GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Multiubiquitin chain-binding protein)

 PSMD4_MOUSE             Reviewed;         376 AA.
O35226; Q91V59; Q9JJM0; Q9JJM1; Q9JJM2; Q9JJM3;
15-DEC-1998, integrated into UniProtKB/Swiss-Prot.
01-JAN-1998, sequence version 1.
29-SEP-2021, entry version 177.
RecName: Full=26S proteasome non-ATPase regulatory subunit 4;
AltName: Full=26S proteasome regulatory subunit RPN10;
AltName: Full=26S proteasome regulatory subunit S5A;
AltName: Full=Multiubiquitin chain-binding protein;
Name=Psmd4; Synonyms=Mcb1;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA].
PubMed=9511739; DOI=10.1016/s0378-1119(97)00599-4;
Pusch W., Jaehner D., Ivell R.;
"Molecular cloning and testicular expression of the gene transcripts
encoding the murine multiubiquitin-chain-binding protein (Mcb1).";
Gene 207:19-24(1998).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA], AND ALTERNATIVE SPLICING.
STRAIN=129/SvJ; TISSUE=Embryo, and Testis;
PubMed=10921894; DOI=10.1093/emboj/19.15.4144;
Kawahara H., Kasahara M., Nishiyama A., Ohsumi K., Goto T., Kishimoto T.,
Saeki Y., Yokosawa H., Shimbara N., Murata S., Chiba T., Suzuki K.,
Tanaka K.;
"Developmentally regulated, alternative splicing of the Rpn10 gene
generates multiple forms of 26S proteasomes.";
EMBO J. 19:4144-4153(2000).
[3]
NUCLEOTIDE SEQUENCE (ISOFORM RPN10B).
Masumoto H., Lee H.-J., Tomioka M., Saido T.C.;
"Molecular cloning of a multiubiquitin chain binding subunit of mouse 26S
proteasome.";
Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM RPN10B).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-250, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Embryonic brain;
PubMed=15345747; DOI=10.1074/mcp.m400085-mcp200;
Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P.;
"Phosphoproteomic analysis of the developing mouse brain.";
Mol. Cell. Proteomics 3:1093-1101(2004).
[6]
IDENTIFICATION IN THE 19S PROTEASOME REGULATORY COMPLEX.
PubMed=16857966; DOI=10.1161/01.res.0000237386.98506.f7;
Gomes A.V., Zong C., Edmondson R.D., Li X., Stefani E., Zhang J.,
Jones R.C., Thyparambil S., Wang G.W., Qiao X., Bardag-Gorce F., Ping P.;
"Mapping the murine cardiac 26S proteasome complexes.";
Circ. Res. 99:362-371(2006).
[7]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-250, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=17242355; DOI=10.1073/pnas.0609836104;
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
"Large-scale phosphorylation analysis of mouse liver.";
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
[8]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-250; THR-253 AND SER-256,
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-250 AND SER-259 (ISOFORMS
RPN10B AND RPN10C), AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE
ANALYSIS].
TISSUE=Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung, Pancreas,
Spleen, and Testis;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and expression.";
Cell 143:1174-1189(2010).
-!- FUNCTION: Component of the 26S proteasome, a multiprotein complex
involved in the ATP-dependent degradation of ubiquitinated proteins.
This complex plays a key role in the maintenance of protein homeostasis
by removing misfolded or damaged proteins, which could impair cellular
functions, and by removing proteins whose functions are no longer
required. Therefore, the proteasome participates in numerous cellular
processes, including cell cycle progression, apoptosis, or DNA damage
repair. PSMD4 acts as an ubiquitin receptor subunit through ubiquitin-
interacting motifs and selects ubiquitin-conjugates for destruction.
Displays a preferred selectivity for longer polyubiquitin chains.
{ECO:0000250|UniProtKB:P55036}.
-!- SUBUNIT: Component of the 19S proteasome regulatory particle complex.
The 26S proteasome consists of a 20S core particle (CP) and two 19S
regulatory subunits (RP). The regulatory particle is made of a lid
composed of 9 subunits, a base containing 6 ATPases and few additional
components including PSMD4 (PubMed:16857966). Interacts with NUB1.
Interacts with SQSTM1. Interacts with UBQLN4. Interacts with UBE3A.
Interacts with UBQLN1 (via ubiquitin-like domain). Interacts with DDI2
(By similarity). {ECO:0000250|UniProtKB:P55036,
ECO:0000269|PubMed:16857966}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=Rpn10A;
IsoId=O35226-1; Sequence=Displayed;
Name=Rpn10B;
IsoId=O35226-2; Sequence=VSP_005293;
Name=Rpn10C;
IsoId=O35226-3; Sequence=VSP_005293, VSP_005294, VSP_005295;
Name=Rpn10D;
IsoId=O35226-4; Sequence=VSP_005296, VSP_005297;
Name=Rpn10E;
IsoId=O35226-5; Sequence=VSP_005298, VSP_005299;
-!- TISSUE SPECIFICITY: Isoform Rpn10A is ubiquitous whereas isoform Rpn10E
is mostly expressed in the embryonic brain.
-!- DEVELOPMENTAL STAGE: Isoform Rpn10E is expressed only in the embryos.
-!- DOMAIN: The 2 UIM motifs are involved in the binding to a multi-
ubiquitin chain in a cooperative way. {ECO:0000250}.
-!- SIMILARITY: Belongs to the proteasome subunit S5A family.
{ECO:0000305}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AF013099; AAC53547.1; -; mRNA.
EMBL; AB029090; BAA97572.1; -; Genomic_DNA.
EMBL; AB029142; BAA97573.1; -; mRNA.
EMBL; AB029143; BAA97574.1; -; mRNA.
EMBL; AB029144; BAA97575.1; -; mRNA.
EMBL; AB029145; BAA97576.1; -; mRNA.
EMBL; AB029146; BAA97577.1; -; mRNA.
EMBL; AF175574; AAG09199.1; -; mRNA.
EMBL; BC009005; AAH09005.1; -; mRNA.
CCDS; CCDS38541.1; -. [O35226-1]
CCDS; CCDS71287.1; -. [O35226-2]
PIR; JC6535; JC6535.
RefSeq; NP_001268946.1; NM_001282017.1. [O35226-2]
RefSeq; NP_032977.1; NM_008951.2. [O35226-1]
SMR; O35226; -.
BioGRID; 202431; 64.
IntAct; O35226; 23.
MINT; O35226; -.
STRING; 10090.ENSMUSP00000071589; -.
iPTMnet; O35226; -.
PhosphoSitePlus; O35226; -.
SwissPalm; O35226; -.
REPRODUCTION-2DPAGE; IPI00345779; -.
EPD; O35226; -.
jPOST; O35226; -.
MaxQB; O35226; -.
PaxDb; O35226; -.
PeptideAtlas; O35226; -.
PRIDE; O35226; -.
ProteomicsDB; 291698; -. [O35226-1]
ProteomicsDB; 291699; -. [O35226-2]
ProteomicsDB; 291700; -. [O35226-3]
ProteomicsDB; 291701; -. [O35226-4]
ProteomicsDB; 291702; -. [O35226-5]
Antibodypedia; 20322; 431 antibodies.
DNASU; 19185; -.
Ensembl; ENSMUST00000071664; ENSMUSP00000071589; ENSMUSG00000005625. [O35226-2]
Ensembl; ENSMUST00000107237; ENSMUSP00000102857; ENSMUSG00000005625. [O35226-1]
Ensembl; ENSMUST00000117355; ENSMUSP00000113554; ENSMUSG00000005625. [O35226-3]
GeneID; 19185; -.
KEGG; mmu:19185; -.
UCSC; uc008qhr.2; mouse. [O35226-1]
UCSC; uc008qht.2; mouse. [O35226-3]
UCSC; uc008qhu.2; mouse. [O35226-4]
UCSC; uc008qhv.2; mouse. [O35226-5]
CTD; 5710; -.
MGI; MGI:1201670; Psmd4.
VEuPathDB; HostDB:ENSMUSG00000005625; -.
eggNOG; KOG2884; Eukaryota.
GeneTree; ENSGT00530000064050; -.
HOGENOM; CLU_033293_0_1_1; -.
InParanoid; O35226; -.
OMA; MSLEATM; -.
PhylomeDB; O35226; -.
TreeFam; TF106232; -.
Reactome; R-MMU-1169091; Activation of NF-kappaB in B cells.
Reactome; R-MMU-1234176; Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha.
Reactome; R-MMU-1236978; Cross-presentation of soluble exogenous antigens (endosomes).
Reactome; R-MMU-174084; Autodegradation of Cdh1 by Cdh1:APC/C.
Reactome; R-MMU-174154; APC/C:Cdc20 mediated degradation of Securin.
Reactome; R-MMU-174178; APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1.
Reactome; R-MMU-174184; Cdc20:Phospho-APC/C mediated degradation of Cyclin A.
Reactome; R-MMU-187577; SCF(Skp2)-mediated degradation of p27/p21.
Reactome; R-MMU-195253; Degradation of beta-catenin by the destruction complex.
Reactome; R-MMU-202424; Downstream TCR signaling.
Reactome; R-MMU-2467813; Separation of Sister Chromatids.
Reactome; R-MMU-2871837; FCERI mediated NF-kB activation.
Reactome; R-MMU-349425; Autodegradation of the E3 ubiquitin ligase COP1.
Reactome; R-MMU-350562; Regulation of ornithine decarboxylase (ODC).
Reactome; R-MMU-382556; ABC-family proteins mediated transport.
Reactome; R-MMU-450408; AUF1 (hnRNP D0) binds and destabilizes mRNA.
Reactome; R-MMU-4608870; Asymmetric localization of PCP proteins.
Reactome; R-MMU-4641257; Degradation of AXIN.
Reactome; R-MMU-4641258; Degradation of DVL.
Reactome; R-MMU-5358346; Hedgehog ligand biogenesis.
Reactome; R-MMU-5607761; Dectin-1 mediated noncanonical NF-kB signaling.
Reactome; R-MMU-5607764; CLEC7A (Dectin-1) signaling.
Reactome; R-MMU-5610780; Degradation of GLI1 by the proteasome.
Reactome; R-MMU-5610785; GLI3 is processed to GLI3R by the proteasome.
Reactome; R-MMU-5632684; Hedgehog 'on' state.
Reactome; R-MMU-5658442; Regulation of RAS by GAPs.
Reactome; R-MMU-5668541; TNFR2 non-canonical NF-kB pathway.
Reactome; R-MMU-5676590; NIK-->noncanonical NF-kB signaling.
Reactome; R-MMU-5687128; MAPK6/MAPK4 signaling.
Reactome; R-MMU-5689603; UCH proteinases.
Reactome; R-MMU-5689880; Ub-specific processing proteases.
Reactome; R-MMU-68827; CDT1 association with the CDC6:ORC:origin complex.
Reactome; R-MMU-68949; Orc1 removal from chromatin.
Reactome; R-MMU-69017; CDK-mediated phosphorylation and removal of Cdc6.
Reactome; R-MMU-69481; G2/M Checkpoints.
Reactome; R-MMU-69601; Ubiquitin Mediated Degradation of Phosphorylated Cdc25A.
Reactome; R-MMU-75815; Ubiquitin-dependent degradation of Cyclin D.
Reactome; R-MMU-8852276; The role of GTSE1 in G2/M progression after G2 checkpoint.
Reactome; R-MMU-8854050; FBXL7 down-regulates AURKA during mitotic entry and in early mitosis.
Reactome; R-MMU-8932339; ROS sensing by NFE2L2.
Reactome; R-MMU-8939236; RUNX1 regulates transcription of genes involved in differentiation of HSCs.
Reactome; R-MMU-8939902; Regulation of RUNX2 expression and activity.
Reactome; R-MMU-8941858; Regulation of RUNX3 expression and activity.
Reactome; R-MMU-8948751; Regulation of PTEN stability and activity.
Reactome; R-MMU-8951664; Neddylation.
Reactome; R-MMU-9020702; Interleukin-1 signaling.
Reactome; R-MMU-983168; Antigen processing: Ubiquitination & Proteasome degradation.
BioGRID-ORCS; 19185; 28 hits in 61 CRISPR screens.
ChiTaRS; Psmd4; mouse.
PRO; PR:O35226; -.
Proteomes; UP000000589; Chromosome 3.
RNAct; O35226; protein.
Bgee; ENSMUSG00000005625; Expressed in brain and 321 other tissues.
Genevisible; O35226; MM.
GO; GO:0005737; C:cytoplasm; ISO:MGI.
GO; GO:0005829; C:cytosol; ISO:MGI.
GO; GO:0005654; C:nucleoplasm; ISO:MGI.
GO; GO:0005634; C:nucleus; IBA:GO_Central.
GO; GO:0022624; C:proteasome accessory complex; IDA:UniProtKB.
GO; GO:0000502; C:proteasome complex; ISO:MGI.
GO; GO:0008540; C:proteasome regulatory particle, base subcomplex; IBA:GO_Central.
GO; GO:0042802; F:identical protein binding; ISO:MGI.
GO; GO:0031593; F:polyubiquitin modification-dependent protein binding; IBA:GO_Central.
GO; GO:0043248; P:proteasome assembly; IBA:GO_Central.
GO; GO:0043161; P:proteasome-mediated ubiquitin-dependent protein catabolic process; IBA:GO_Central.
Gene3D; 3.40.50.410; -; 1.
InterPro; IPR003903; UIM_dom.
InterPro; IPR002035; VWF_A.
InterPro; IPR036465; vWFA_dom_sf.
Pfam; PF02809; UIM; 2.
Pfam; PF13519; VWA_2; 1.
SMART; SM00726; UIM; 2.
SMART; SM00327; VWA; 1.
SUPFAM; SSF53300; SSF53300; 1.
PROSITE; PS50330; UIM; 2.
PROSITE; PS50234; VWFA; 1.
1: Evidence at protein level;
Alternative splicing; Isopeptide bond; Phosphoprotein; Proteasome;
Reference proteome; Repeat; Ubl conjugation.
CHAIN 1..376
/note="26S proteasome non-ATPase regulatory subunit 4"
/id="PRO_0000173829"
DOMAIN 5..188
/note="VWFA"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00219"
DOMAIN 211..230
/note="UIM 1"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00213"
DOMAIN 282..301
/note="UIM 2"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00213"
REGION 197..262
/note="Interaction with UBQLN1"
/evidence="ECO:0000250|UniProtKB:P55036"
REGION 224..257
/note="Disordered"
/evidence="ECO:0000256|SAM:MobiDB-lite"
REGION 355..376
/note="Disordered"
/evidence="ECO:0000256|SAM:MobiDB-lite"
COMPBIAS 225..239
/note="Basic and acidic residues"
/evidence="ECO:0000256|SAM:MobiDB-lite"
MOD_RES 250
/note="Phosphothreonine"
/evidence="ECO:0007744|PubMed:15345747,
ECO:0007744|PubMed:17242355, ECO:0007744|PubMed:21183079"
MOD_RES 253
/note="Phosphothreonine"
/evidence="ECO:0007744|PubMed:21183079"
MOD_RES 256
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:21183079"
MOD_RES 360
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:P55036"
CROSSLNK 122
/note="Glycyl lysine isopeptide (Lys-Gly) (interchain with
G-Cter in SUMO2)"
/evidence="ECO:0000250|UniProtKB:P55036"
VAR_SEQ 254
/note="E -> EGER (in isoform Rpn10B and isoform Rpn10C)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_005293"
VAR_SEQ 255..260
/note="DSDDAL -> GERGGF (in isoform Rpn10E)"
/evidence="ECO:0000305"
/id="VSP_005298"
VAR_SEQ 261..376
/note="Missing (in isoform Rpn10E)"
/evidence="ECO:0000305"
/id="VSP_005299"
VAR_SEQ 299..349
/note="EFSQESADMDASSAMDTSDPVKEEDDYDVMQDPEFLQSVLENLPGVDPNNA
-> GGPWLGWQGLDRVWGEELALSGLLLSFPQSLAKNRLTWMPAQPWTHLIQSR (in
isoform Rpn10D)"
/evidence="ECO:0000305"
/id="VSP_005296"
VAR_SEQ 321..365
/note="EEDDYDVMQDPEFLQSVLENLPGVDPNNAAIRSVMGALASQATKD -> VRA
SSEALTQPSLTSPAFRSLSFWDQGLSSLAFHKKGLGATEGNT (in isoform
Rpn10C)"
/evidence="ECO:0000305"
/id="VSP_005294"
VAR_SEQ 350..376
/note="Missing (in isoform Rpn10D)"
/evidence="ECO:0000305"
/id="VSP_005297"
VAR_SEQ 366..376
/note="Missing (in isoform Rpn10C)"
/evidence="ECO:0000305"
/id="VSP_005295"
MOD_RES O35226-2:250
/note="Phosphothreonine"
/evidence="ECO:0007744|PubMed:21183079"
MOD_RES O35226-2:259
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:21183079"
MOD_RES O35226-3:250
/note="Phosphothreonine"
/evidence="ECO:0007744|PubMed:21183079"
MOD_RES O35226-3:259
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:21183079"
SEQUENCE 376 AA; 40704 MW; 732AC02B56760EAA CRC64;
MVLESTMVCV DNSEYMRNGD FLPTRLQAQQ DAVNIVCHSK TRSNPENNVG LITLANDCEV
LTTLTPDTGR ILSKLHTVQP KGKITFCTGI RVAHLALKHR QGKNHKMRII AFVGSPVEDN
EKDLVKLAKR LKKEKVNVDI INFGEEEVNT EKLTAFVNTL NGKDGTGSHL VTVPPGPSLA
DALISSPILA GEGGAMLGLG ASDFEFGVDP SADPELALAL RVSMEEQRQR QEEEARRAAA
ASAAEAGIAT PGTEDSDDAL LKMTINQQEF GRPGLPDLSS MTEEEQIAYA MQMSLQGTEF
SQESADMDAS SAMDTSDPVK EEDDYDVMQD PEFLQSVLEN LPGVDPNNAA IRSVMGALAS
QATKDGKNDK KEEEKK


Related products :

Catalog number Product name Quantity
EIAAB32852 26S proteasome non-ATPase regulatory subunit 4,26S proteasome regulatory subunit RPN10,26S proteasome regulatory subunit S5A,Mcb1,Mouse,Multiubiquitin chain-binding protein,Mus musculus,Psmd4
EIAAB32851 26S proteasome non-ATPase regulatory subunit 4,26S proteasome regulatory subunit RPN10,26S proteasome regulatory subunit S5A,AF,Antisecretory factor 1,ASF,Homo sapiens,Human,MCB1,Multiubiquitin chain-
18-003-42187 26S proteasome non-ATPase regulatory subunit 4 - 26S proteasome regulatory subunit S5A; Rpn10; Multiubiquitin chain-binding protein; Antisecretory factor 1; AF; ASF Polyclonal 0.1 mg Protein A
18-003-42186 26S proteasome non-ATPase regulatory subunit 4 - 26S proteasome regulatory subunit S5A; Rpn10; Multiubiquitin chain-binding protein; Antisecretory factor 1; AF; ASF Polyclonal 0.05 mg Aff Pur
EIAAB32808 26S proteasome non-ATPase regulatory subunit 7,26S proteasome regulatory subunit RPN8,26S proteasome regulatory subunit S12,Homo sapiens,Human,Mov34 protein homolog,MOV34L,Proteasome subunit p40,PSMD7
EIAAB32846 26S proteasome non-ATPase regulatory subunit 2,26S proteasome regulatory subunit RPN1,26S proteasome regulatory subunit S2,26S proteasome subunit p97,Homo sapiens,Human,Protein 55.11,PSMD2,TRAP2,Tumor
EIAAB32847 26S proteasome non-ATPase regulatory subunit 2,26S proteasome regulatory subunit RPN1,26S proteasome regulatory subunit S2,26S proteasome subunit p97,Bos taurus,Bovine,PSMD2,TRAP2,Tumor necrosis facto
EIAAB32850 26S proteasome non-ATPase regulatory subunit 3,26S proteasome regulatory subunit RPN3,26S proteasome regulatory subunit S3,Mouse,Mus musculus,P91a,Proteasome subunit p58,Psmd3,Transplantation antigen
EIAAB32798 26S proteasome non-ATPase regulatory subunit 13,26S proteasome regulatory subunit p40.5,26S proteasome regulatory subunit RPN9,26S proteasome regulatory subunit S11,Homo sapiens,Human,PSMD13
EIAAB32789 26S proteasome non-ATPase regulatory subunit 11,26S proteasome regulatory subunit p44.5,26S proteasome regulatory subunit RPN6,26S proteasome regulatory subunit S9,Homo sapiens,Human,PSMD11
EIAAB32858 26S proteasome non-ATPase regulatory subunit 6,26S proteasome regulatory subunit RPN7,26S proteasome regulatory subunit S10,Breast cancer-associated protein SGA-113M,Homo sapiens,Human,KIAA0107,p42A,P
EIAAB32842 26S proteasome non-ATPase regulatory subunit 1,26S proteasome regulatory subunit RPN2,26S proteasome regulatory subunit S1,26S proteasome subunit p112,Homo sapiens,Human,PSMD1
EIAAB32848 26S proteasome non-ATPase regulatory subunit 3,26S proteasome regulatory subunit RPN3,26S proteasome regulatory subunit S3,Homo sapiens,Human,Proteasome subunit p58,PSMD3
EIAAB32841 26S proteasome non-ATPase regulatory subunit 1,26S proteasome regulatory subunit RPN2,26S proteasome regulatory subunit S1,26S proteasome subunit p112,Psmd1,Rat,Rattus norvegicus
EIAAB32791 26S proteasome non-ATPase regulatory subunit 11,26S proteasome regulatory subunit p44.5,26S proteasome regulatory subunit RPN6,26S proteasome regulatory subunit S9,Mouse,Mus musculus,Psmd11
EIAAB32797 26S proteasome non-ATPase regulatory subunit 13,26S proteasome regulatory subunit p40.5,26S proteasome regulatory subunit RPN9,26S proteasome regulatory subunit S11,Mouse,Mus musculus,Psmd13
EIAAB32796 26S proteasome non-ATPase regulatory subunit 13,26S proteasome regulatory subunit p40.5,26S proteasome regulatory subunit RPN9,26S proteasome regulatory subunit S11,Psmd13,Rat,Rattus norvegicus
EIAAB32799 26S proteasome non-ATPase regulatory subunit 13,26S proteasome regulatory subunit p40.5,26S proteasome regulatory subunit RPN9,26S proteasome regulatory subunit S11,Bos taurus,Bovine,PSMD13
EIAAB32807 26S proteasome non-ATPase regulatory subunit 7,26S proteasome regulatory subunit RPN8,26S proteasome regulatory subunit S12,Mouse,Mov34,Mov-34,Mov34 protein,Mus musculus,Proteasome subunit p40,Psmd7
EIAAB32844 26S proteasome non-ATPase regulatory subunit 2,26S proteasome regulatory subunit RPN1,26S proteasome regulatory subunit S2,26S proteasome subunit p97,Mouse,Mus musculus,Psmd2
EIAAB32793 26S proteasome non-ATPase regulatory subunit 12,26S proteasome regulatory subunit p55,26S proteasome regulatory subunit RPN5,Homo sapiens,Human,PSMD12
EIAAB32859 26S proteasome non-ATPase regulatory subunit 6,26S proteasome regulatory subunit RPN7,26S proteasome regulatory subunit S10,Mouse,Mus musculus,p42A,Psmd6
EIAAB32862 26S proteasome non-ATPase regulatory subunit 8,26S proteasome regulatory subunit RPN12,26S proteasome regulatory subunit S14,Homo sapiens,Human,p31,PSMD8
EIAAB32853 26S proteasome non-ATPase regulatory subunit 4,26S proteasome regulatory subunit RPN10,Bos taurus,Bovine,PSMD4
15-288-22830 26S proteasome non-ATPase regulatory subunit 1 - 26S proteasome regulatory subunit RPN2; 26S proteasome regulatory subunit S1; 26S proteasome subunit p112 Polyclonal 0.1 mg
Pathways :
WP2292: Chemokine signaling pathway
WP731: Sterol regulatory element binding protein related
WP1663: Homologous recombination
WP1672: Mismatch repair
WP1691: Proteasome
WP158: Proteasome Degradation
WP1694: Pyrimidine metabolism
WP1626: Benzoate degradation via CoA ligation
WP470: Proteasome Degradation
WP1644: DNA replication
WP2272: Pathogenic Escherichia coli infection
WP1493: Carbon assimilation C4 pathway
WP1909: Signal regulatory protein (SIRP) family interactions
WP1566: Citrate cycle (TCA cycle)
WP1693: Purine metabolism
WP1614: 1- and 2-Methylnaphthalene degradation
WP281: Proteasome Degradation
WP1196: Proteasome Degradation
WP519: Proteasome Degradation
WP1655: Geraniol degradation
WP841: Proteasome Degradation
WP267: Proteasome Degradation
WP1711: Trinitrotoluene degradation
WP302: Proteasome Degradation
WP1079: Proteasome Degradation

Related Genes :
[RPN10 MBP1 MCB1 At4g38630 F20M13.190 T9A14.7] 26S proteasome non-ATPase regulatory subunit 4 homolog (26S proteasome regulatory subunit RPN10) (AtRPN10) (26S proteasome regulatory subunit S5A homolog) (Multiubiquitin chain-binding protein 1) (AtMCB1)
[PSMD4 MCB1] 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein)
[Rpn10 PROS-54 Pros54 CG7619] 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (54 kDa subunit of mu particle) (Multiubiquitin chain-binding protein) (p54)
[Psmd4 Mcb1] 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Multiubiquitin chain-binding protein)
[RPN10 MCB1 SUN1 YHR200W] 26S proteasome regulatory subunit RPN10
[PSMD3] 26S proteasome non-ATPase regulatory subunit 3 (26S proteasome regulatory subunit RPN3) (26S proteasome regulatory subunit S3) (Proteasome subunit p58)
[RPT2A HLR At4g29040 F19B15.70 F25O24.6] 26S proteasome regulatory subunit 4 homolog A (26S proteasome AAA-ATPase subunit RPT2a) (26S proteasome subunit 4 homolog A) (Protein HALTED ROOT) (Regulatory particle triple-A ATPase subunit 2a)
[PSMD6 KIAA0107 PFAAP4] 26S proteasome non-ATPase regulatory subunit 6 (26S proteasome regulatory subunit RPN7) (26S proteasome regulatory subunit S10) (Breast cancer-associated protein SGA-113M) (Phosphonoformate immuno-associated protein 4) (Proteasome regulatory particle subunit p44S10) (p42A)
[PSMC4 MIP224 TBP7] 26S proteasome regulatory subunit 6B (26S proteasome AAA-ATPase subunit RPT3) (MB67-interacting protein) (MIP224) (Proteasome 26S subunit ATPase 4) (Tat-binding protein 7) (TBP-7)
[RPT5A ATS6A.2 TBP1 At3g05530 F22F7.1] 26S proteasome regulatory subunit 6A homolog A (26S proteasome AAA-ATPase subunit RPT5a) (Proteasome 26S subunit 6A homolog A) (Regulatory particle triple-A ATPase subunit 5a) (Tat-binding protein 1 homolog A) (TBP-1 homolog A)
[RPT5B TBP1 At1g09100 F7G19.2] 26S proteasome regulatory subunit 6A homolog B (26S proteasome AAA-ATPase subunit RPT5b) (Proteasome 26S subunit 6A homolog B) (Regulatory particle triple-A ATPase subunit 5b) (Tat-binding protein 1 homolog B) (TBP-1 homolog B)
[RPT2B At2g20140 T2G17.6] 26S proteasome regulatory subunit 4 homolog B (26S proteasome AAA-ATPase subunit RPT2b) (26S proteasome subunit 4 homolog B) (Regulatory particle triple-A ATPase subunit 2b)
[PSMD2 TRAP2] 26S proteasome non-ATPase regulatory subunit 2 (26S proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Protein 55.11) (Tumor necrosis factor type 1 receptor-associated protein 2)
[PSMD11] 26S proteasome non-ATPase regulatory subunit 11 (26S proteasome regulatory subunit RPN6) (26S proteasome regulatory subunit S9) (26S proteasome regulatory subunit p44.5)
[rpn-10 B0205.3] 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit rpn-10)
[PSMC3 TBP1] 26S proteasome regulatory subunit 6A (26S proteasome AAA-ATPase subunit RPT5) (Proteasome 26S subunit ATPase 3) (Proteasome subunit P50) (Tat-binding protein 1) (TBP-1)
[PSMD1] 26S proteasome non-ATPase regulatory subunit 1 (26S proteasome regulatory subunit RPN2) (26S proteasome regulatory subunit S1) (26S proteasome subunit p112)
[PSMD13] 26S proteasome non-ATPase regulatory subunit 13 (26S proteasome regulatory subunit RPN9) (26S proteasome regulatory subunit S11) (26S proteasome regulatory subunit p40.5)
[PSMD7 MOV34L] 26S proteasome non-ATPase regulatory subunit 7 (26S proteasome regulatory subunit RPN8) (26S proteasome regulatory subunit S12) (Mov34 protein homolog) (Proteasome subunit p40)
[PSMC1] 26S proteasome regulatory subunit 4 (P26s4) (26S proteasome AAA-ATPase subunit RPT2) (Proteasome 26S subunit ATPase 1)
[PSMC6 SUG2] 26S proteasome regulatory subunit 10B (26S proteasome AAA-ATPase subunit RPT4) (Proteasome 26S subunit ATPase 6) (Proteasome subunit p42)
[PSMD14 POH1] 26S proteasome non-ATPase regulatory subunit 14 (EC 3.4.19.-) (26S proteasome regulatory subunit RPN11) (26S proteasome-associated PAD1 homolog 1)
[Psmc1] 26S proteasome regulatory subunit 4 (P26s4) (26S proteasome AAA-ATPase subunit RPT2) (Proteasome 26S subunit ATPase 1)
[RPN1A At2g20580 F23N11.10] 26S proteasome non-ATPase regulatory subunit 2 homolog A (26S proteasome regulatory subunit RPN1a) (AtRPN1a) (26S proteasome regulatory subunit S2 homolog A)
[PSMD12] 26S proteasome non-ATPase regulatory subunit 12 (26S proteasome regulatory subunit RPN5) (26S proteasome regulatory subunit p55)
[PSMC5 SUG1] 26S proteasome regulatory subunit 8 (26S proteasome AAA-ATPase subunit RPT6) (Proteasome 26S subunit ATPase 5) (Proteasome subunit p45) (Thyroid hormone receptor-interacting protein 1) (TRIP1) (p45/SUG)
[rpn10 pus1 SPAC637.10c] 26S proteasome regulatory subunit rpn10
[RPN12A At1g64520 F1N19.9] 26S proteasome non-ATPase regulatory subunit 8 homolog A (26S proteasome regulatory subunit RPN12a) (AtRPN12a) (26S proteasome regulatory subunit S14 homolog A)
[Psmc5 Sug1] 26S proteasome regulatory subunit 8 (26S proteasome AAA-ATPase subunit RPT6) (Proteasome 26S subunit ATPase 5) (Proteasome subunit p45) (Thyroid hormone receptor-interacting protein 1) (TRIP1) (p45/SUG)
[PSMC2 MSS1] 26S proteasome regulatory subunit 7 (26S proteasome AAA-ATPase subunit RPT1) (Proteasome 26S subunit ATPase 2) (Protein MSS1)

Bibliography :
No related Items