GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

ATP-dependent DNA helicase DDX11 (EC 3.6.4.12) (CHL1-related protein 1) (hCHLR1) (DEAD/H-box protein 11) (Keratinocyte growth factor-regulated gene 2 protein) (KRG-2)

 DDX11_HUMAN             Reviewed;         970 AA.
Q96FC9; Q13333; Q86VQ4; Q86W62; Q92498; Q92770; Q92998; Q92999;
10-JAN-2006, integrated into UniProtKB/Swiss-Prot.
01-DEC-2001, sequence version 1.
13-FEB-2019, entry version 155.
RecName: Full=ATP-dependent DNA helicase DDX11 {ECO:0000305};
EC=3.6.4.12 {ECO:0000269|PubMed:10648783, ECO:0000269|PubMed:18499658, ECO:0000269|PubMed:22102414, ECO:0000269|PubMed:26089203, ECO:0000269|PubMed:27477908};
AltName: Full=CHL1-related protein 1 {ECO:0000303|PubMed:9013641};
Short=hCHLR1 {ECO:0000303|PubMed:9013641};
AltName: Full=DEAD/H-box protein 11 {ECO:0000312|HGNC:HGNC:2736};
AltName: Full=Keratinocyte growth factor-regulated gene 2 protein {ECO:0000303|PubMed:8798685};
Short=KRG-2 {ECO:0000303|PubMed:8798685};
Name=DDX11 {ECO:0000312|HGNC:HGNC:2736};
Synonyms=CHL1, CHLR1 {ECO:0000303|PubMed:9013641},
KRG2 {ECO:0000303|PubMed:8798685};
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), TISSUE SPECIFICITY, INDUCTION,
AND VARIANT SER-39.
TISSUE=Keratinocyte;
PubMed=8798685; DOI=10.1074/jbc.271.40.24337;
Frank S., Werner S.;
"The human homologue of the yeast CHL1 gene is a novel keratinocyte
growth factor regulated gene.";
J. Biol. Chem. 271:24337-24340(1996).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, SUBCELLULAR
LOCATION, TISSUE SPECIFICITY, AND VARIANT GLU-567.
PubMed=9013641; DOI=10.1074/jbc.272.6.3823;
Amann J., Kidd V.J., Lahti J.M.;
"Characterization of putative human homologues of the yeast chromosome
transmission fidelity gene, CHL1.";
J. Biol. Chem. 272:3823-3832(1997).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 5), AND VARIANTS GLU-567
AND MET-575.
Ouellette M.M., Wright W.E., Shay J.W.;
"Isolation and characterization of the human homologue of the yeast
CHL1 gene.";
Submitted (OCT-1996) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
TISSUE=Testis, and Uterus;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
CATALYTIC ACTIVITY, ENZYME ACTIVITY, FUNCTION, AND MUTAGENESIS OF
LYS-50.
PubMed=10648783; DOI=10.1093/nar/28.4.917;
Hirota Y., Lahti J.M.;
"Characterization of the enzymatic activity of hChlR1, a novel human
DNA helicase.";
Nucleic Acids Res. 28:917-924(2000).
[6]
FUNCTION, SUBCELLULAR LOCATION, ASSOCIATION WITH A COHESIN COMPLEX,
AND INTERACTION WITH RAD21; SMC1 PROTEINS AND SMC3.
PubMed=17105772; DOI=10.1242/jcs.03262;
Parish J.L., Rosa J., Wang X., Lahti J.M., Doxsey S.J., Androphy E.J.;
"The DNA helicase ChlR1 is required for sister chromatid cohesion in
mammalian cells.";
J. Cell Sci. 119:4857-4865(2006).
[7]
FUNCTION (MICROBIAL INFECTION), INTERACTION WITH BOVINE PAPILLOMAVIRUS
TYPE 1 REGULATORY PROTEIN E2 (MICROBIAL INFECTION), AND SUBCELLULAR
LOCATION (MICROBIAL INFECTION).
PubMed=17189189; DOI=10.1016/j.molcel.2006.11.005;
Parish J.L., Bean A.M., Park R.B., Androphy E.J.;
"ChlR1 is required for loading papillomavirus E2 onto mitotic
chromosomes and viral genome maintenance.";
Mol. Cell 24:867-876(2006).
[8]
FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, ASSOCIATES WITH THE
CTF18-RFC COMPLEX, INTERACTION WITH CHTF18; DSCC1; FEN1; PCNA AND
RFC2, AND MUTAGENESIS OF LYS-50.
PubMed=18499658; DOI=10.1074/jbc.M802696200;
Farina A., Shin J.H., Kim D.H., Bermudez V.P., Kelman Z., Seo Y.S.,
Hurwitz J.;
"Studies with the human cohesin establishment factor, ChlR1.
Association of ChlR1 with Ctf18-RFC and Fen1.";
J. Biol. Chem. 283:20925-20936(2008).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[10]
INVOLVEMENT IN WBRS.
PubMed=20137776; DOI=10.1016/j.ajhg.2010.01.008;
van der Lelij P., Chrzanowska K.H., Godthelp B.C., Rooimans M.A.,
Oostra A.B., Stumm M., Zdzienicka M.Z., Joenje H., de Winter J.P.;
"Warsaw breakage syndrome, a cohesinopathy associated with mutations
in the XPD helicase family member DDX11/ChlR1.";
Am. J. Hum. Genet. 86:262-266(2010).
[11]
FUNCTION, AND INTERACTION WITH TIMELESS.
PubMed=20124417; DOI=10.1242/jcs.057984;
Leman A.R., Noguchi C., Lee C.Y., Noguchi E.;
"Human Timeless and Tipin stabilize replication forks and facilitate
sister-chromatid cohesion.";
J. Cell Sci. 123:660-670(2010).
[12]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[13]
FUNCTION.
PubMed=21854770; DOI=10.1016/j.yexcr.2011.08.006;
Inoue A., Hyle J., Lechner M.S., Lahti J.M.;
"Mammalian ChlR1 has a role in heterochromatin organization.";
Exp. Cell Res. 317:2522-2535(2011).
[14]
FUNCTION, CATALYTIC ACTIVITY, AND MUTAGENESIS OF LYS-50.
PubMed=22102414; DOI=10.1074/jbc.M111.276022;
Wu Y., Sommers J.A., Khan I., de Winter J.P., Brosh R.M. Jr.;
"Biochemical characterization of Warsaw breakage syndrome helicase.";
J. Biol. Chem. 287:1007-1021(2012).
[15]
FUNCTION, INDUCTION, AND TISSUE SPECIFICITY.
PubMed=23116066; DOI=10.1186/1476-4598-11-82;
Bhattacharya C., Wang X., Becker D.;
"The DEAD/DEAH box helicase, DDX11, is essential for the survival of
advanced melanomas.";
Mol. Cancer 11:82-82(2012).
[16]
FUNCTION.
PubMed=23797032; DOI=10.1016/j.yexcr.2013.06.005;
Shah N., Inoue A., Woo Lee S., Beishline K., Lahti J.M., Noguchi E.;
"Roles of ChlR1 DNA helicase in replication recovery from DNA
damage.";
Exp. Cell Res. 319:2244-2253(2013).
[17]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-262, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[18]
FUNCTION, CATALYTIC ACTIVITY, INTERACTION WITH POLR1A AND UBTF,
SUBCELLULAR LOCATION, INDUCTION, VARIANT WBRS GLN-263, AND
CHARACTERIZATION OF VARIANT WBRS GLN-263.
PubMed=26089203; DOI=10.1093/hmg/ddv213;
Sun X., Chen H., Deng Z., Hu B., Luo H., Zeng X., Han L., Cai G.,
Ma L.;
"The Warsaw breakage syndrome-related protein DDX11 is required for
ribosomal RNA synthesis and embryonic development.";
Hum. Mol. Genet. 24:4901-4915(2015).
[19]
FUNCTION, CATALYTIC ACTIVITY, ACTIVITY REGULATION, CHROMATIN-BINDING,
AND RNA-BINDING.
PubMed=27477908; DOI=10.1016/j.molcel.2016.06.031;
Marchese F.P., Grossi E., Marin-Bejar O., Bharti S.K., Raimondi I.,
Gonzalez J., Martinez-Herrera D.J., Athie A., Amadoz A.,
Brosh R.M. Jr., Huarte M.;
"A Long Noncoding RNA Regulates Sister Chromatid Cohesion.";
Mol. Cell 63:397-407(2016).
[20]
FUNCTION, AND INTERACTION WITH TIMELESS.
PubMed=26503245; DOI=10.1093/nar/gkv1112;
Cali F., Bharti S.K., Di Perna R., Brosh R.M. Jr., Pisani F.M.;
"Tim/Timeless, a member of the replication fork protection complex,
operates with the Warsaw breakage syndrome DNA helicase DDX11 in the
same fork recovery pathway.";
Nucleic Acids Res. 44:705-717(2016).
[21]
VARIANT WBRS GLN-263, AND CHARACTERIZATION OF VARIANT WBRS GLN-263.
PubMed=23033317; DOI=10.1002/humu.22226;
Capo-Chichi J.M., Bharti S.K., Sommers J.A., Yammine T., Chouery E.,
Patry L., Rouleau G.A., Samuels M.E., Hamdan F.F., Michaud J.L.,
Brosh R.M. Jr., Megarbane A., Kibar Z.;
"Identification and biochemical characterization of a novel mutation
in DDX11 causing warsaw breakage syndrome.";
Hum. Mutat. 34:103-107(2013).
-!- FUNCTION: DNA-dependent ATPase and ATP-dependent DNA helicase that
participates in various functions in genomic stability, including
DNA replication, DNA repair and heterochromatin organization as
well as in ribosomal RNA synthesis (PubMed:10648783,
PubMed:21854770, PubMed:23797032, PubMed:26089203,
PubMed:26503245). Its double-stranded DNA helicase activity
requires either a minimal 5'-single-stranded tail length of
approximately 15 nt (flap substrates) or 10 nt length single-
stranded gapped DNA substrates of a partial duplex DNA structure
for helicase loading and translocation along DNA in a 5' to 3'
direction (PubMed:18499658, PubMed:22102414). The helicase
activity is capable of displacing duplex regions up to 100 bp,
which can be extended up to 500 bp by the replication protein A
(RPA) or the cohesion CTF18-replication factor C (Ctf18-RFC)
complex activities (PubMed:18499658). Shows also ATPase- and
helicase activities on substrates that mimic key DNA intermediates
of replication, repair and homologous recombination reactions,
including forked duplex, anti-parallel G-quadruplex and three-
stranded D-loop DNA molecules (PubMed:22102414, PubMed:26503245).
Plays a role in DNA double-strand break (DSB) repair at the DNA
replication fork during DNA replication recovery from DNA damage
(PubMed:23797032). Recruited with TIMELESS factor upon DNA-
replication stress response at DNA replication fork to preserve
replication fork progression, and hence ensure DNA replication
fidelity (PubMed:26503245). Cooperates also with TIMELESS factor
during DNA replication to regulate proper sister chromatid
cohesion and mitotic chromosome segregation (PubMed:17105772,
PubMed:18499658, PubMed:20124417, PubMed:23116066,
PubMed:23797032). Stimulates 5'-single-stranded DNA flap
endonuclease activity of FEN1 in an ATP- and helicase-independent
manner; and hence it may contribute in Okazaki fragment processing
at DNA replication fork during lagging strand DNA synthesis
(PubMed:18499658). Its ability to function at DNA replication fork
is modulated by its binding to long non-coding RNA (lncRNA)
cohesion regulator non-coding RNA DDX11-AS1/CONCR, which is able
to increase both DDX11 ATPase activity and binding to DNA
replicating regions (PubMed:27477908). Plays also a role in
heterochromatin organization (PubMed:21854770). Involved in rRNA
transcription activation through binding to active hypomethylated
rDNA gene loci by recruiting UBTF and the RNA polymerase Pol I
transcriptional machinery (PubMed:26089203). Plays a role in
embryonic development and prevention of aneuploidy (By
similarity). Involved in melanoma cell proliferation and survival
(PubMed:23116066). Associates with chromatin at DNA replication
fork regions (PubMed:27477908). Binds to single- and double-
stranded DNAs (PubMed:9013641, PubMed:18499658, PubMed:22102414).
{ECO:0000250|UniProtKB:Q6AXC6, ECO:0000269|PubMed:10648783,
ECO:0000269|PubMed:17105772, ECO:0000269|PubMed:18499658,
ECO:0000269|PubMed:20124417, ECO:0000269|PubMed:21854770,
ECO:0000269|PubMed:22102414, ECO:0000269|PubMed:23116066,
ECO:0000269|PubMed:23797032, ECO:0000269|PubMed:26089203,
ECO:0000269|PubMed:26503245, ECO:0000269|PubMed:27477908}.
-!- FUNCTION: (Microbial infection) Required for bovine papillomavirus
type 1 regulatory protein E2 loading onto mitotic chromosomes
during DNA replication for the viral genome to be maintained and
segregated. {ECO:0000269|PubMed:17189189}.
-!- CATALYTIC ACTIVITY:
Reaction=ATP + H2O = ADP + H(+) + phosphate; Xref=Rhea:RHEA:13065,
ChEBI:CHEBI:15377, ChEBI:CHEBI:15378, ChEBI:CHEBI:30616,
ChEBI:CHEBI:43474, ChEBI:CHEBI:456216; EC=3.6.4.12;
Evidence={ECO:0000269|PubMed:10648783,
ECO:0000269|PubMed:18499658, ECO:0000269|PubMed:22102414,
ECO:0000269|PubMed:26089203, ECO:0000269|PubMed:27477908};
-!- COFACTOR:
Name=[4Fe-4S] cluster; Xref=ChEBI:CHEBI:49883;
Evidence={ECO:0000250};
Note=Binds 1 [4Fe-4S] cluster. {ECO:0000250};
-!- ACTIVITY REGULATION: ATPase activity is stimulated by high
magnesium salt levels (up to a 0.1 M), and potassium salts
(glutamate, chloride or acetate) are more effective than the
corresponding sodium salts (PubMed:10648783, PubMed:18499658).
ATPase activity is enhanced by the long non-coding RNA (lncRNA)
cohesion regulator noncoding RNA (CONCR) (PubMed:27477908).
Double-stranded DNA helicase activity is maximal with magnesium
ions at low concentrations (0.5-1 mM) whereas is markedly
inhibited at higher levels (5 mM and above) (PubMed:10648783,
PubMed:18499658). Double-stranded DNA helicase activity is
stimulated by 25-50 mM potassium acetate, stimulated to a lesser
extent by 25 mM of ammonium acetate, and markedly inhibited by
sodium acetate (PubMed:18499658). {ECO:0000269|PubMed:10648783,
ECO:0000269|PubMed:18499658, ECO:0000269|PubMed:27477908}.
-!- SUBUNIT: Associates with the CTF18-RFC complex (PubMed:18499658).
Associates with a cohesin complex composed of RAD21, SMC1 proteins
and SMC3 (PubMed:17105772). Interacts with CHTF18
(PubMed:18499658). Interacts with DSCC1 (PubMed:18499658).
Interacts with FEN1; this interaction is direct and increases flap
endonuclease activity of FEN1 (PubMed:18499658). Interacts with
PCNA (PubMed:18499658). Interacts with POLR1A and UBTF
(PubMed:26089203). Interacts with RAD21, SMC1 proteins and SMC3
(PubMed:17105772). Interacts with RFC2 (PubMed:18499658).
Interacts with TIMELESS; this interaction increases recruitment of
both proteins onto chromatin in response to replication stress
induction by hydroxyurea (PubMed:20124417, PubMed:26503245).
{ECO:0000269|PubMed:17105772, ECO:0000269|PubMed:18499658,
ECO:0000269|PubMed:20124417, ECO:0000269|PubMed:26089203,
ECO:0000269|PubMed:26503245}.
-!- SUBUNIT: (Microbial infection) Interacts with bovine
papillomavirus type 1 regulatory protein E2; this interaction
stimulates the recruitment of E2 onto mitotic chromosomes.
{ECO:0000269|PubMed:17189189}.
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:17105772}.
Nucleus, nucleolus {ECO:0000269|PubMed:17105772,
ECO:0000269|PubMed:26089203, ECO:0000269|PubMed:9013641}.
Cytoplasm, cytoskeleton, spindle pole
{ECO:0000269|PubMed:17105772}. Midbody
{ECO:0000269|PubMed:17105772}. Cytoplasm, cytoskeleton,
microtubule organizing center, centrosome
{ECO:0000269|PubMed:17105772}. Note=During the early stages of
mitosis, localizes to condensed chromatin and is released from the
chromatin with progression to metaphase. Also localizes to the
spindle poles throughout mitosis and at the midbody at later
stages of mitosis (metaphase to telophase) (PubMed:17105772). In
interphase, colocalizes with nucleolin in the nucleolus
(PubMed:26089203). {ECO:0000269|PubMed:17105772,
ECO:0000269|PubMed:26089203}.
-!- SUBCELLULAR LOCATION: Chromosome {ECO:0000269|PubMed:17189189}.
Note=(Microbial infection) Colocalizes with bovine papillomavirus
type 1 regulatory protein E2 on mitotic chromosomes at early
stages of mitosis. {ECO:0000269|PubMed:17189189}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1;
IsoId=Q96FC9-1; Sequence=Displayed;
Name=2;
IsoId=Q96FC9-2; Sequence=VSP_016864, VSP_016865;
Name=3;
IsoId=Q96FC9-3; Sequence=VSP_016860, VSP_016864, VSP_016865;
Name=4;
IsoId=Q96FC9-4; Sequence=VSP_016863, VSP_016864, VSP_016865;
Name=5;
IsoId=Q96FC9-5; Sequence=VSP_016861, VSP_016862;
-!- TISSUE SPECIFICITY: Expressed in melanoma cells. Not detected in
epidermal melanocytes of normal skin (at protein level)
(PubMed:23116066). Highly expressed in spleen, B-cells, thymus,
testis, ovary, small intestine and pancreas (PubMed:9013641). Very
low expression seen in brain (PubMed:9013641). Expressed in
dividing cells and/or cells undergoing high levels of
recombination (PubMed:9013641). No expression detected in cells
signaled to terminally differentiate (PubMed:9013641). Expressed
weakly in keratinocytes (PubMed:8798685).
{ECO:0000269|PubMed:23116066, ECO:0000269|PubMed:8798685,
ECO:0000269|PubMed:9013641}.
-!- INDUCTION: Up-regulated by serum (at protein level)
(PubMed:26089203). Up-regulated by fibroblast growth factor FGF7
(PubMed:8798685). Expressed in keratinocyte growth factor-
stimulated cells but not in EGF and IL1-beta-treated keratinocytes
(PubMed:8798685). Up-regulated with progression from noninvasive
to invasive melanoma (PubMed:23116066).
{ECO:0000269|PubMed:23116066, ECO:0000269|PubMed:26089203,
ECO:0000269|PubMed:8798685}.
-!- DISEASE: Warsaw breakage syndrome (WBRS) [MIM:613398]: A syndrome
characterized by severe microcephaly, pre- and postnatal growth
retardation, facial dysmorphism and abnormal skin pigmentation.
Additional features include high arched palate, coloboma of the
right optic disk, deafness, ventricular septal defect, toes and
fingers abnormalities. At cellular level, drug-induced chromosomal
breakage, a feature of Fanconi anemia, and sister chromatid
cohesion defects, a feature of Roberts syndrome, coexist.
{ECO:0000269|PubMed:20137776, ECO:0000269|PubMed:23033317,
ECO:0000269|PubMed:26089203}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the DEAD box helicase family. DEAH
subfamily. DDX11/CHL1 sub-subfamily. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=CAA67895.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=CAA67895.1; Type=Frameshift; Positions=644, 648; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=DEAD/H (Asp-Glu-Ala-Asp/His) box helicase 11
(DDX11); Note=Leiden Open Variation Database (LOVD);
URL="http://www.lovd.nl/DDX11";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; X99583; CAA67895.1; ALT_SEQ; mRNA.
EMBL; U33833; AAB06962.1; -; mRNA.
EMBL; U75967; AAB18749.1; -; mRNA.
EMBL; U75968; AAB18750.1; -; mRNA.
EMBL; BC050069; AAH50069.1; -; mRNA.
EMBL; BC050522; AAH50522.1; -; mRNA.
CCDS; CCDS41767.1; -. [Q96FC9-2]
CCDS; CCDS44856.1; -. [Q96FC9-1]
CCDS; CCDS58224.1; -. [Q96FC9-3]
CCDS; CCDS8721.1; -. [Q96FC9-4]
PIR; G02071; G02071.
RefSeq; NP_001244073.1; NM_001257144.1. [Q96FC9-1]
RefSeq; NP_001244074.1; NM_001257145.1. [Q96FC9-3]
RefSeq; NP_004390.3; NM_004399.2. [Q96FC9-4]
RefSeq; NP_689651.1; NM_152438.1. [Q96FC9-1]
RefSeq; XP_016874421.1; XM_017018932.1. [Q96FC9-2]
UniGene; Hs.443960; -.
ProteinModelPortal; Q96FC9; -.
BioGrid; 108028; 37.
CORUM; Q96FC9; -.
IntAct; Q96FC9; 6.
STRING; 9606.ENSP00000384703; -.
iPTMnet; Q96FC9; -.
PhosphoSitePlus; Q96FC9; -.
BioMuta; DDX11; -.
DMDM; 74731686; -.
EPD; Q96FC9; -.
jPOST; Q96FC9; -.
MaxQB; Q96FC9; -.
PaxDb; Q96FC9; -.
PeptideAtlas; Q96FC9; -.
PRIDE; Q96FC9; -.
ProteomicsDB; 76511; -.
ProteomicsDB; 76512; -. [Q96FC9-2]
ProteomicsDB; 76513; -. [Q96FC9-3]
ProteomicsDB; 76514; -. [Q96FC9-4]
ProteomicsDB; 76515; -. [Q96FC9-5]
DNASU; 1663; -.
Ensembl; ENST00000228264; ENSP00000228264; ENSG00000013573. [Q96FC9-3]
Ensembl; ENST00000350437; ENSP00000309965; ENSG00000013573. [Q96FC9-4]
Ensembl; ENST00000435753; ENSP00000406799; ENSG00000013573. [Q96FC9-5]
Ensembl; ENST00000542838; ENSP00000443426; ENSG00000013573. [Q96FC9-2]
Ensembl; ENST00000545668; ENSP00000440402; ENSG00000013573. [Q96FC9-1]
GeneID; 1663; -.
KEGG; hsa:1663; -.
UCSC; uc001rjr.2; human. [Q96FC9-1]
CTD; 1663; -.
DisGeNET; 1663; -.
EuPathDB; HostDB:ENSG00000013573.16; -.
GeneCards; DDX11; -.
HGNC; HGNC:2736; DDX11.
HPA; HPA065197; -.
MalaCards; DDX11; -.
MIM; 601150; gene.
MIM; 613398; phenotype.
neXtProt; NX_Q96FC9; -.
OpenTargets; ENSG00000013573; -.
Orphanet; 280558; Warsaw breakage syndrome.
PharmGKB; PA27201; -.
eggNOG; KOG1133; Eukaryota.
eggNOG; COG1199; LUCA.
GeneTree; ENSGT00940000153853; -.
HOVERGEN; HBG058884; -.
InParanoid; Q96FC9; -.
KO; K11273; -.
OMA; HAINQSI; -.
OrthoDB; 186062at2759; -.
PhylomeDB; Q96FC9; -.
TreeFam; TF300435; -.
Reactome; R-HSA-381038; XBP1(S) activates chaperone genes.
GeneWiki; DDX11; -.
GenomeRNAi; 1663; -.
PRO; PR:Q96FC9; -.
Proteomes; UP000005640; Chromosome 12.
Bgee; ENSG00000013573; Expressed in 175 organ(s), highest expression level in small intestine Peyer's patch.
ExpressionAtlas; Q96FC9; baseline and differential.
Genevisible; Q96FC9; HS.
GO; GO:0005813; C:centrosome; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-KW.
GO; GO:0070062; C:extracellular exosome; HDA:UniProtKB.
GO; GO:0001650; C:fibrillar center; IDA:HPA.
GO; GO:0030496; C:midbody; IDA:UniProtKB.
GO; GO:0000790; C:nuclear chromatin; IDA:UniProtKB.
GO; GO:0005730; C:nucleolus; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; TAS:Reactome.
GO; GO:0005634; C:nucleus; IDA:HPA.
GO; GO:0000922; C:spindle pole; IDA:UniProtKB.
GO; GO:0051539; F:4 iron, 4 sulfur cluster binding; IEA:UniProtKB-KW.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0004003; F:ATP-dependent DNA helicase activity; IDA:UniProtKB.
GO; GO:0008026; F:ATP-dependent helicase activity; IDA:UniProtKB.
GO; GO:0003682; F:chromatin binding; IDA:UniProtKB.
GO; GO:0003677; F:DNA binding; IDA:UniProtKB.
GO; GO:0003688; F:DNA replication origin binding; IMP:UniProtKB.
GO; GO:0008094; F:DNA-dependent ATPase activity; IDA:UniProtKB.
GO; GO:0003690; F:double-stranded DNA binding; IDA:UniProtKB.
GO; GO:0051880; F:G-quadruplex DNA binding; IDA:UniProtKB.
GO; GO:0004386; F:helicase activity; IDA:UniProtKB.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0008186; F:RNA-dependent ATPase activity; IDA:UniProtKB.
GO; GO:0003697; F:single-stranded DNA binding; IDA:UniProtKB.
GO; GO:0003727; F:single-stranded RNA binding; IDA:UniProtKB.
GO; GO:0045142; F:triplex DNA binding; IDA:UniProtKB.
GO; GO:1904976; P:cellular response to bleomycin; IMP:UniProtKB.
GO; GO:0072719; P:cellular response to cisplatin; IMP:UniProtKB.
GO; GO:0006974; P:cellular response to DNA damage stimulus; IMP:UniProtKB.
GO; GO:0072711; P:cellular response to hydroxyurea; IMP:UniProtKB.
GO; GO:0032508; P:DNA duplex unwinding; IDA:UniProtKB.
GO; GO:0006281; P:DNA repair; IEA:UniProtKB-KW.
GO; GO:0034085; P:establishment of sister chromatid cohesion; IBA:GO_Central.
GO; GO:0044806; P:G-quadruplex DNA unwinding; IDA:UniProtKB.
GO; GO:0036498; P:IRE1-mediated unfolded protein response; TAS:Reactome.
GO; GO:0007275; P:multicellular organism development; IEA:UniProtKB-KW.
GO; GO:0032091; P:negative regulation of protein binding; IMP:UniProtKB.
GO; GO:1990700; P:nucleolar chromatin organization; IMP:UniProtKB.
GO; GO:0035563; P:positive regulation of chromatin binding; IDA:UniProtKB.
GO; GO:2000781; P:positive regulation of double-strand break repair; IMP:UniProtKB.
GO; GO:0032079; P:positive regulation of endodeoxyribonuclease activity; IDA:UniProtKB.
GO; GO:0045876; P:positive regulation of sister chromatid cohesion; IMP:UniProtKB.
GO; GO:1901838; P:positive regulation of transcription of nucleolar large rRNA by RNA polymerase I; IMP:UniProtKB.
GO; GO:0031297; P:replication fork processing; IMP:UniProtKB.
GO; GO:0007062; P:sister chromatid cohesion; IDA:UniProtKB.
GO; GO:0016032; P:viral process; IEA:UniProtKB-KW.
InterPro; IPR006555; ATP-dep_Helicase_C.
InterPro; IPR010614; DEAD_2.
InterPro; IPR014013; Helic_SF1/SF2_ATP-bd_DinG/Rad3.
InterPro; IPR006554; Helicase-like_DEXD_c2.
InterPro; IPR027417; P-loop_NTPase.
InterPro; IPR013020; Rad3/Chl1-like.
Pfam; PF06733; DEAD_2; 1.
Pfam; PF13307; Helicase_C_2; 1.
SMART; SM00488; DEXDc2; 1.
SMART; SM00491; HELICc2; 1.
SUPFAM; SSF52540; SSF52540; 1.
TIGRFAMs; TIGR00604; rad3; 1.
PROSITE; PS51193; HELICASE_ATP_BIND_2; 1.
1: Evidence at protein level;
4Fe-4S; Activator; Alternative splicing; ATP-binding; Chromosome;
Complete proteome; Cytoplasm; Cytoskeleton; Developmental protein;
Disease mutation; DNA damage; DNA repair; DNA replication;
DNA-binding; Helicase; Host-virus interaction; Hydrolase; Iron;
Iron-sulfur; Metal-binding; Nucleotide-binding; Nucleus;
Phosphoprotein; Polymorphism; Reference proteome; RNA-binding;
Transcription; Transcription regulation.
CHAIN 1 970 ATP-dependent DNA helicase DDX11.
/FTId=PRO_0000055136.
DOMAIN 9 445 Helicase ATP-binding.
{ECO:0000255|PROSITE-ProRule:PRU00541}.
NP_BIND 44 51 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00541}.
MOTIF 393 396 DEAH box.
COMPBIAS 163 224 Glu-rich.
METAL 267 267 Iron-sulfur (4Fe-4S). {ECO:0000250}.
METAL 285 285 Iron-sulfur (4Fe-4S). {ECO:0000250}.
METAL 315 315 Iron-sulfur (4Fe-4S). {ECO:0000250}.
METAL 350 350 Iron-sulfur (4Fe-4S). {ECO:0000250}.
MOD_RES 262 262 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
VAR_SEQ 1 26 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_016860.
VAR_SEQ 214 288 VDEDEDDLEEEHITKIYYCSRTHSQLAQFVHEVKKSPFGKD
VRLVSLGSRQNLCVNEDVKSLGSVQLINDRCVDM -> APS
DATSSRHPPDASFPAALNFLQRTRPSSVLSEDLLMQRAVAK
HPALLPWQMSSSPLRPGSEWMRMRMTWRKNT (in
isoform 5). {ECO:0000303|Ref.3}.
/FTId=VSP_016861.
VAR_SEQ 289 970 Missing (in isoform 5).
{ECO:0000303|Ref.3}.
/FTId=VSP_016862.
VAR_SEQ 685 734 Missing (in isoform 4).
{ECO:0000303|PubMed:8798685}.
/FTId=VSP_016863.
VAR_SEQ 820 906 SPRPGTPREGSGGEPVHEGRQPVHRQGHQAPEGFCQRSAPG
PAICPAPCPGQAAGLDPSPCGGQSYLWPRHCCCAEVSPGEV
GLFLM -> PRAPGQAPPGKALVENLCMKAVNQSIGRAIRH
QKDFASVVLLDQRYARPPVLAKLPAWIRARVEVKATFGPAI
AAVQKFHREKSASS (in isoform 2, isoform 3
and isoform 4).
{ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:8798685,
ECO:0000303|PubMed:9013641,
ECO:0000303|Ref.3}.
/FTId=VSP_016864.
VAR_SEQ 907 970 Missing (in isoform 2, isoform 3 and
isoform 4). {ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:8798685,
ECO:0000303|PubMed:9013641,
ECO:0000303|Ref.3}.
/FTId=VSP_016865.
VARIANT 39 39 I -> S. {ECO:0000269|PubMed:8798685}.
/FTId=VAR_024808.
VARIANT 263 263 R -> Q (in WBRS; impairs the helicase
activity by perturbing its DNA binding
and DNA-dependent ATPase activity;
reduces binding to rDNA promoter and
promotion of rDNA transcription;
dbSNP:rs201968272).
{ECO:0000269|PubMed:23033317,
ECO:0000269|PubMed:26089203}.
/FTId=VAR_069099.
VARIANT 567 567 Q -> E (in dbSNP:rs2075322).
{ECO:0000269|PubMed:9013641,
ECO:0000269|Ref.3}.
/FTId=VAR_024809.
VARIANT 575 575 T -> M (in dbSNP:rs17857386).
{ECO:0000269|Ref.3}.
/FTId=VAR_024810.
VARIANT 856 856 R -> H (in dbSNP:rs1046457).
/FTId=VAR_052175.
VARIANT 864 864 C -> R (in dbSNP:rs3893679).
/FTId=VAR_052176.
VARIANT 951 951 C -> R (in dbSNP:rs1046458).
/FTId=VAR_052177.
VARIANT 966 966 W -> C (in dbSNP:rs14330).
/FTId=VAR_052178.
MUTAGEN 50 50 K->R: Loss of both DNA-dependent ATPase
and ATP-dependent helicase activities.
{ECO:0000269|PubMed:10648783,
ECO:0000269|PubMed:18499658,
ECO:0000269|PubMed:22102414}.
SEQUENCE 970 AA; 108313 MW; 5BF49FE74E912B48 CRC64;
MANETQKVGA IHFPFPFTPY SIQEDFMAEL YRVLEAGKIG IFESPTGTGK SLSLICGALS
WLRDFEQKKR EEEARLLETG TGPLHDEKDE SLCLSSSCEG AAGTPRPAGE PAWVTQFVQK
KEERDLVDRL KAEQARRKQR EERLQQLQHR VQLKYAAKRL RQEEEERENL LRLSREMLET
GPEAERLEQL ESGEEELVLA EYESDEEKKV ASRVDEDEDD LEEEHITKIY YCSRTHSQLA
QFVHEVKKSP FGKDVRLVSL GSRQNLCVNE DVKSLGSVQL INDRCVDMQR SRHEKKKGAE
EEKPKRRRQE KQAACPFYNH EQMGLLRDEA LAEVKDMEQL LALGKEARAC PYYGSRLAIP
AAQLVVLPYQ MLLHAATRQA AGIRLQDQVV IIDEAHNLID TITGMHSVEV SGSQLCQAHS
QLLQYVERYG KRLKAKNLMY LKQILYLLEK FVAVLGGNIK QNPNTQSLSQ TGTELKTIND
FLFQSQIDNI NLFKVQRYCE KSMISRKLFG FTERYGAVFS SREQPKLAGF QQFLQSLQPR
TTEALAAPAD ESQASTLRPA SPLMHIQGFL AALTTANQDG RVILSRQGSL SQSTLKFLLL
NPAVHFAQVV KECRAVVIAG GTMQPVSDFR QQLLACAGVE AERVVEFSCG HVIPPDNILP
LVICSGISNQ PLEFTFQKRE LPQMMDEVGR ILCNLCGVVP GGVVCFFPSY EYLRQVHAHW
EKGGLLGRLA ARKKIFQEPK SAHQVEQVLL AYSRCIQACG QERGQVTGAL LLSVVGGKMS
EGINFSDNLG RCVVMVGMPF PNIRSAELQE KMAYLDQTLS PRPGTPREGS GGEPVHEGRQ
PVHRQGHQAP EGFCQRSAPG PAICPAPCPG QAAGLDPSPC GGQSYLWPRH CCCAEVSPGE
VGLFLMGNHT TAWRRALPLS CPLETVFVVG VVCGDPVTKV KPRRRVWSPE CCQDPGTGVS
SRRRKWGNPE


Related products :

Catalog number Product name Quantity
EIAAB10756 CHL1,CHL1-related protein 1,CHLR1,DDX11,DEAD_H box protein 11,hCHLR1,Homo sapiens,Human,Keratinocyte growth factor-regulated gene 2 protein,KRG2,KRG-2,Probable ATP-dependent RNA helicase DDX11
EIAAB10794 ATP-dependent RNA helicase DDX42,DDX42,DEAD box protein 42,Homo sapiens,Human,RHELP,RNA helicase-like protein,RNA helicase-related protein,RNAHP,SF3b DEAD box protein,SF3b125,Splicing factor 3B-associ
EIAAB10696 ATP-dependent RNA helicase DDX19A,Ddx19,Ddx19a,DEAD box protein 19A,DEAD box RNA helicase DEAD5,Eif4a-rs1,Eukaryotic translation initiation factor 4A-related sequence 1,mDEAD5,Mouse,Mus musculus
EIAAB10762 ATP-dependent RNA helicase DDX18,DDX18,DEAD box protein 18,Homo sapiens,Human,MrDb,Myc-regulated DEAD box protein
EIAAB10824 ATP-dependent 61 kDa nucleolar RNA helicase,DDX21,DDX56,DEAD box protein 21,DEAD box protein 56,Homo sapiens,Human,NOH61,Probable ATP-dependent RNA helicase DDX56
EIAAB10783 ATP-dependent RNA helicase DDX3X,D1Pas1-related sequence 2,D1Pas1-rs2,Ddx3,Ddx3x,DEAD box protein 3, X-chromosomal,DEAD box RNA helicase DEAD3,Dead3,Embryonic RNA helicase,Erh,mDEAD3,Mouse,Mus musculu
EIAAB10759 DDX17,DEAD box protein 17,DEAD box protein p72,Homo sapiens,Human,Probable ATP-dependent RNA helicase DDX17,RNA-dependent helicase p72
EIAAB10815 CAGE,Cancer_testis antigen 26,Cancer-associated gene protein,CT26,DDX53,DEAD box protein 53,DEAD box protein CAGE,Homo sapiens,Human,Probable ATP-dependent RNA helicase DDX53
EIAAB10757 Ddx11,DEAD_H box protein 11,Mouse,Mus musculus,Probable ATP-dependent RNA helicase DDX11
EIAAB10774 ATP-dependent RNA helicase DDX25,Ddx25,DEAD box protein 25,Gonadotropin-regulated testicular RNA helicase,Grth,Mouse,Mus musculus
EIAAB10772 ATP-dependent RNA helicase DDX25,Ddx25,DEAD box protein 25,Gonadotropin-regulated testicular RNA helicase,Grth,Rat,Rattus norvegicus
EIAAB10771 ATP-dependent RNA helicase DDX25,DDX25,DEAD box protein 25,Gonadotropin-regulated testicular RNA helicase,GRTH,Homo sapiens,Human
EIAAB10758 CHL1-related protein 2,CHLR2,DDX12,DDX12P,DEAD_H box protein 12,hCHLR2,Homo sapiens,Human,Putative ATP-dependent RNA helicase DDX12
EIAAB10782 ATP-dependent RNA helicase DDX3X,DBX,DDX3,DDX3X,DEAD box protein 3, X-chromosomal,DEAD box, X isoform,Helicase-like protein 2,HLP2,Homo sapiens,Human
EIAAB10817 ATP-dependent RNA helicase DDX54,ATP-dependent RNA helicase DP97,DDX54,DEAD box protein 54,DEAD box RNA helicase 97 kDa,Homo sapiens,Human
EIAAB10763 Component of gems 3,Ddx20,DEAD box protein 20,DEAD box protein DP 103,Dp103,Gemin3,Gemin-3,Mouse,Mus musculus,Probable ATP-dependent RNA helicase DDX20,Regulator of steroidogenic factor 1,ROSF-1
EIAAB10806 Ddx5,DEAD box protein 5,DEAD box RNA helicase DEAD1,mDEAD1,Mouse,Mus musculus,Probable ATP-dependent RNA helicase DDX5,RNA helicase p68,Tnz2
D11L8_HUMAN ELISA Kit FOR Putative ATP-dependent RNA helicase DDX11-like protein 8; organism: Human; gene name: DDX11L8 96T
EIAAB10785 ATP-dependent RNA helicase DDX3Y,D1Pas1-related sequence 1,D1Pas1-rs1,Ddx3y,DEAD box protein 3, Y-chromosomal,Dead2,DEAD-box RNA helicase DEAD2,mDEAD2,Mouse,Mus musculus
18-003-42774 Spliceosome RNA helicase BAT1 - EC 3.6.1.-; DEAD box protein UAP56; 56 kDa U2AF65-associated protein; ATP-dependent RNA helicase p47; HLA-B-associated transcript-1 Polyclonal 0.05 mg Aff Pur
EIAAB10825 DDX58,DEAD box protein 58,Pig,Probable ATP-dependent RNA helicase DDX58,Retinoic acid-inducible gene 1 protein,Retinoic acid-inducible gene I protein,RHIV-1,RIG-1,RIG-I,RNA helicase induced by virus,S
EIAAB10334 DDX11L8,DEAD_H box protein 11-like 8,Homo sapiens,Human,Putative ATP-dependent RNA helicase DDX11-like protein 8
18-003-42773 Probable ATP-dependent RNA helicase DDX6 - EC 3.6.1.-; DEAD box protein 6; ATP-dependent RNA helicase p54; Oncogene RCK Polyclonal 0.1 mg Protein A
EIAAB10697 ATP-dependent RNA helicase DDX19B,DBP5,DDX19,DDX19B,DEAD box protein 19B,DEAD box RNA helicase DEAD5,Homo sapiens,Human,TDBP
EIAAB12133 ATP-dependent RNA helicase DDX39A,Ddx39,Ddx39a,Ddxl,DEAD box protein 39,Nuclear RNA helicase, DECD variant of DEAD box family,Rat,Rattus norvegicus

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1672: Mismatch repair
WP1678: Nucleotide excision repair
WP1493: Carbon assimilation C4 pathway
WP1625: Base excision repair
WP1676: Non-homologous end-joining
WP2199: Seed Development
WP2272: Pathogenic Escherichia coli infection
WP731: Sterol regulatory element binding protein related
WP1049: G Protein Signaling Pathways
WP1165: G Protein Signaling Pathways
WP1371: G Protein Signaling Pathways
WP1438: Influenza A virus infection
WP1502: Mitochondrial biogenesis
WP1531: Vitamin D synthesis
WP1566: Citrate cycle (TCA cycle)
WP1613: 1,4-Dichlorobenzene degradation
WP1616: ABC transporters
WP1624: Bacterial secretion system
WP1644: DNA replication
WP1650: Fluorobenzoate degradation
WP1654: gamma-Hexachlorocyclohexane degradation
WP1657: Glycerolipid metabolism
WP1659: Glycine, serine and threonine metabolism
WP1661: Glyoxylate and dicarboxylate metabolism
WP1663: Homologous recombination

Related Genes :
[DDX11 CHL1 CHLR1 KRG2] ATP-dependent DNA helicase DDX11 (EC 3.6.4.12) (CHL1-related protein 1) (hCHLR1) (DEAD/H-box protein 11) (Keratinocyte growth factor-regulated gene 2 protein) (KRG-2)
[Ddx11] ATP-dependent DNA helicase DDX11 (EC 3.6.4.12) (DEAD/H-box protein 11)
[NPF6.3 CHL1 NRT1 NRT1.1 At1g12110 F12F1.1 T28K15_13] Protein NRT1/ PTR FAMILY 6.3 (AtNPF6.3) (Nitrate transporter 1.1) (AtNRT1) (Nitrate/chlorate transporter) (Protein CHLORINA 1)
[Ddx3x D1Pas1-rs2 Ddx3 Dead3 Erh] ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (D1Pas1-related sequence 2) (DEAD box RNA helicase DEAD3) (mDEAD3) (DEAD box protein 3, X-chromosomal) (Embryonic RNA helicase)
[1a] Replicase polyprotein 1a (pp1a) (ORF1a polyprotein) [Cleaved into: Non-structural protein 1 (nsp1) (Leader protein); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.69) (PL2-PRO) (Papain-like proteinase) (PL-PRO) (SARS coronavirus main proteinase); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (nsp5); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); Non-structural protein 11 (nsp11)]
[DDX3X DBX DDX3] ATP-dependent RNA helicase DDX3X (EC 3.6.4.13) (DEAD box protein 3, X-chromosomal) (DEAD box, X isoform) (Helicase-like protein 2) (HLP2)
[rep 1a-1b] Replicase polyprotein 1ab (ORF1ab polyprotein) [Cleaved into: Nsp1 (EC 3.4.22.-); Nsp1-alpha papain-like cysteine proteinase (EC 3.4.22.-) (PCP1-alpha); Nsp1-beta papain-like cysteine proteinase (EC 3.4.22.-) (PCP1-beta); Nsp2 cysteine proteinase (EC 3.4.19.12) (EC 3.4.22.-) (CP2) (CP); Non-structural protein 3 (Nsp3); Serine protease nsp4 (3CLSP) (EC 3.4.21.-) (3C-like serine proteinase) (Nsp4); Non-structural protein 5-6-7 (Nsp5-6-7); Non-structural protein 5 (Nsp5); Non-structural protein 6 (Nsp6); Non-structural protein 7-alpha (Nsp7-alpha); Non-structural protein 7-beta (Nsp7-beta); Non-structural protein 8 (Nsp8); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (Nsp9); Helicase nsp10 (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (Nsp10); Non-structural protein 11 (Nsp11); Non-structural protein 12 (Nsp12)]
[DHX36 DDX36 KIAA1488 MLEL1 RHAU] ATP-dependent DNA/RNA helicase DHX36 (EC 3.6.4.12) (EC 3.6.4.13) (DEAD/H box polypeptide 36) (DEAH-box protein 36) (G4-resolvase-1) (G4R1) (MLE-like protein 1) (RNA helicase associated with AU-rich element protein)
[Eif4a3 Ddx48] Eukaryotic initiation factor 4A-III (eIF-4A-III) (eIF4A-III) (EC 3.6.4.13) (ATP-dependent RNA helicase DDX48) (ATP-dependent RNA helicase eIF4A-3) (DEAD box protein 48) (Eukaryotic translation initiation factor 4A isoform 3) [Cleaved into: Eukaryotic initiation factor 4A-III, N-terminally processed]
[] Genome polyprotein [Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)]
[chl1 NCU11409] ATP-dependent DNA helicase chl1 (EC 3.6.4.12) (Chromosome loss protein 1)
[repD ercc2 DDB_G0267414] General transcription and DNA repair factor IIH helicase subunit XPD (TFIIH subunit XPD) (EC 3.6.4.12) (DNA excision repair cross-complementing protein-2 homolog) (DNA repair protein D) (TFIIH basal transcription factor complex helicase repD subunit)
[Dhx36 Ddx36 Kiaa1488 Mlel1] ATP-dependent DNA/RNA helicase DHX36 (EC 3.6.4.13) (DEAD/H box polypeptide 36) (DEAH box protein 36) (MLE-like protein 1) (RNA helicase associated with AU-rich element ARE)
[DDX17] Probable ATP-dependent RNA helicase DDX17 (EC 3.6.4.13) (DEAD box protein 17) (DEAD box protein p72) (DEAD box protein p82) (RNA-dependent helicase p72)
[rep 1a-1b] Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Cleaved into: Non-structural protein 1 (nsp1) (p9); Non-structural protein 2 (nsp2) (p87); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL1-PRO/PL2-PRO) (PLP1/PLP2) (Papain-like proteinases 1/2) (p195); Non-structural protein 4 (nsp4) (Peptide HD2); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (M-PRO) (nsp5) (p34); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7) (p5); Non-structural protein 8 (nsp8) (p23); Non-structural protein 9 (nsp9) (p12); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL) (p14); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (nsp12) (p100); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (nsp13) (p66) (p66-HEL); Exoribonuclease (ExoN) (EC 3.1.13.-) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (nsp15) (p41); Putative 2'-O-methyl transferase (EC 2.1.1.-) (nsp16)]
[] Genome polyprotein [Cleaved into: Core protein p21 (Capsid protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); Viroporin p7; Protease NS2-3 (p23) (EC 3.4.22.-); Serine protease NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3P) (p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)]
[rep 1a-1b] Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Cleaved into: Non-structural protein 1 (nsp1) (p9); Non-structural protein 2 (nsp2) (p87); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL1-PRO/PL2-PRO) (PLP1/PLP2) (Papain-like proteinases 1/2) (p195); Non-structural protein 4 (nsp4) (Peptide HD2); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (M-PRO) (nsp5) (p34); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7) (p5); Non-structural protein 8 (nsp8) (p23); Non-structural protein 9 (nsp9) (p12); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL) (p14); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (nsp12) (p100); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (nsp13) (p66) (p66-HEL); Exoribonuclease (ExoN) (EC 3.1.13.-) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (nsp15) (p41); Putative 2'-O-methyl transferase (EC 2.1.1.-) (nsp16)]
[DHX36] ATP-dependent DNA/RNA helicase DHX36 (EC 3.6.4.12) (EC 3.6.4.13) (DEAD/H box polypeptide 36) (DEAH-box protein 36) (G4-resolvase-1) (G4R1) (MLE-like protein 1) (RNA helicase associated with AU-rich element protein)
[] Genome polyprotein [Cleaved into: Capsid protein C (Capsid protein) (Core protein); Protein prM (Precursor membrane protein); Peptide pr (Peptide precursor); Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)]
[Dhx36] ATP-dependent DNA/RNA helicase DHX36 (EC 3.6.4.12) (EC 3.6.4.13) (DEAD/H box polypeptide 36) (DEAH-box protein 36) (G4-resolvase-1) (G4R1) (MLE-like protein 1) (RNA helicase associated with AU-rich element protein)
[EIF4A3 RH2 At3g19760 MMB12.25 MMB12.4] Eukaryotic initiation factor 4A-III homolog (AteIF4AIII) (eIF-4A-III) (eIF4A-III) (EC 3.6.4.13) (DEAD-box ATP-dependent RNA helicase 2) (AtRH02)
[EIF4A3 DDX48 KIAA0111] Eukaryotic initiation factor 4A-III (eIF-4A-III) (eIF4A-III) (EC 3.6.4.13) (ATP-dependent RNA helicase DDX48) (ATP-dependent RNA helicase eIF4A-3) (DEAD box protein 48) (Eukaryotic initiation factor 4A-like NUK-34) (Eukaryotic translation initiation factor 4A isoform 3) (Nuclear matrix protein 265) (NMP 265) (hNMP 265) [Cleaved into: Eukaryotic initiation factor 4A-III, N-terminally processed]
[rep 1a-1b] Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Cleaved into: Non-structural protein 1 (nsp1) (p9); Non-structural protein 2 (nsp2) (p87); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL1-PRO/PL2-PRO) (PLP1/PLP2) (Papain-like proteinases 1/2) (p195); Non-structural protein 4 (nsp4) (Peptide HD2); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (M-PRO) (nsp5) (p34); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7) (p5); Non-structural protein 8 (nsp8) (p23); Non-structural protein 9 (nsp9) (p12); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL) (p16); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (nsp12) (p100); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (nsp13) (p66) (p66-HEL); Exoribonuclease (ExoN) (EC 3.1.13.-) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (nsp15) (p41); Putative 2'-O-methyl transferase (EC 2.1.1.-) (nsp16)]
[DDX58] Probable ATP-dependent RNA helicase DDX58 (EC 3.6.4.13) (DEAD box protein 58) (RIG-I-like receptor 1) (RLR-1) (Retinoic acid-inducible gene 1 protein) (RIG-1) (Retinoic acid-inducible gene I protein) (RIG-I)
[rep 1a-1b] Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Cleaved into: Non-structural protein 1 (nsp1) (p9); Non-structural protein 2 (nsp2) (p87); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL1-PRO/PL2-PRO) (PLP1/PLP2) (Papain-like proteinases 1/2) (p195); Non-structural protein 4 (nsp4) (Peptide HD2); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (M-PRO) (nsp5) (p34); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7) (p5); Non-structural protein 8 (nsp8) (p23); Non-structural protein 9 (nsp9) (p12); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL) (p14); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (nsp12) (p100); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (nsp13) (p66) (p66-HEL); Exoribonuclease (ExoN) (EC 3.1.13.-) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (nsp15); Putative 2'-O-methyl transferase (EC 2.1.1.-) (nsp16)]
[] Genome polyprotein [Cleaved into: Core protein p21 (Capsid protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (p23) (EC 3.4.22.-); Serine protease NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3P) (p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)]
[Smarca4 Baf190a Brg1 Snf2b Snf2l4] Transcription activator BRG1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA4) (BRG1-associated factor 190A) (BAF190A) (Protein brahma homolog 1) (SNF2-beta) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4)
[SMARCA4 BAF190A BRG1 SNF2B SNF2L4] Transcription activator BRG1 (EC 3.6.4.-) (ATP-dependent helicase SMARCA4) (BRG1-associated factor 190A) (BAF190A) (Mitotic growth and transcription activator) (Protein BRG-1) (Protein brahma homolog 1) (SNF2-beta) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4)
[rep 1a-1b] Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein) [Cleaved into: Non-structural protein 1 (nsp1) (p9); Non-structural protein 2 (nsp2) (p87); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.-) (PL1-PRO/PL2-PRO) (PLP1/PLP2) (Papain-like proteinases 1/2) (p195); Non-structural protein 4 (nsp4) (Peptide HD2); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (M-PRO) (nsp5) (p34); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7) (p5); Non-structural protein 8 (nsp8) (p23); Non-structural protein 9 (nsp9) (p12); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL) (p14); RNA-directed RNA polymerase (Pol) (RdRp) (EC 2.7.7.48) (nsp12) (p100); Helicase (Hel) (EC 3.6.4.12) (EC 3.6.4.13) (nsp13) (p66) (p66-HEL); Exoribonuclease (ExoN) (EC 3.1.13.-) (nsp14); Uridylate-specific endoribonuclease (EC 3.1.-.-) (NendoU) (nsp15); Putative 2'-O-methyl transferase (EC 2.1.1.-) (nsp16)]
[1a] Replicase polyprotein 1a (pp1a) (ORF1a polyprotein) [Cleaved into: Non-structural protein 1 (nsp1) (Leader protein); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.69) (PL2-PRO) (Papain-like proteinase) (PL-PRO); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (nsp5); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); Non-structural protein 11 (nsp11)]

Bibliography :
?>