-Tyr)-Adrenomedullin (rat), CE-marked, Lyophilized 10.0 1405-Eur Bach
S-3169.0001 Adrenomedullin (rat) - Immunofluorescence Kit, Host: Rabbit 1.0kit 634-Eur Bach
B-010-09 Adrenomedullin (AM_ADM)(11_50)(Rat) _ Biotin Labeled _ 100ug 100 µg 468-Eur Phoenix Peptide labeled
010-06 Adrenomedullin (AM_ADM) _Pro (45_92)(Human) _ 200ug 100 µg 492-Eur Phoenix Peptide human
bs-0995R Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 383-Eur Bioss
ADML11-S Anti-Human Adrenomedullin (ADM) peptide antiserum 100 ul 538-Eur ADI
ADML11-A Anti-Human Adrenomedullin (ADM) peptide IgG, aff. Pure 100 ug 567-Eur ADI
FG-010-01A Adrenomedullin (AM_ADM)(1_52)(Human) _ FAM Labeled _ 1 nmol 1 nmol 388-Eur Phoenix Peptide labeled
RPA15218 Rabbit anti Adrenomedullin Polyclonal purified 200ug 516-Eur reprokine
SP-100047-1 Adrenomedullin (11_50) (rat) (AA see antigen, sequence too long) 1 mg 712-Eur Alpha Dia rat
SP-100824-5 Adrenomedullin (1_12), human (AA Tyr_Arg_Gln_Ser_Met_Asn_Asn_Phe_Gln_Gly_Leu_Arg) (MW 1513.7) 5 mg 381-Eur Alpha Dia human
bs-0007R-Cy5.5 Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 303-Eur Bioss
SP-100825-1 Adrenomedullin (1_ 52), porcine (AA see antigen, sequence too long) 1 mg 712-Eur Alpha Dia porcine
S-2057.0001 Adrenomedullin (human) _ RIA Kit, Host Rabbit 1kit 1132-Eur Bach polyclonal
S-3169.0001 Adrenomedullin (rat) _ Immunofluorescence Kit, Host Rabbit 1kit 591-Eur Bach polyclonal
ADML11-P Human Adrenomedullin (ADM) Control blocking peptide 100 ug 198-Eur ADI
bs-0007R-HRP Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 303-Eur Bioss
bs-0007R-Cy7 Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 303-Eur Bioss
010-05 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Human) _ 200ug 200 µg 316-Eur Phoenix Peptide human
RPA15218 Rabbit anti Adrenomedullin Polyclonal purified 100ug 383-Eur reprokine
S-3169.0001 Adrenomedullin (rat) _ Immunofluorescence Kit, Host Rabbit 1.0 kit 479-Eur Bach polyclonal
SP-100827-1 Pro-Adrenomedullin N20, human (AA: Ala-Arg-Leu-Asp-Val-Ala-Ala-Glu-Phe-Arg-Lys-Lys-Trp-Asn-Lys-Trp-Ala-Leu-Ser-Arg-NH2) (MW: 2444.9) Species Reactivity: 1 mg Product tipe: Pure Peptide 197-Eur ADI
S-2059.0001 Adrenomedullin (rat) _ RIA Kit, Host Rabbit CE_marked 1.0 kit 1199-Eur Bach polyclonal
H-6866.0010 ([125I]-Tyr)-Adrenomedullin (rat), CE-marked, Lyophilized 794-Eur Bach
S-2059.0001 Adrenomedullin (rat) - RIA Kit, Host RabbitCE-marked 1.0 kit 923-Eur Bach polyclonal
CSB-E09146h Human adrenomedullin 2 (ADM2) ELISA kit SpeciesHuman 96T 931-Eur Cusabio Elisa kits
H-5122.0010 ([125I]-Tyr)-Adrenomedullin (rat)CE-markedLiquid 10.0 1016-Eur Bach rat
H-5122.0010 ([125I]-Tyr)-Adrenomedullin (rat), CE-marked, Liquid 766-Eur Bach
S-3169.0001 Adrenomedullin (rat) - Immunofluorescence Kit, Host Rabbit kit 335-Eur Bach
S-2059.0001 Adrenomedullin (rat) - RIA Kit, Host Rabbit, CE-marked kit 689-Eur Bach
SP-100826-1 Prepro-adrenomedullin (153 - 185), human (AA: Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu) (MW: 3219.6) Species 1 mg Product tipe: Pure Peptide 271-Eur ADI
S-2059.0001 Adrenomedullin (rat) _ RIA Kit, Host RabbitCE_marked 1kit 1178-Eur Bach polyclonal
H-6866.0010 ([125I]-Tyr)-Adrenomedullin (rat)CE-markedLyophilized 10.0 1055-Eur Bach rat
Y050480 Anti-ADMR(adrenomedullin receptor) Antibody 100ug 440-Eur ABM recombinant
SP-100049-1 Adrenomedullin (26-52) (human) (AA: Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2) (MW: 3119.49) Species Reactivity: 1 mg Product tipe: Pure Peptide 271-Eur ADI
SP-100824-5 Adrenomedullin (1-12), human (AA: Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Leu-Arg) (MW: 1513.7) Species Reactivity: 5 mg Product tipe: Pure Peptide 345-Eur ADI
bs-0007R-A488 Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 288-Eur Bioss
ADML15-P Human Adrenomedullin (ADM) Peptide full length (52 aa, 1 disulfide) 100 ug 494-Eur ADI
T-4137.0400 Adrenomedullin (rat) _ Purified Antiserum _ IgG, Host Rabbit 400 845-Eur Bach polyclonal
Y-0183 Peptides: ADM (Adrenomedullin)(22-42) Protein Length:12-25 amino acids. 200ug lyophilized 234-Eur Bios
FG-010-05A Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Human) _ FAM Labeled _ 1 nmol 1 nmol 710-Eur Phoenix Peptide labeled
bs-0007R-A647 Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 288-Eur Bioss
G-010-01 Adrenomedullin (AM_ADM)(1_52)(Human) _ Purified IgG Antibody _ 400ug 400 µg 628-Eur Phoenix Peptide human
bs-0007R-A555 Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 288-Eur Bioss
I-0402 Intermedin (rat) IMD (rat), rIMD, Adrenomedullin-2 (rat), ADM2 (rat) 98 percent C226H361N75O64S2 CAS: 5mg 1014-Eur Other suppliers
H-5124.0010 ([125I]-Tyr)-Adrenomedullin (human)CE-markedLiquid 10.0 1016-Eur Bach human
bs-0007R-FITC Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 288-Eur Bioss
S-2057.0001 Adrenomedullin (human) - RIA Kit, Host RabbitCE-marked 1.0 kit 923-Eur Bach polyclonal
bs-0007R-Biotin Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 288-Eur Bioss
S-3032.0001 Adrenomedullin (human) - Immunofluorescence Kit, Host: Rabbit 1.0kit 634-Eur Bach
010-34 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)[Tyr0](Human) _ 50ug 50 µg 492-Eur Phoenix Peptide human
T-4136.0500 Adrenomedullin (rat) _ Diluted Antiserum for RIA, Host Rabbit 500 tests 773-Eur Bach polyclonal
B-010-01 Adrenomedullin (AM_ADM)(1_52)(Human) _ Biotin Labeled _ 100ug 100 µg 468-Eur Phoenix Peptide labeled
S-1423.0001 Adrenomedullin (rat) _ EIA Kit, Host RabbitHigh Sensitivity 1kit 934-Eur Bach elisa
H-010-31 Adrenomedullin (AM_ADM)(1_50)(Mouse) _ Antibody for Immunohistochemistry _ 50ul 50 µl 628-Eur Phoenix Peptide mouse
T-010-27 Adrenomedullin (AM_ADM)(Canine) _ Iodine 125 Labeled Tracer _ 10uCi 10 µCi 789-Eur Phoenix Peptide labeled
MRK-010-01 Adrenomedullin (AM_ADM)(1_52)(Human) _ Magnetic Bead RIA kit _ 1.5uCi 125 tests 1022-Eur Phoenix Peptide assays
RK-010-01 Adrenomedullin (AM_ADM)(1_52)(Human) _ Iodine 125 labeled RIA Kit _ 1.5uCi 125 RIA tubes 909-Eur Phoenix Peptide assays
RK-010-10 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Rat) _ Iodine 125 labeled RIA Kit _ 1.5uCi 125 RIA tubes 909-Eur Phoenix Peptide assays
SEA220Eq ELISA Kit for Adrenomedullin (ADM) Equus caballus; Equine (Horse) 96T 855-Eur USCNLife Elisa kits
SEG043Hu ELISA Kit for Adrenomedullin Receptor (AMR) Homo sapiens (Human) 96T 784-Eur USCNLife Elisa kits
SEJ675Hu ELISA Kit for Adrenomedullin 2 (ADM2) Homo sapiens (Human) 96T 784-Eur USCNLife Elisa kits
T-010-05 Adrenomedullin N_20, Pro _ PAMP_20 _ Prodepin (Human) I_125 Labeled 10 µCi 789-Eur Phoenix Peptide labeled
T-010-08 Adrenomedullin (AM_ADM)(1_50)(Rat) _ Iodine 125 Labeled Tracer _ 10uCi 10 µCi 789-Eur Phoenix Peptide labeled
Y-0184 Peptides: ADM (Adrenomedullin)(22-52) Protein Length:12-25 amino acids. 200ug lyophilized 234-Eur Bios
S-3032.0001 Adrenomedullin (human) _ Immunofluorescence Kit, Host Rabbit 1.0 kit 479-Eur Bach polyclonal
RK-010-31 Adrenomedullin (AM_ADM)(1_50)(Mouse) _ Iodine 125 labeled RIA Kit _ 1.5uCi 125 RIA tubes 909-Eur Phoenix Peptide assays
G-010-10 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Rat) _ Purified IgG Antibody _ 400ug 400 µg 628-Eur Phoenix Peptide rat
G-010-31 Adrenomedullin (AM_ADM)(1_50)(Mouse) _ Purified IgG Antibody _ 400ug 400 µg 628-Eur Phoenix Peptide mouse
H-010-01 Adrenomedullin (AM_ADM)(1_52)(Human) _ Antibody for Immunohistochemistry _ 50ul 50 µl 628-Eur Phoenix Peptide human
S-2057.0001 Adrenomedullin (human) _ RIA Kit, Host RabbitCE_marked 1kit 1178-Eur Bach polyclonal
SP-100825-1 Adrenomedullin (1- 52), porcine [(AA: see antigen, sequence too long) (MW: 5971.8)] 1 mg 642-Eur ADI
bs-0995R-Cy5 Rabbit Anti-Adrenomedullin Polyclonal Antibody, Cy5 Conjugated 100ul 471-Eur Bioss
bs-0995R-Cy3 Rabbit Anti-Adrenomedullin Polyclonal Antibody, Cy3 Conjugated 100ul 471-Eur Bioss
bs-0995R-Cy7 Rabbit Anti-Adrenomedullin Polyclonal Antibody, Cy7 Conjugated 100ul 471-Eur Bioss
H-010-10 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Rat) _ Antibody for Immunohistochemistry _ 50ul 100 µl 628-Eur Phoenix Peptide rat
bs-0995R-Cy5.5 Rabbit Anti-Adrenomedullin Polyclonal Antibody, Cy5.5 Conjugated 100ul 471-Eur Bioss
S-2057.0001 Adrenomedullin (human) _ RIA Kit, Host Rabbit CE_marked 1.0 kit 1199-Eur Bach polyclonal
bs-0007R-A350 Rabbit Anti-Adrenomedullin Polyclonal Antibody 100ul 288-Eur Bioss
T-4137.0400 Adrenomedullin (rat) - Purified Antiserum - IgG, Host Rabbit 400.0 666-Eur Bach polyclonal
S-1423.0001 Adrenomedullin (rat) - EIA Kit, Host RabbitHigh Sensitivity 1.0 kit 728-Eur Bach elisa
H-6868.0010 ([125I]-Tyr)-Adrenomedullin (human)CE-markedLyophilized 10.0 1055-Eur Bach human
ADML15-P Human Adrenomedullin Peptide full length (52 aa, 1 disulfide) 100 ug 547-Eur Alpha Dia human
010-04 Adrenomedullin (AM_ADM)(22_52)(Human)(ADM Receptor Antagonist) _ 100ug 100 µg 324-Eur Phoenix Peptide recombinant
T-4137.0400 Adrenomedullin (rat) _ Purified Antiserum _ IgG, Host Rabbit 400UG 730-Eur Bach polyclonal
H-5124.0010 ([125I]-Tyr)-Adrenomedullin (human), CE-marked, Liquid 766-Eur Bach
S-2057.0001 Adrenomedullin (human) - RIA Kit, Host Rabbit, CE-marked kit 689-Eur Bach
S-3032.0001 Adrenomedullin (human) - Immunofluorescence Kit, Host Rabbit kit 335-Eur Bach
T-4136.0500 Adrenomedullin (rat) - Diluted Antiserum for RIA, Host Rabbit tests 512-Eur Bach
T-4137.0400 Adrenomedullin (rat) _ Purified Antiserum _ IgG, Host Rabbit 400µg 811-Eur Bach polyclonal
T-4136.0500 Adrenomedullin (rat) _ Diluted Antiserum for RIA, Host Rabbit 500tests 870-Eur Bach polyclonal
E90220Hu ELISA Kit for Adrenomedullin (ADM) Organism Homo sapiens (Human) 96T 728-Eur USCNLife elisa
E90220Ca ELISA Kit for Adrenomedullin (ADM) Organism Canis familiaris; Canine (Dog) 96T 815-Eur USCNLife elisa
S-1423.0001 Adrenomedullin (rat) _ EIA Kit, Host Rabbit High Sensitivity 1.0 kit 945-Eur Bach elisa
E90220Bo ELISA Kit for Adrenomedullin (ADM) Organism Bos taurus; Bovine (Cattle) 96T 850-Eur USCNLife elisa
55426 Adrenomedullin (1_52), human Formula C264H406N80O77S3 Sequence Tyr_Arg_Gln_Ser_Met_Asn_Asn_Phe_Gln_Gly_Leu_Arg_Ser_Phe_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Val_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr 1mg 384-Eur GLSChina human
T-4136.0500 Adrenomedullin (rat) _ Diluted Antiserum for RIA, Host Rabbit 500.0 tests 697-Eur Bach polyclonal
S-3032.0001 Adrenomedullin (human) _ Immunofluorescence Kit, Host Rabbit 1kit 591-Eur Bach polyclonal
55286 Adrenomedullin (22_52),human Formula C159H252N46O48 Sequence Thr_Val_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr_Asp_Lys_Asp_Lys_Asp_Asn_Val_Ala_Pro_Arg_Ser_Lys_Ile_Ser_Pro_Gln_Gly_Tyr_NH2 1mg 232-Eur GLSChina human
100049 Adrenomedullin (26_52) (human) Formula C139H216N40O42 Sequence Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr_Asp_Lys_Asp_Lys_Asp_Asn_Val_Ala_Pro_Arg_Ser_Lys_Ile_Ser_Pro_Gln_Gly_Tyr_NH2 1mg 192-Eur GLSChina human
T-4137.0400 Adrenomedullin (rat) - Purified Antiserum - IgG, Host Rabbit 483-Eur Bach
E90220Bo ELISA Kit for Adrenomedullin (ADM) Organism: Bos taurus; Bovine (Cattle) 96T 767-Eur USCNLife Elisa kits
T-4136.0500 Adrenomedullin (rat) - Diluted Antiserum for RIA, Host: Rabbit 500.0tests 931-Eur Bach
bs-0007P Peptides: AM (Adrenomedullin; ADM) Protein Length:12-25 amino acids. 200ug lyophilized 234-Eur Bios
S-2057.0001 Adrenomedullin (human) - RIA Kit, Host: Rabbit, CE-marked 1.0kit 1242-Eur Bach
S-1423.0001 Adrenomedullin (rat) - EIA Kit, Host: Rabbit, High Sensitivity 1.0kit 975-Eur Bach
E90220Ca ELISA Kit for Adrenomedullin (ADM) Organism: Canis familiaris; Canine (Dog) 96T 735-Eur USCNLife Elisa kits
T-4137.0400 Adrenomedullin (rat) _ Purified Antiserum _ IgG, Host Rabbit 400.0 µg 852-Eur Bach polyclonal
E90220Hu ELISA Kit for Adrenomedullin (ADM) Organism: Homo sapiens (Human) 96T 657-Eur USCNLife Elisa kits
S-1423.0001 Adrenomedullin (rat) - EIA Kit, Host Rabbit, High Sensitivity kit 536-Eur Bach
T-4137.0400 Adrenomedullin (rat) - Purified Antiserum - IgG, Host: Rabbit 400.0 886-Eur Bach
H-5124.0010 ([125I]-Tyr)-Adrenomedullin (human), CE-marked, Liquid 10.0 1361-Eur Bach
H-6868.0010 ([125I]-Tyr)-Adrenomedullin (human), CE-marked, Lyophilized 794-Eur Bach
H-6868.0010 ([125I]-Tyr)-Adrenomedullin (human), CE-marked, Lyophilized 10.0 1405-Eur Bach
H-010-05 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Human) _ Antibody for Immunohistochemistry _ 50ul 50 µl 628-Eur Phoenix Peptide human
T-4129.0500 Adrenomedullin (human) _ Diluted Antiserum for RIA, Host Rabbit 500tests 870-Eur Bach polyclonal
T-010-31 Adrenomedullin (AM_ADM)(1_50)(Mouse) _ Iodine 125 Labeled Tracer _ 10uCi 10 µCi 789-Eur Phoenix Peptide labeled
'GTX18092 Adrenomedullin (ADM) Clone 'HTA171_E8 antibody Isotype IgM Host Mouse 0.1 mg 533-Eur ACR
bs-0007R-A594 Adrenomedullin Polyclonal Antibody, ALEXA FLUOR 594 Conjugated 100ul 185-Eur Bioss
T-010-01 Adrenomedullin (AM_ADM)(1_52)(Human) _ Iodine 125 Labeled Tracer _ 10uCi 10 µCi 789-Eur Phoenix Peptide labeled
SP-100048-1 Adrenomedullin (16-31) (human, pig) (AA: Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-NH2 (Disulfide bridge:Cys1-Cys6) (MW: 1865.21) 1 mg 346-Eur ADI
bs-0995R-A594 Adrenomedullin Polyclonal Antibody, ALEXA FLUOR 594 Conjugated 100ul 185-Eur Bioss
S-1390.0001 Adrenomedullin 5 (primate) _ EIA Kit, Host Rabbit, High Sensitivity 1kit 968-Eur Bach elisa
RK-010-05 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Human) _ Iodine 125 labeled RIA Kit _ 1.5uCi 125 RIA tubes 909-Eur Phoenix Peptide assays
RK-010-24 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Canine) _ Iodine 125 labeled RIA Kit _ 1.5uCi 125 RIA tubes 909-Eur Phoenix Peptide assays
T-4138.0050 Adrenomedullin (rat) - Undiluted Antiserum for Immunohistochemistry, Host Rabbit 50.0 386-Eur Bach polyclonal
RK-010-07 Adrenomedullin (AM_ADM) _Pro (153_185)(Human) _ Iodine 125 labeled RIA Kit _ 1.5uCi 125 RIA tubes 909-Eur Phoenix Peptide assays
'GTX18092 Adrenomedullin (ADM) Clone 'HTA171 E8 antibody Isotype IgM Host Mouse 0.1 mg 533-Eur ACR
RK-010-06 Adrenomedullin (AM_ADM) _Pro (45_92)(Human) _ Iodine 125 labeled RIA Kit _ 1.5uCi 125 RIA tubes 909-Eur Phoenix Peptide assays
T-4130.0400 Adrenomedullin (human) _ Purified Antiserum _ IgG, Host Rabbit 400µg 811-Eur Bach polyclonal
T-4130.0400 Adrenomedullin (human) - Purified Antiserum - IgG, Host Rabbit 400.0 666-Eur Bach polyclonal
010-26 Adrenomedullin (AM_ADM) _Pro_N_12 (PAMP_12)(Human, Rat, Mouse, Porcine) _ 200ug 200 µg 284-Eur Phoenix Peptide human
G-010-07 Adrenomedullin (AM_ADM) _Pro (153_185)(Human) _ Purified IgG Antibody _ 400ug 400 µg 628-Eur Phoenix Peptide human
G-010-06 Adrenomedullin (AM_ADM) _Pro (45_92)(Human) _ Purified IgG Antibody _ 400ug 400 µg 628-Eur Phoenix Peptide human
T-4129.0500 Adrenomedullin (human) - Diluted Antiserum for RIA, Host Rabbit tests 512-Eur Bach
T-4130.0400 Adrenomedullin (human) _ Purified Antiserum _ IgG, Host Rabbit 400 845-Eur Bach polyclonal
G-010-05 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Human) _ Purified IgG Antibody _ 400ug 400 µg 628-Eur Phoenix Peptide human
T-4130.0400 Adrenomedullin (human) - Purified Antiserum - IgG, Host Rabbit 483-Eur Bach
T-4138.0050 Adrenomedullin (rat) - Undiluted Antiserum for Immunohistochemistry, Host: Rabbit 50.0 486-Eur Bach
T-4138.0050 Adrenomedullin (rat) _ Undiluted Antiserum for Immunohistochemistry, Host Rabbit 50 480-Eur Bach polyclonal
G-010-24 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Canine) _ Purified IgG Antibody _ 400ug 400 µg 628-Eur Phoenix Peptide dog
T-4130.0400 Adrenomedullin (human) - Purified Antiserum - IgG, Host: Rabbit 400.0 886-Eur Bach
B-010-06 Adrenomedullin (AM_ADM) _Pro (45_92)(Human) _ Biotin Labeled _ 20ug 20 µg 67-Eur Phoenix Peptide labeled
H-010-24 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Canine) _ Antibody for Immunohistochemistry _ 50ul 50 µl 628-Eur Phoenix Peptide dog
T-4138.0050 Adrenomedullin (rat) _ Undiluted Antiserum for Immunohistochemistry, Host Rabbit 50µl 464-Eur Bach polyclonal
CSB-EL001370DO Dog adrenomedullin,ADM ELISA Kit, Species Dog, Sample Type serum, plasma 96T 1119-Eur Cusabio elisa
H-010-07 Adrenomedullin (AM_ADM) _Pro (153_185)(Human) _ Antibody for Immunohistochemistry _ 50ul 50 µl 628-Eur Phoenix Peptide human
CSB-EL001370PI Pig adrenomedullin (ADM) ELISA kit, Species Pig, Sample Type serum, plasma 96T 1041-Eur Cusabio elisa
CSB-EL001370RA Rat adrenomedullin,ADM ELISA Kit, Species Rat, Sample Type serum, plasma 96T 1119-Eur Cusabio elisa
T-4129.0500 Adrenomedullin (human) - Diluted Antiserum for RIA, Host: Rabbit 500.0tests 931-Eur Bach
H-010-06 Adrenomedullin (AM_ADM) _Pro (45_92)(Human) _ Antibody for Immunohistochemistry _ 50ul 50 µl 628-Eur Phoenix Peptide human
SP-100046-1 Adrenomedullin (1-50), rat (YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2; Disulfide bridge:Cys14-Cys19 ) (MW: 5729.5) 1 mg 642-Eur ADI
T-4138.0050 Adrenomedullin (rat) - Undiluted Antiserum for Immunohistochemistry, Host Rabbit 258-Eur Bach
55425 Adrenomedullin (13_52),human Formula C200H308N58O59S2 Sequence Ser_Phe_Gly_Cys_Arg_Phe_Gly_Thr_Cys_Thr_Val_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_Gln_Phe_Thr_Asp_Lys_Asp_Lys_Asp_ Asn_Val_Ala_Pro_Arg_Ser_Ly 1mg 384-Eur GLSChina human
100824 Adrenomedullin (1_12), human Formula C64H100N22O19S1 Sequence Tyr_Arg_Gln_Ser_Met_Asn_Asn_Phe_Gln_Gly_Leu_Arg 5mg 223-Eur GLSChina human
P90220Ra01 Adrenomedullin (ADM) Organism: Rattus norvegicus (Rat) Source: Escherichia coli 100ug ----Eur USCNLife
bs-0090P Peptides: ADM R, Adrenomedullin receptor Protein Length:12-25 amino acids. 200ug lyophilized 234-Eur Bios
E90220Eq ELISA Kit for Adrenomedullin (ADM) Organism Equus caballus; Equine (Horse) 96T 867-Eur USCNLife elisa
P90220Ra02 Adrenomedullin (ADM) Organism: Rattus norvegicus (Rat) Source: Escherichia coli 50ug ----Eur USCNLife
E96043Hu ELISA Kit for Adrenomedullin Receptor (AMR) Organism Homo sapiens (Human) 96T 728-Eur USCNLife elisa
P90220Ra01 Adrenomedullin (ADM) Organism: Rattus norvegicus (Rat) Source: Escherichia coli 10ug ----Eur USCNLife
P90220Ra01 Adrenomedullin (ADM) Organism: Rattus norvegicus (Rat) Source: Escherichia coli 50ug ----Eur USCNLife
T-4138.0050 Adrenomedullin (rat) _ Undiluted Antiserum for Immunohistochemistry, Host Rabbit 50.0 µl 472-Eur Bach polyclonal
P90220Ra02 Adrenomedullin (ADM) Organism: Rattus norvegicus (Rat) Source: Escherichia coli 10ug ----Eur USCNLife
T-4129.0500 Adrenomedullin (human) _ Diluted Antiserum for RIA, Host Rabbit 500 tests 773-Eur Bach polyclonal
T-4130.0400 Adrenomedullin (human) _ Purified Antiserum _ IgG, Host Rabbit 400UG 730-Eur Bach polyclonal
T-4129.0500 Adrenomedullin (human) _ Diluted Antiserum for RIA, Host Rabbit 500.0 tests 697-Eur Bach polyclonal
T-4130.0400 Adrenomedullin (human) _ Purified Antiserum _ IgG, Host Rabbit 400.0 µg 852-Eur Bach polyclonal
E96043Hu ELISA Kit for Adrenomedullin Receptor (AMR) Organism: Homo sapiens (Human) 96T 718-Eur USCNLife Elisa kits
E90220Eq ELISA Kit for Adrenomedullin (ADM) Organism: Equus caballus; Equine (Horse) 96T 782-Eur USCNLife Elisa kits
T-4138.0050 Adrenomedullin (rat) _ Undiluted Antiserum for Immunohistochemistry, Host Rabbit 50 UL 407-Eur Bach polyclonal
Y-0133 Peptides: ADM 1-52_AM 1-52 (Adrenomedullin 1-52) Protein Length:12-25 amino acids. 200ug lyophilized 234-Eur Bios
P90220Ra02 Adrenomedullin (ADM) Organism: Rattus norvegicus (Rat) Source: Escherichia coli 100ug ----Eur USCNLife
T-G-010-08 Adrenomedullin (AM_ADM)(1_50)(Rat) _ Iodine 125 Labeled Purified IgG Tracer _ 10uCi 10 µCi 950-Eur Phoenix Peptide labeled
S-1409.0001 Adrenomedullin (human) _ EIA Kit, Host Rabbit High Sensitivity 1.0 kit 945-Eur Bach elisa
T-4131.0050 Adrenomedullin (human) _ Undiluted Antiserum for Immunohistochemistry, Host Rabbit 50µl 464-Eur Bach polyclonal
CSB-EL001371RA Rat adrenomedullin 2 (ADM2) ELISA kit, Species Rat, Sample Type serum, plasma 96T 1041-Eur Cusabio elisa
P90220Bo01 Adrenomedullin (ADM) Organism: Bos taurus; Bovine (Cattle) Source: Escherichia coli 50ug ----Eur USCNLife
P90220Ca01 Adrenomedullin (ADM) Organism: Canis familiaris; Canine (Dog) Source: Escherichia coli 10ug ----Eur USCNLife
P90220Bo01 Adrenomedullin (ADM) Organism: Bos taurus; Bovine (Cattle) Source: Escherichia coli 10ug ----Eur USCNLife
S-1409.0001 Adrenomedullin (human) - EIA Kit, Host: Rabbit, High Sensitivity, CE-marked 1.0kit 975-Eur Bach
T-4131.0050 Adrenomedullin (human) _ Undiluted Antiserum for Immunohistochemistry, Host Rabbit 50 480-Eur Bach polyclonal
S-1409.0001 Adrenomedullin (human) - EIA Kit, Host RabbitHigh SensitivityCE-marked 1.0 kit 728-Eur Bach elisa
bs-0995P Peptides: ADM (Adrenomedullin)ProAM-N20 Rat, human, mo, pig, dog, bov Protein Length:12-25 amino acids. 200ug lyophilized 234-Eur Bios
P90220Hu01 Adrenomedullin (ADM) Organism: Homo sapiens (Human) Source: Escherichia coli 100ug 1030-Eur USCNLife
P90220Hu01 Adrenomedullin (ADM) Organism: Homo sapiens (Human) Source: Escherichia coli 50ug 725-Eur USCNLife
S-1390.0001 Adrenomedullin 5 (primate) - EIA Kit, Host: Rabbit, High Sensitivity, CE-marked 1.0kit 1049-Eur Bach
P90220Hu01 Adrenomedullin (ADM) Organism: Homo sapiens (Human) Source: Escherichia coli 10ug 419-Eur USCNLife
S-1390.0001 Adrenomedullin 5 (primate) - EIA Kit, Host RabbitHigh SensitivityCE-marked 1.0 kit 791-Eur Bach elisa
S-1390.0001 Adrenomedullin 5 (primate) - EIA Kit, Host Rabbit, High Sensitivity, CE-marked kit 584-Eur Bach
ADM5_HUMAN ELISA Kit FOR Putative adrenomedullin-5-like protein; organism: Human; gene name: ADM5 96T 956-Eur EIAab Elisa kits
T-4131.0050 Adrenomedullin (human) - Undiluted Antiserum for Immunohistochemistry, Host Rabbit 50.0 386-Eur Bach polyclonal
P90220Bo01 Adrenomedullin (ADM) Organism: Bos taurus; Bovine (Cattle) Source: Escherichia coli 100ug ----Eur USCNLife
P90220Ca01 Adrenomedullin (ADM) Organism: Canis familiaris; Canine (Dog) Source: Escherichia coli 100ug ----Eur USCNLife
P90220Ca01 Adrenomedullin (ADM) Organism: Canis familiaris; Canine (Dog) Source: Escherichia coli 50ug ----Eur USCNLife
T-4131.0050 Adrenomedullin (human) _ Undiluted Antiserum for Immunohistochemistry, Host Rabbit 50 UL 407-Eur Bach polyclonal
T-4131.0050 Adrenomedullin (human) - Undiluted Antiserum for Immunohistochemistry, Host: Rabbit 50.0 486-Eur Bach
T-010-33 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)[Tyr0](Rat) _ Iodine 125 Labeled Tracer _ 10uCi 10 µCi 789-Eur Phoenix Peptide labeled
S-1409.0001 Adrenomedullin (human) - EIA Kit, Host Rabbit, High Sensitivity, CE-marked kit 536-Eur Bach
S-1409.0001 Adrenomedullin (human) _ EIA Kit, Host RabbitHigh SensitivityCE_marked 1kit 934-Eur Bach elisa
T-G-010-31 Adrenomedullin (AM_ADM)(1_50)(Mouse) _ Iodine 125 Labeled Purified IgG Tracer _ 10uCi 10 µCi 950-Eur Phoenix Peptide labeled
T-G-010-10 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Rat) _ Iodine 125 Labeled Purified IgG Tracer _ 10uCi 10 µCi 950-Eur Phoenix Peptide labeled
S-1390.0001 Adrenomedullin 5 (primate) _ EIA Kit, Host Rabbit High Sensitivity CE_marked 1.0 kit 1021-Eur Bach elisa
T-4131.0050 Adrenomedullin (human) - Undiluted Antiserum for Immunohistochemistry, Host Rabbit 258-Eur Bach
T-010-07 Adrenomedullin (AM_ADM) _Pro (153_185)(Human) _ Iodine 125 Labeled Tracer _ 10uCi 10 µCi 789-Eur Phoenix Peptide labeled
S-1390.0001 Adrenomedullin 5 (primate) _ EIA Kit, Host RabbitHigh SensitivityCE_marked 1kit 1007-Eur Bach elisa
T-010-06 Adrenomedullin (AM_ADM) _Pro (45_92)(Human) _ Iodine 125 Labeled Tracer _ 10uCi 10 µCi 789-Eur Phoenix Peptide labeled
SP-100825-1 Adrenomedullin (1- 52), porcine [(AA: see antigen, sequence too long) (MW: 5971.8)] Species Reactivity: 1 mg Product tipe: Pure Peptide 642-Eur ADI
SP-100048-1 Adrenomedullin (16_31) (human, pig) (AA Cys_Arg_Phe_Gly_Thr_Cys_Thr_Val_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_NH2 (Disulfide bridge Cys1_Cys6) (MW 1865.21) 1 mg 381-Eur Alpha Dia human
T-G-010-01 Adrenomedullin (AM_ADM)(1_52)(Human) _ Iodine 125 Labeled Purified IgG Tracer _ 10uCi 10 µCi 950-Eur Phoenix Peptide labeled
T-4131.0050 Adrenomedullin (human) _ Undiluted Antiserum for Immunohistochemistry, Host Rabbit 50.0 µl 472-Eur Bach polyclonal
bs-0995R-A647 Rabbit Anti-Adrenomedullin Polyclonal Antibody, ALEXA FLUOR 647 Conjugated 100ul 501-Eur Bioss
T-G-010-24 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Canine) _ Iodine 125 Labeled Purified IgG Tracer _ 10uCi 10 µCi 950-Eur Phoenix Peptide labeled
bs-0995R-A555 Rabbit Anti-Adrenomedullin Polyclonal Antibody, ALEXA FLUOR 555 Conjugated 100ul 501-Eur Bioss
SP-100048-1 Adrenomedullin (16-31) (human, pig) (AA: Cys-Arg-Phe-Gly-Thr-Cys-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-NH2 (Disulfide bridge:Cys1-Cys6) (MW: 1865.21) Species Reactivity: 1 mg Product tipe: Pure Peptide 345-Eur ADI
T-010-34 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)[Tyr0](Human) _ Iodine 125 Labeled Tracer _ 10uCi 10 µCi 789-Eur Phoenix Peptide labeled
SP-100046-1 Adrenomedullin (1-50), rat (YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2; Disulfide bridge:Cys14-Cys19 ) (MW: 5729.5) Species Reactivity: 1 mg Product tipe: Pure Peptide 642-Eur ADI
A90220Ra01 Antibody to Adrenomedullin (ADM) Organism: Rattus norvegicus (Rat) Type: Polyclonal Source: Rabbit 50ug 373-Eur USCNLife
11701-05011 Adrenomedullin, anti_rat Species Rat Format IgG Host Rabbit Polyclonal antibody 150 ug 178-Eur Assaypro polyclonal
T-G-010-05 Adrenomedullin (AM_ADM) _Pro_N_20 (PAMP_20)(Human) _ Iodine 125 Labeled Purified IgG Tracer _ 10uCi 10 µCi 950-Eur Phoenix Peptide labeled
H-2934.0500 Adrenomedullin (rat) Salt Trifluoroacetate Binding (Disulfide_bond) Synonym SumFormula C242H381N77O75S5 0.5 mg 600-Eur Bach rat
A90220Ra01 Antibody to Adrenomedullin (ADM) Organism: Rattus norvegicus (Rat) Type: Polyclonal Source: Rabbit 100ug 485-Eur USCNLife
T-G-010-06 Adrenomedullin (AM_ADM) _Pro (45_92)(Human) _ Iodine 125 Labeled Purified IgG Tracer _ 10uCi 10 µCi 950-Eur Phoenix Peptide labeled
T-G-010-07 Adrenomedullin (AM_ADM) _Pro (153_185)(Human) _ Iodine 125 Labeled Purified IgG Tracer _ 10uCi 10 µCi 950-Eur Phoenix Peptide labeled
H-2932.0500 Adrenomedullin (human) Salt _ Binding (Disulfide_bond) Synonym SumFormula C264H406N80O77S3 0.5 mg 600-Eur Bach human
H-5694.1000 Adrenomedullin (11_50) (rat) Salt _ Binding (Disulfide_bond) Synonym SumFormula C194H304N58O59S4 1.0 mg 898-Eur Bach rat
H-2932.1000 Adrenomedullin (human) Salt _ Binding (Disulfide_bond) Synonym SumFormula C264H406N80O77S3 1.0 mg 984-Eur Bach human
H-5694.0500 Adrenomedullin (11_50) (rat) Salt _ Binding (Disulfide_bond) Synonym SumFormula C194H304N58O59S4 0.5 mg 524-Eur Bach rat
bs-0995R-A488 Rabbit Anti-Adrenomedullin Polyclonal Antibody, ALEXA FLUOR 488 Conjugated 100ul 501-Eur Bioss
H-4138.1000 Adrenomedullin (26_52) (human) Salt _ Binding _ Synonym SumFormula C139H216N40O42 1.0 mg 426-Eur Bach human
bs-0995R-A350 Rabbit Anti-Adrenomedullin Polyclonal Antibody, ALEXA FLUOR 350 Conjugated 100ul 501-Eur Bioss
H-4138.0500 Adrenomedullin (26_52) (human) Salt _ Binding _ Synonym SumFormula C139H216N40O42 0.5 mg 275-Eur Bach human
11701-05015 Adrenomedullin, anti_rat Species Rat Format IgG Host Rabbit Polyclonal antibody 400 ug 288-Eur Assaypro polyclonal
H-2934.1000 Adrenomedullin (rat) Salt Trifluoroacetate Binding (Disulfide_bond) Synonym SumFormula C242H381N77O75S5 1.0 mg 984-Eur Bach rat
11701-05025 Adrenomedullin, anti_rat Species Rat Format Biotin_IgG Host Rabbit Polyclonal antibody 400 ug 321-Eur Assaypro polyclonal
A90220Hu22 Antibody to Adrenomedullin (ADM) Organism: Homo sapiens (Human) Type: Monoclonal Source: Mouse 200ug 376-Eur USCNLife
11701-05021 Adrenomedullin, anti_rat Species Rat Format Biotin_IgG Host Rabbit Polyclonal antibody 150 ug 200-Eur Assaypro polyclonal
100048 Adrenomedullin (16_31) (human, pig) Formula C82H129N25O21S2 Sequence Cys_Arg_Phe_Gly_Thr_Cys_Thr_Val_Gln_Lys_Leu_Ala_His_Gln_Ile_Tyr_NH2 (Disulfide bridge Cys1_Cys6) 1mg 262-Eur GLSChina human
A90220Ca01 Antibody to Adrenomedullin (ADM) Organism: Canis familiaris; Canine (Dog) Type: Polyclonal Source: Rabbit 50ug 387-Eur USCNLife
A90220Hu01 Antibody to Adrenomedullin (ADM) Organism: Homo sapiens (Human) Type: Polyclonal Source: Rabbit 50ug 353-Eur USCNLife
A90220Hu01 Antibody to Adrenomedullin (ADM) Organism: Homo sapiens (Human) Type: Polyclonal Source: Rabbit 100ug 456-Eur USCNLife
10371-05015 Adrenomedullin, anti_human Species Human Format IgG Host Rabbit Polyclonal antibody 400 ug 288-Eur Assaypro polyclonal
H-4144.1000 Adrenomedullin (22_52) (human) Salt Trifluoroacetate Binding _ Synonym SumFormula C159H252N46O48 1.0 mg 587-Eur Bach human
H-4064.0001 Adrenomedullin (16_31) (human, pig) Salt _ Binding (Disulfide_bond) Synonym SumFormula C82H129N25O21S2 1.0 mg 449-Eur Bach human
H-4064.0005 Adrenomedullin (16_31) (human, pig) Salt _ Binding (Disulfide_bond) Synonym SumFormula C82H129N25O21S2 5.0 mg 1719-Eur Bach human
H-4936.0500 Adrenomedullin (13_52) (human) Salt _ Binding (Disulfide_bond) Synonym SumFormula C200H308N58O59S2 0.5 mg 524-Eur Bach human
A90220Hu22 Antibody to Adrenomedullin (ADM) Organism: Homo sapiens (Human) Type: Monoclonal Source: Mouse 500ug 639-Eur USCNLife
10371-05011 Adrenomedullin, anti_human Species Human Format IgG Host Rabbit Polyclonal antibody 150 ug 178-Eur Assaypro polyclonal
A90220Bo01 Antibody to Adrenomedullin (ADM) Organism: Bos taurus; Bovine (Cattle) Type: Polyclonal Source: Rabbit 100ug 525-Eur USCNLife
A90220Ca01 Antibody to Adrenomedullin (ADM) Organism: Canis familiaris; Canine (Dog) Type: Polyclonal Source: Rabbit 100ug 505-Eur USCNLife
A90220Bo01 Antibody to Adrenomedullin (ADM) Organism: Bos taurus; Bovine (Cattle) Type: Polyclonal Source: Rabbit 50ug 402-Eur USCNLife
H-4144.0500 Adrenomedullin (22_52) (human) Salt Trifluoroacetate Binding _ Synonym SumFormula C159H252N46O48 0.5 mg 338-Eur Bach human
H-4936.1000 Adrenomedullin (13_52) (human) Salt _ Binding (Disulfide_bond) Synonym SumFormula C200H308N58O59S2 1.0 mg 898-Eur Bach human
10371-05025 Adrenomedullin, anti_human Species Human Format Biotin_IgG Host Rabbit Polyclonal antibody 400 ug 321-Eur Assaypro polyclonal
10371-05021 Adrenomedullin, anti_human Species Human Format Biotin_IgG Host Rabbit Polyclonal antibody 150 ug 200-Eur Assaypro polyclonal
A90220Ra01-B Biotin-linked Antibody to Adrenomedullin (ADM); Reactivity: Rattus norvegicus (Rat) Clonality: Polyclonal Source: Rabbit 50ug 453-Eur USCNLife
A90220Bo01-B Biotin-linked Antibody to Adrenomedullin (ADM); Reactivity: Bos taurus; Bovine (Cattle) Clonality: Polyclonal Source: Rabbit 50ug 425-Eur USCNLife
A90220Ca01-B Biotin-linked Antibody to Adrenomedullin (ADM); Reactivity: Canis familiaris; Canine (Dog) Clonality: Polyclonal Source: Rabbit 50ug 425-Eur USCNLife
A90220Hu01-B Biotin-linked Antibody to Adrenomedullin (ADM); Reactivity: Homo sapiens (Human) Clonality: Polyclonal Source: Rabbit 50ug 491-Eur USCNLife
A90220Hu22-B Biotin-linked Antibody to Adrenomedullin (ADM); Reactivity: Homo sapiens (Human) Clonality: Monoclonal Source: Mouse 50ug 455-Eur USCNLife
ADML11-A Anti-Human Adrenomedullin (ADM) peptide IgG, aff. Pure Species Reactivity: Human 100 ug Product tipe: Antibodies 538-Eur ADI
orb15060 Adrenomedullin Receptor antibody (FITC) Polyclonal Antibody Host: Rabbit 100ug 297-Eur Biorb
orb13791 Adrenomedullin Receptor antibody (FITC) Polyclonal Antibody Host: Rabbit 100ug 297-Eur Biorb
bs-0995R-Biotin Rabbit Anti-Adrenomedullin Polyclonal Antibody, Biotin Conjugated 100ul 471-Eur Bioss
bs-0995R-FITC Rabbit Anti-Adrenomedullin Polyclonal Antibody, FITC Conjugated 100ul 471-Eur Bioss
orb15060 Adrenomedullin Receptor antibody (FITC) Polyclonal Antibodies Primary antibodies 100 395-Eur Biorb
orb13791 Adrenomedullin Receptor antibody (FITC) Polyclonal Antibodies Primary antibodies 100 395-Eur Biorb
ADML11-S Anti-Human Adrenomedullin (ADM) peptide antiserum Species Reactivity: Human 100 ul Product tipe: Antiserum 494-Eur ADI
orb15058 Adrenomedullin antibody (FITC) Polyclonal Antibodies Primary antibodies 100 395-Eur Biorb
orb15059 Adrenomedullin Pro N20 antibody (FITC) Polyclonal Antibodies Primary antibodies 100 395-Eur Biorb
orb15058 Adrenomedullin antibody (FITC) Polyclonal Antibody Host: Rabbit 100ug 297-Eur Biorb
orb15059 Adrenomedullin Pro N20 antibody (FITC) Polyclonal Antibody Host: Rabbit 100ug 297-Eur Biorb
orb10051 Adrenomedullin Receptor antibody Polyclonal Antibody Host: Rabbit 100ug 312-Eur Biorb
orb10051 Adrenomedullin Receptor antibody Polyclonal Antibody Host: Rabbit 200ug 404-Eur Biorb
orb10051 Adrenomedullin Receptor antibody Polyclonal Antibodies Primary antibodies 100 327-Eur Biorb
ADML11-P Human Adrenomedullin (ADM) Control_blocking peptide Species Reactivity: Human 100 ug Product tipe: Peptide 197-Eur ADI
ADML15-P Human Adrenomedullin (ADM) Peptide full length (52 aa, 1 disulfide) Species Reactivity: Human 100 ug Product tipe: Peptide 494-Eur ADI
CSB-E09837Rb Rabbit adrenomedullin,ADM ELISA Kit, Species Rabbit, Sample Type serum, plasma 96T 1119-Eur Cusabio elisa
CSB-EL001370MO Mouse adrenomedullin,ADM ELISA Kit, Species Mouse, Sample Type serum, plasma 96T 1094-Eur Cusabio elisa
CSB-E09838Mo Monkey adrenomedullin,ADM ELISA Kit, Species Monkey, Sample Type serum, plasma 96T 1119-Eur Cusabio elisa
CSB-EL001370HU Human adrenomedullin,ADM ELISA Kit, Species Human, Sample Type serum, plasma 96T 1041-Eur Cusabio elisa
CSB-E04843Ch Chicken adrenomedullin,ADM ELISA Kit, Species Chicken, Sample Type serum, plasma 96T 1119-Eur Cusabio elisa
CSB-EL001370BO Bovine adrenomedullin (ADM) ELISA kit, Species Bovine, Sample Type serum, plasma 96T 1041-Eur Cusabio elisa
CSB-EL001371MO Mouse adrenomedullin 2 (ADM2) ELISA kit, Species Mouse, Sample Type serum, plasma 96T 1041-Eur Cusabio elisa
YF-MA17711 Mouse monoclonal to Adrenomedullin Receptor L1 , Isotype IgG2a, Host Mouse, Clone 3B10 100 ug 434-Eur Abfron
orb10050 Adrenomedullin Pro N20 antibody Polyclonal Antibodies Primary antibodies 100 327-Eur Biorb
SP-55286-1 Adrenomedullin (22-52), Human [H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2; MW: 3576.06] Species Reactivity: Human 0.5 mg Product tipe: Pure Peptide 412-Eur ADI
orb10050 Adrenomedullin Pro N20 antibody Polyclonal Antibody Host: Rabbit 200ug 404-Eur Biorb
orb10049 Adrenomedullin antibody Polyclonal Antibody Host: Rabbit 100ug 312-Eur Biorb
orb10049 Adrenomedullin antibody Polyclonal Antibodies Primary antibodies 100 327-Eur Biorb
IRAPKT2045-1 Kit (96 Wells) Human Adrenomedullin N-20, Pro_PAMP-20 Prodepin EIA Kit 1 Kit (96 Wells) 805-Eur Innovative
orb10049 Adrenomedullin antibody Polyclonal Antibody Host: Rabbit 200ug 404-Eur Biorb
orb10050 Adrenomedullin Pro N20 antibody Polyclonal Antibody Host: Rabbit 100ug 312-Eur Biorb
H-6612.0500 Adrenomedullin 5 (primate) Salt Trifluoroacetate Binding (Disulfide_bond) Synonym AM5 (primate) SumFormula C253H394N82O71S2 0.5 mg 773-Eur Bach
H-6612.1000 Adrenomedullin 5 (primate) Salt Trifluoroacetate Binding (Disulfide_bond) Synonym AM5 (primate) SumFormula C253H394N82O71S2 1.0 mg 1395-Eur Bach
A-0808 Adrenomedullin 5 (primate) AM5 (primate) 98 percent C253H394N82O71S2 CAS: 5mg 779-Eur Other suppliers
A90220Hu22-F FITC-linked Antibody to Adrenomedullin (ADM) Clonality: Polyclonal Source: Rabbit ReactivityHomo sapiens (Human) Conjugate: FITC 50ug 433-Eur USCNLife
A90220Hu01-F FITC-linked Antibody to Adrenomedullin (ADM) Clonality: Polyclonal Source: Rabbit ReactivityHomo sapiens (Human) Conjugate: FITC 50ug 504-Eur USCNLife
DL-ADM2-Hu Human Adrenomedullin 2 (ADM2) ELISA Kit 96T 954-Eur Yukichj Elisa kits
25-752 CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G prote 0.05 mg 721-Eur Prosci recombinant
S-1409.0001 Adrenomedullin (human) _ EIA Kit, Host Rabbit, High Sensitivity Host Rabbit Kit 809-Eur Bach elisa
I-0401 Intermedin (human) hIMD, IMD (human), Adrenomedullin-2 (human), ADM2 (human) 98 percent C219H349N69O66S3 CAS: 5mg 1014-Eur Other suppliers
S-3032.0001 Adrenomedullin (human) _ Immunofluorescence Kit, Host Rabbit Host Rabbit Kit 522-Eur Bach polyclonal
S-1423.0001 Adrenomedullin (rat) _ EIA Kit, Host Rabbit, High Sensitivity Host Rabbit Kit 809-Eur Bach elisa
S-3169.0001 Adrenomedullin (rat) _ Immunofluorescence Kit, Host Rabbit Host Rabbit Kit 522-Eur Bach polyclonal
S-2057.0001 Adrenomedullin (human) _ RIA Kit, Host Rabbit Host Rabbit 125 tests 1025-Eur Bach polyclonal
S-2059.0001 Adrenomedullin (rat) _ RIA Kit, Host Rabbit Host Rabbit 125 tests 1025-Eur Bach polyclonal
Catalog-Num Product Name Quantity Price Supplier