GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Acetyl-CoA carboxylase 1 (ACC1) (EC 6.4.1.2) (ACC-alpha) [Includes: Biotin carboxylase (EC 6.3.4.14)]

 ACACA_SHEEP             Reviewed;        2346 AA.
Q28559; O62847; Q6KEV5;
15-JUL-1998, integrated into UniProtKB/Swiss-Prot.
01-NOV-1996, sequence version 1.
08-MAY-2019, entry version 127.
RecName: Full=Acetyl-CoA carboxylase 1;
Short=ACC1;
EC=6.4.1.2;
AltName: Full=ACC-alpha;
Includes:
RecName: Full=Biotin carboxylase;
EC=6.3.4.14;
Name=ACACA; Synonyms=ACAC;
Ovis aries (Sheep).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;
Pecora; Bovidae; Caprinae; Ovis.
NCBI_TaxID=9940;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
STRAIN=Finn-Dorset; TISSUE=Adipose tissue;
PubMed=7890176; DOI=10.1016/0378-1119(94)00871-O;
Barber M.C., Travers M.T.;
"Cloning and characterisation of multiple acetyl-CoA carboxylase
transcripts in ovine adipose tissue.";
Gene 154:271-275(1995).
[2]
NUCLEOTIDE SEQUENCE [MRNA] OF 1-144 (ISOFORM 2), TISSUE SPECIFICITY,
AND INDUCTION BY LACTATION.
STRAIN=Finn-Dorset; TISSUE=Mammary gland;
PubMed=9639557; DOI=10.1042/bj3330017;
Barber M.C., Travers M.T.;
"Elucidation of a promoter activity that directs the expression of
acetyl-CoA carboxylase alpha with an alternative N-terminus in a
tissue-restricted fashion.";
Biochem. J. 333:17-25(1998).
[3]
NUCLEOTIDE SEQUENCE [MRNA] OF 1-93 (ISOFORM 3).
TISSUE=Brain;
PubMed=15607423; DOI=10.1016/j.ygeno.2004.10.001;
Travers M.T., Cambot M., Kennedy H.T., Lenoir G.M., Barber M.C.,
Joulin V.;
"Asymmetric expression of transcripts derived from the shared promoter
between the divergently oriented ACACA and TADA2L genes.";
Genomics 85:71-84(2005).
-!- FUNCTION: Catalyzes the rate-limiting reaction in the biogenesis
of long-chain fatty acids. Carries out three functions: biotin
carboxyl carrier protein, biotin carboxylase and
carboxyltransferase. {ECO:0000250|UniProtKB:Q13085}.
-!- CATALYTIC ACTIVITY:
Reaction=acetyl-CoA + ATP + hydrogencarbonate = ADP + H(+) +
malonyl-CoA + phosphate; Xref=Rhea:RHEA:11308,
ChEBI:CHEBI:15378, ChEBI:CHEBI:17544, ChEBI:CHEBI:30616,
ChEBI:CHEBI:43474, ChEBI:CHEBI:57288, ChEBI:CHEBI:57384,
ChEBI:CHEBI:456216; EC=6.4.1.2;
Evidence={ECO:0000250|UniProtKB:Q13085};
-!- CATALYTIC ACTIVITY:
Reaction=ATP + hydrogencarbonate + N(6)-biotinyl-L-lysyl-[protein]
= ADP + H(+) + N(6)-carboxybiotinyl-L-lysyl-[protein] +
phosphate; Xref=Rhea:RHEA:13501, Rhea:RHEA-COMP:10505,
Rhea:RHEA-COMP:10506, ChEBI:CHEBI:15378, ChEBI:CHEBI:17544,
ChEBI:CHEBI:30616, ChEBI:CHEBI:43474, ChEBI:CHEBI:83144,
ChEBI:CHEBI:83145, ChEBI:CHEBI:456216; EC=6.3.4.14;
Evidence={ECO:0000250|UniProtKB:Q13085};
-!- COFACTOR:
Name=biotin; Xref=ChEBI:CHEBI:57586;
Evidence={ECO:0000250|UniProtKB:O00763};
-!- COFACTOR:
Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250};
Note=Binds 2 manganese ions per subunit. {ECO:0000250};
-!- ACTIVITY REGULATION: By phosphorylation (By similarity). Activity
is increased by oligomerization. Citrate and MID1IP1 promote
oligomerization (By similarity). {ECO:0000250}.
-!- PATHWAY: Lipid metabolism; malonyl-CoA biosynthesis; malonyl-CoA
from acetyl-CoA: step 1/1.
-!- SUBUNIT: Monomer, homodimer, and homotetramer. Can form
filamentous polymers. Interacts in its inactive phosphorylated
form with the BRCT domains of BRCA1 which prevents ACACA
dephosphorylation and inhibits lipid synthesis. Interacts with
MID1IP1; interaction with MID1IP1 promotes oligomerization and
increases its activity (By similarity). {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Cytoplasm.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative promoter usage; Named isoforms=3;
Name=1;
IsoId=Q28559-1; Sequence=Displayed;
Name=2; Synonyms=E5A;
IsoId=Q28559-2; Sequence=VSP_026102;
Name=3;
IsoId=Q28559-3; Sequence=VSP_026103;
-!- TISSUE SPECIFICITY: Isoform 2 is expressed at high levels in
mammary gland. {ECO:0000269|PubMed:9639557}.
-!- INDUCTION: Isoform 2 is induced in mammary gland during lactation.
{ECO:0000269|PubMed:9639557}.
-!- PTM: Phosphorylation on Ser-1263 is required for interaction with
BRCA1. {ECO:0000250}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; X80045; CAA56352.1; -; mRNA.
EMBL; AJ001056; CAA04506.1; -; mRNA.
EMBL; AJ564445; CAD92090.1; -; mRNA.
RefSeq; NP_001009256.1; NM_001009256.1. [Q28559-1]
SMR; Q28559; -.
STRING; 9940.ENSOARP00000000876; -.
PRIDE; Q28559; -.
GeneID; 443186; -.
KEGG; oas:443186; -.
CTD; 31; -.
KO; K11262; -.
OrthoDB; 156081at2759; -.
UniPathway; UPA00655; UER00711.
Proteomes; UP000002356; Unplaced.
GO; GO:0005829; C:cytosol; ISS:UniProtKB.
GO; GO:0003989; F:acetyl-CoA carboxylase activity; ISS:UniProtKB.
GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
GO; GO:0004075; F:biotin carboxylase activity; IEA:UniProtKB-EC.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0006084; P:acetyl-CoA metabolic process; ISS:UniProtKB.
GO; GO:0006633; P:fatty acid biosynthetic process; ISS:UniProtKB.
GO; GO:2001295; P:malonyl-CoA biosynthetic process; IEA:UniProtKB-UniPathway.
GO; GO:0051289; P:protein homotetramerization; ISS:UniProtKB.
Gene3D; 3.30.1490.20; -; 1.
InterPro; IPR034733; AcCoA_carboxyl.
InterPro; IPR013537; AcCoA_COase_cen.
InterPro; IPR011761; ATP-grasp.
InterPro; IPR013815; ATP_grasp_subdomain_1.
InterPro; IPR005481; BC-like_N.
InterPro; IPR001882; Biotin_BS.
InterPro; IPR011764; Biotin_carboxylation_dom.
InterPro; IPR005482; Biotin_COase_C.
InterPro; IPR000089; Biotin_lipoyl.
InterPro; IPR005479; CbamoylP_synth_lsu-like_ATP-bd.
InterPro; IPR029045; ClpP/crotonase-like_dom_sf.
InterPro; IPR011763; COA_CT_C.
InterPro; IPR011762; COA_CT_N.
InterPro; IPR016185; PreATP-grasp_dom_sf.
InterPro; IPR011054; Rudment_hybrid_motif.
InterPro; IPR011053; Single_hybrid_motif.
Pfam; PF08326; ACC_central; 1.
Pfam; PF02785; Biotin_carb_C; 1.
Pfam; PF00289; Biotin_carb_N; 1.
Pfam; PF00364; Biotin_lipoyl; 1.
Pfam; PF01039; Carboxyl_trans; 1.
Pfam; PF02786; CPSase_L_D2; 1.
SMART; SM00878; Biotin_carb_C; 1.
SUPFAM; SSF51230; SSF51230; 1.
SUPFAM; SSF51246; SSF51246; 1.
SUPFAM; SSF52096; SSF52096; 2.
SUPFAM; SSF52440; SSF52440; 1.
PROSITE; PS50975; ATP_GRASP; 1.
PROSITE; PS50979; BC; 1.
PROSITE; PS00188; BIOTIN; 1.
PROSITE; PS50968; BIOTINYL_LIPOYL; 1.
PROSITE; PS50989; COA_CT_CTER; 1.
PROSITE; PS50980; COA_CT_NTER; 1.
PROSITE; PS00866; CPSASE_1; 1.
PROSITE; PS00867; CPSASE_2; 1.
2: Evidence at transcript level;
Acetylation; Allosteric enzyme; Alternative promoter usage;
ATP-binding; Biotin; Complete proteome; Cytoplasm;
Fatty acid biosynthesis; Fatty acid metabolism; Ligase;
Lipid biosynthesis; Lipid metabolism; Manganese; Metal-binding;
Multifunctional enzyme; Nucleotide-binding; Phosphoprotein;
Reference proteome.
CHAIN 1 2346 Acetyl-CoA carboxylase 1.
/FTId=PRO_0000146766.
DOMAIN 117 618 Biotin carboxylation.
DOMAIN 275 466 ATP-grasp. {ECO:0000255|PROSITE-
ProRule:PRU00409}.
DOMAIN 745 819 Biotinyl-binding. {ECO:0000255|PROSITE-
ProRule:PRU01066}.
DOMAIN 1576 1914 CoA carboxyltransferase N-terminal.
{ECO:0000255|PROSITE-ProRule:PRU01136}.
DOMAIN 1918 2234 CoA carboxyltransferase C-terminal.
{ECO:0000255|PROSITE-ProRule:PRU01137}.
NP_BIND 315 320 ATP. {ECO:0000255|PROSITE-
ProRule:PRU00409}.
REGION 1576 2234 Carboxyltransferase.
{ECO:0000255|PROSITE-ProRule:PRU01138}.
ACT_SITE 441 441 {ECO:0000250}.
METAL 424 424 Manganese 1. {ECO:0000250}.
METAL 437 437 Manganese 1. {ECO:0000250}.
METAL 437 437 Manganese 2. {ECO:0000250}.
METAL 439 439 Manganese 2. {ECO:0000250}.
BINDING 1823 1823 Coenzyme A. {ECO:0000250}.
BINDING 2127 2127 Coenzyme A. {ECO:0000250}.
BINDING 2129 2129 Coenzyme A. {ECO:0000250}.
MOD_RES 1 1 N-acetylmethionine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 5 5 Phosphoserine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 23 23 Phosphoserine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 25 25 Phosphoserine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 29 29 Phosphoserine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 34 34 Phosphoserine.
{ECO:0000250|UniProtKB:P11497}.
MOD_RES 48 48 Phosphoserine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 50 50 Phosphoserine.
{ECO:0000250|UniProtKB:P11497}.
MOD_RES 53 53 Phosphoserine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 58 58 Phosphothreonine.
{ECO:0000250|UniProtKB:Q5SWU9}.
MOD_RES 78 78 Phosphoserine.
{ECO:0000250|UniProtKB:P11497}.
MOD_RES 80 80 Phosphoserine; by AMPK.
{ECO:0000250|UniProtKB:Q5SWU9}.
MOD_RES 610 610 Phosphothreonine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 786 786 N6-biotinyllysine. {ECO:0000250,
ECO:0000255|PROSITE-ProRule:PRU01066}.
MOD_RES 835 835 Phosphoserine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 1201 1201 Phosphoserine.
{ECO:0000250|UniProtKB:P11497}.
MOD_RES 1216 1216 Phosphoserine.
{ECO:0000250|UniProtKB:P11497}.
MOD_RES 1218 1218 Phosphoserine.
{ECO:0000250|UniProtKB:Q5SWU9}.
MOD_RES 1227 1227 Phosphothreonine.
{ECO:0000250|UniProtKB:Q5SWU9}.
MOD_RES 1259 1259 Phosphoserine.
{ECO:0000250|UniProtKB:Q5SWU9}.
MOD_RES 1263 1263 Phosphoserine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 1273 1273 Phosphoserine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 1334 1334 N6-acetyllysine.
{ECO:0000250|UniProtKB:Q13085}.
MOD_RES 2153 2153 Phosphothreonine.
{ECO:0000250|UniProtKB:Q13085}.
VAR_SEQ 1 75 MGEPSSLAKPLELNQHSRFIIGSVSEDNSEDEISNLVKLDL
LEEKEGSLSPASVSSDTLSDLGISSLQDGLALHM -> MEG
SAEESKEMRYYMLQ (in isoform 2).
{ECO:0000303|PubMed:9639557}.
/FTId=VSP_026102.
VAR_SEQ 1 1 M -> MWWSTLMSILRASSFWKWISAQTIRIIRALRARFEG
TM (in isoform 3).
{ECO:0000303|PubMed:15607423}.
/FTId=VSP_026103.
SEQUENCE 2346 AA; 265251 MW; BCA010ADF6CD24EF CRC64;
MGEPSSLAKP LELNQHSRFI IGSVSEDNSE DEISNLVKLD LLEEKEGSLS PASVSSDTLS
DLGISSLQDG LALHMRSSMS GLHLVKQGRD RKKIDSQRDF TVASPAEFVT RFGGNKVIEK
VLIANNGIAA VKCMRSIRRW SYEMFRNERA IRFVVMVTPE DLKANAEYIK MADHYVPVPG
GPNNNNYANV ELILDIARRI PVQAVWAGWG HASENPKLPE LLLKNGIAFM GPPSQAMWAL
GDKIASSIVA QTAGIPTLPW SGSGLCVDWH ENDFSKRILN VPQELYEKGY VKDVDDGLKA
AEEVGYPVMI KASEGGGGKG IRKVNNADDF PNLFRQVQAE VPGSPIFVMR LAKQSRHLEV
QILADQYGNA ISLFGRDCSV QRRHQKIIEE APAAIATPAV FEHMEQCAVK LARMVGYVSA
GTVEYLYSQD GSFYFLELNP RLQVEHPCTE MVADVNLPAA QLQIAMGIPL YRIKDIRMMY
GVSPWGDAPI DFENSAHVPC PRGHVIAARI TSENPDEGFK PSSGTVQELN FRSNKNVWGY
FSVAAAGGLH EFADSQFGHC FSWGENREEA ISNMVVALKE LSIRGDFRTT VEYLIKLLET
ESFQLNRIDT GWLDRLIAEK VQAERPDTML GVVCGALHVA DVSLRNSISN FLHSLERGQV
LSAHTLLNTV DVELIYEGEK IVLKVTRQSP NSYVVIMNGS CVEVDVHRLS DGGLLLSYDG
SSYTTYMKEE VDRYRITIGN KTCVFEKEND PSVLRSPSAG KLIQYIVEDG GHVFAGQCYA
EIEVMKMVMT LTAAESGCIH YVKRPGAALD PGCVIAKMQL DNPSKVQQAE LHTGSLPRIQ
STALRGEKLH RVFHYVLDNL VNVMNGYCLP DPFFSSRVKD WVEGLMKTLR DPSLPLLELQ
DIMTSVSGRI PPNVEKSIKK EMAQYASNIT SVLCQFPSQQ IANILDSHAA TLNRKSEREV
FFMNTQSIVQ LVQRYRSGIR GHMKAVVMDL LRQYLRVETQ FQNGHYDKCV FALREENKSD
MNTVLNYIFS HAQVTKKNLL VTMLIDQLCG RDPTLTDELL NILTELTQLS KTTNAKVALR
ARQVLIASHL PSYELRHNQV ESIFLSAIDM YGHQFCIENL QKLILSETSI FDVLPNFFYH
SNQVVRMAAL EVYVRRAYIA YELNSVQHRQ LKDNTCVVEF QFMLPTSHPN RGNIPTLNRM
SFSSNLNHYG MTHVASVSDV LLDNAFTPPC QRMGGMVSFR TFEDFVRIFD EVMGCFCDSP
PQSPTFPEAG HTSLYDEDKV PRDEPIHILN VAIKTDCDIE DDSLAAMFRE FTQQNKATLV
EHGIRRLTFL VAQKDFRKQV NYEVDQRFHR EFPKFFTFRA RDKFEEDRIY RHLEPALAFQ
LELNRMRNFD LTAIPCANHK MHLYLGAAKV EVGTEVTDYR FFVRAIIRHS DLVTKEASFE
YLQNEGERLL LEAMDELEVA FNNTNVRTDC NHIFLNFVPT VIMDPSKIEE SVRSMVMRYG
SRLWKLRVLQ AELKINIRLT PTGKAIPIRL FLTNESGYYL DISLYKEVTD SRTAQIMFQA
YGDKQGPLHG MLINTPYVTK DLLQSKRFQA QSLGTTYIYD IPEMFRQSLI KLWESMSSQA
FLPPPPLPSD ILTYTELVLD DQGQLVHMNR LPGGNEIGMV AWKMTLKSPE YPDGRDIIVI
GNDITYRIGS FGPQEDLLFL RASELARAEG IPRIYVAANS GARIGLAEEI RHMFHVAWVD
PEDPYKGYKY LYLTPQDYKR VSALNSVHCE HVEDEGESRY KITDIIGKEE GLGAENLRGS
GMIAGESSLA YDEIITISLV TCRAIGIGAY LVRLGQRTIQ VENSHLILTG AGALNKVLGR
EVYTSNNQLG GIQIMHNNGV THSTVCDDFE GVFTVLHWLS YMPKSVYSSV PLLNSKDPID
RVIEFVPTKA PYDPRWMLAG RPHPTQKGQW LSGFFDYGSF SEIMQPWAQT VVVGRARLGG
IPVGVVAVET RTVELSIPAD PANLDSEAKI IQQAGQVWFP DSAFKTYQAI KDFNREGLPL
MVFANWRGFS GGMKDMYDQV LKFGAYIVDG LRECSQPVMV YIPPQAELRG GSWVVIDPTI
NPRHMEMYAD RESRGSVLEP EGTVEIKFRR KDLVKTMRRV DPVYIHLAER LGTPELSARE
RKELESKLKE REEFLLPIYH QVAVQFADLH DTPGRMQEKG VINDILDWKT SRTFFYWRLR
RLLLEDLVKK KIHNANPELT DGQIQAMLRR WFVEVEGTVK AYVWDNNKDL VEWLEKQLTE
EDGVRSVIEE NIKYISRDYV LKQIRSLVQA NPEVAMDSIV HMTQHISPTQ RAEVVRILST
MDSPST


Related products :

Catalog number Product name Quantity
U1284m CLIA Acac,Acaca,ACC1,ACC-alpha,Acetyl-CoA carboxylase 1,Acetyl-CoA carboxylase 265,Gm738,Mouse,Mus musculus 96T
E1284m ELISA kit Acac,Acaca,ACC1,ACC-alpha,Acetyl-CoA carboxylase 1,Acetyl-CoA carboxylase 265,Gm738,Mouse,Mus musculus 96T
E1284m ELISA Acac,Acaca,ACC1,ACC-alpha,Acetyl-CoA carboxylase 1,Acetyl-CoA carboxylase 265,Gm738,Mouse,Mus musculus 96T
E1284h ELISA kit ACAC,ACACA,ACC1,ACC1,ACCA,ACC-alpha,Acetyl-CoA carboxylase 1,Homo sapiens,Human 96T
U1284h CLIA ACAC,ACACA,ACC1,ACC1,ACCA,ACC-alpha,Acetyl-CoA carboxylase 1,Homo sapiens,Human 96T
E1284h ELISA ACAC,ACACA,ACC1,ACC1,ACCA,ACC-alpha,Acetyl-CoA carboxylase 1,Homo sapiens,Human 96T
E1284r ELISA kit Acac,Acaca,ACC1,ACC-alpha,Acetyl-CoA carboxylase 1,Rat,Rattus norvegicus 96T
U1284r CLIA Acac,Acaca,ACC1,ACC-alpha,Acetyl-CoA carboxylase 1,Rat,Rattus norvegicus 96T
E1284r ELISA Acac,Acaca,ACC1,ACC-alpha,Acetyl-CoA carboxylase 1,Rat,Rattus norvegicus 96T
E1284b ELISA kit ACAC,ACACA,ACC1,ACCA,ACC-alpha,Acetyl-CoA carboxylase 1,Bos taurus,Bovine 96T
E1284b ELISA ACAC,ACACA,ACC1,ACCA,ACC-alpha,Acetyl-CoA carboxylase 1,Bos taurus,Bovine 96T
U1284b CLIA ACAC,ACACA,ACC1,ACCA,ACC-alpha,Acetyl-CoA carboxylase 1,Bos taurus,Bovine 96T
GWB-E5EEE6 Acetyl CoA Carboxylase 1 (ACC1), Antibody
GWB-BB9909 Acetyl CoA Carboxylase 1 (ACC1) Phos. (pS79), Antibody
bs-12954R-Biotin Rabbit Anti-phospho-Acetyl Coenzyme A Carboxylase alpha (Ser80 Polyclonal Antibody, Biotin Conjugated 100ul
bs-3036R-Biotin Rabbit Anti-Phospho-Acetyl Coenzyme A carboxylase alpha (Ser78 Polyclonal Antibody, Biotin Conjugated 100ul
bs-12955R-Biotin Rabbit Anti-phospho-Acetyl Coenzyme A Carboxylase alpha (Ser12 Polyclonal Antibody, Biotin Conjugated 100ul
EIAAB45818 Gamma-glutamyl carboxylase,GC,GGCX,Homo sapiens,Human,Peptidyl-glutamate 4-carboxylase,Vitamin K gamma glutamyl carboxylase,Vitamin K-dependent gamma-carboxylase
EIAAB45819 Gamma-glutamyl carboxylase,Ggcx,Peptidyl-glutamate 4-carboxylase,Rat,Rattus norvegicus,Vitamin K gamma glutamyl carboxylase,Vitamin K-dependent gamma-carboxylase
EIAAB45817 Bos taurus,Bovine,Gamma-glutamyl carboxylase,GC,GGCX,Peptidyl-glutamate 4-carboxylase,Vitamin K gamma glutamyl carboxylase,Vitamin K-dependent gamma-carboxylase
EIAAB45820 Gamma-glutamyl carboxylase,Ggcx,Mouse,Mus musculus,Peptidyl-glutamate 4-carboxylase,Vitamin K gamma glutamyl carboxylase,Vitamin K-dependent gamma-carboxylase
bs-2745R-Biotin Rabbit Anti-Acetyl CoA Carboxylase Polyclonal Antibody, Biotin Conjugated 100ul
bs-2745R-Biotin Rabbit Anti-Acetyl CoA Carboxylase Polyclonal Antibody, Biotin Conjugated 100ug
bs-2745R-Biotin Rabbit Anti-Acetyl CoA Carboxylase Polyclonal Antibody, Biotin conjugated, Isotype: IgG 100ug Lyophilized
E02A0639 Rat Acetyl Coenzyme A Carboxylase Alpha ELISA 96T/kit
Pathways :
WP296: TCA Cycle - biocyc
WP1493: Carbon assimilation C4 pathway
WP1713: Two-component system
WP885: Ovarian Infertility Genes
WP1531: Vitamin D synthesis
WP246: TNF-alpha NF-kB Signaling Pathway
WP1584: Type II diabetes mellitus
WP273: Ovarian Infertility Genes
WP1047: TNF-alpha NF-kB Signaling Pathway
WP1835: Interferon alpha/beta signaling
WP1209: EBV LMP1 signaling
WP210: Cytoplasmic Ribosomal Proteins
WP1626: Benzoate degradation via CoA ligation
WP34: Ovarian Infertility Genes
WP1648: Fatty acid metabolism
WP457: TNF-alpha NF-kB Signaling Pathway
WP1340: Ovarian Infertility Genes
WP215: noncanonical wnt pathway
WP1403: AMPK signaling
WP231: TNF alpha Signaling Pathway
WP1695: Pyruvate metabolism
WP622: Long-Day Flowering Time Pathway
WP1712: Tryptophan metabolism
WP811: TNF-alpha NF-kB Signaling Pathway
WP244: Alpha 6 Beta 4 signaling pathway

Related Genes :
[ACC1 ABP2 FAS3 MTR7 YNR016C N3175] Acetyl-CoA carboxylase (ACC) (EC 6.4.1.2) (Fatty acid synthetase 3) (mRNA transport-defective protein 7) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[ACC1 EMB22 GK PAS3 At1g36160 F15C21.1] Acetyl-CoA carboxylase 1 (AtACC1) (EC 6.4.1.2) (Protein EMBRYO DEFECTIVE 22) (Protein GURKE) (Protein PASTICCINO 3) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[Acaca Acac] Acetyl-CoA carboxylase 1 (ACC1) (EC 6.4.1.2) (ACC-alpha) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[Acacb Acc2 Accb] Acetyl-CoA carboxylase 2 (EC 6.4.1.2) (ACC-beta) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[ACC1 Os10g0363300 LOC_Os10g21910 OsJ_31236 OSJNBa0073L01.2] Acetyl-CoA carboxylase 1 (EC 6.4.1.2) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[HFA1 YMR207C YM8261.01C YM8325.08C] Acetyl-CoA carboxylase, mitochondrial (ACC) (EC 6.4.1.2) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[CAC2 At5g35360 T26D22.8] Biotin carboxylase, chloroplastic (EC 6.3.4.14) (Acetyl-CoA carboxylase subunit A) (ACC) (EC 6.4.1.2)
[HLCS] Biotin--protein ligase (EC 6.3.4.-) (Biotin apo-protein ligase) [Includes: Biotin--[methylmalonyl-CoA-carboxytransferase] ligase (EC 6.3.4.9); Biotin--[propionyl-CoA-carboxylase [ATP-hydrolyzing]] ligase (EC 6.3.4.10) (Holocarboxylase synthetase) (HCS); Biotin--[methylcrotonoyl-CoA-carboxylase] ligase (EC 6.3.4.11); Biotin--[acetyl-CoA-carboxylase] ligase (EC 6.3.4.15)]
[HFA1 EC1118_1M3_4049g] Acetyl-CoA carboxylase, mitochondrial (ACC) (EC 6.4.1.2) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[ACC2 At1g36180 F15C21.2] Acetyl-CoA carboxylase 2 (EC 6.4.1.2) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[MCCC1 MCCA] Methylcrotonoyl-CoA carboxylase subunit alpha, mitochondrial (MCCase subunit alpha) (EC 6.4.1.4) (3-methylcrotonyl-CoA carboxylase 1) (3-methylcrotonyl-CoA carboxylase biotin-containing subunit) (3-methylcrotonyl-CoA:carbon dioxide ligase subunit alpha)
[hchA A9819_11910 ACN81_03425 AML35_08765 AW059_23935 BANRA_00208 BANRA_00433 BANRA_02614 BHF46_18455 BMT91_24760 C4J69_22715 C7B08_25495 CR538_10415 D2F89_25795 D3Y67_22910 D9G42_11130 D9I97_22010 D9J11_25195 DP258_02540 EC3234A_36c00010 EC382_21100 ECTO6_01955 EFV06_13085 EFV16_12340 NCTC8500_02249 NCTC9037_02122 NCTC9117_02637 NCTC9969_02156 SAMEA3472108_01151 SAMEA3484427_04795 SAMEA3484429_02051 SAMEA3752557_05476 SAMEA3752559_04333] Protein/nucleic acid deglycase HchA (EC 3.1.2.-) (EC 3.5.1.-) (EC 3.5.1.124) (Maillard deglycase)
[birA bioR dhbB b3973 JW3941] Bifunctional ligase/repressor BirA (Biotin operon repressor) (Biotin--[acetyl-CoA-carboxylase] ligase) (EC 6.3.4.15) (Biotin--protein ligase) (Biotin-[acetyl-CoA carboxylase] synthetase)
[MCCC2 MCCB] Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial (MCCase subunit beta) (EC 6.4.1.4) (3-methylcrotonyl-CoA carboxylase 2) (3-methylcrotonyl-CoA carboxylase non-biotin-containing subunit) (3-methylcrotonyl-CoA:carbon dioxide ligase subunit beta)
[ACC2 Os05g0295300 LOC_Os05g22940 OsJ_17935] Acetyl-CoA carboxylase 2 (EC 6.4.1.2) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[HFA1 SCRG_02101] Acetyl-CoA carboxylase, mitochondrial (ACC) (EC 6.4.1.2) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[accA b0185 JW0180] Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15)
[HFA1 C1Q_02929] Acetyl-CoA carboxylase, mitochondrial (ACC) (EC 6.4.1.2) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[Prkaa2] 5'-AMP-activated protein kinase catalytic subunit alpha-2 (AMPK subunit alpha-2) (EC 2.7.11.1) (Acetyl-CoA carboxylase kinase) (ACACA kinase) (EC 2.7.11.27) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase) (EC 2.7.11.31)
[Prkaa1] 5'-AMP-activated protein kinase catalytic subunit alpha-1 (AMPK subunit alpha-1) (EC 2.7.11.1) (Acetyl-CoA carboxylase kinase) (ACACA kinase) (EC 2.7.11.27) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase) (EC 2.7.11.31) (Tau-protein kinase PRKAA1) (EC 2.7.11.26)
[accD A6592_11000 A8C65_11680 A8M42_11610 A9819_13610 A9R57_18405 AC067_01610 ACN002_2374 ACN77_22040 ACN81_17485 ACU57_26670 ACU90_07195 AJ318_08915 AKG99_12410 AM270_05725 AM446_09235 AM464_02920 AM465_12940 AMK83_13675 AML07_04515 AML35_07465 APT94_13525 APU18_03020 APZ14_22065 ARC77_07895 AU473_10370 AUQ13_04600 AUS26_02075 AW059_07255 AW106_12960 AWE53_012675 AWF23_020720 AWF59_016780 AWF80_013985 AWG78_020565 AWP75_23110 B1K96_04830 B7C53_22355 B9M99_08445 B9N33_02175 B9T59_22175 BANRA_00101 BANRA_00884 BANRA_01311 BANRA_02956 BANRA_03105 BANRA_04740 BB545_16860 BE963_27395 BEN53_14785 BER14_17395 BET08_21000 BFD68_00300 BHF46_01565 BHS81_14340 BHS87_13215 BIU72_23275 BIZ41_10400 BJJ90_07685 BK248_00685 BK292_05455 BK334_03625 BK375_19740 BK383_00085 BK400_08035 BMT49_14870 BMT53_24450 BMT91_07940 BN17_16211 BTQ04_02065 BTQ06_04250 BUE81_00910 BVL39_15780 BW690_09570 BWP17_05895 BXT93_15275 BZL31_15320 BZL69_14870 C2M16_08740 C2U48_22830 C4J69_20755 C4K41_06095 C4M78_23045 C5715_07235 C5N07_04020 C5P01_06965 C5P43_07205 C5P44_06955 C6669_17490 C6986_15090 C6B13_00955 C7235_07955 C7B02_03615 C7B06_10160 C7B07_13395 C7B08_04395 C9E25_01020 CA593_15605 CCZ14_19125 CCZ17_09750 CDL37_03775 CG691_00540 CG692_16120 CG705_00540 CG706_06250 CIJ94_13080 COD30_04170 COD46_01380 CQP61_09360 CR539_16410 CRD98_01035 CRE06_18705 CRM83_28840 CRT43_13855 CRT46_13865 CSB64_11255 CT143_04840 CT146_08800 CVH05_16405 CWM24_16870 CWS33_01390 CY655_15115 D0X26_14060 D1900_18750 D2183_09190 D2184_03420 D2185_05565 D2F89_06325 D3821_01480 D3822_22330 D3C88_11355 D3O91_00405 D3Y67_03585 D4M06_01040 D5618_22180 D6X47_04745 D7K63_07120 D7K66_13410 D8K42_13425 D8Y29_13265 D9D20_01530 D9D31_11140 D9D33_19675 D9D43_01810 D9E22_01095 D9E34_13485 D9E35_03930 D9E49_01170 D9F57_05275 D9G11_03530 D9G48_13440 D9H53_15580 D9H68_13525 D9H70_02505 D9H94_01005 D9I18_14380 D9I20_04665 D9I87_13885 D9I88_13165 D9I97_12200 D9J03_10205 D9J11_03505 D9J44_01145 D9J46_08060 D9J60_17035 D9L89_18170 D9N32_08205 D9X97_18010 DD762_01525 DIV22_21250 DL455_01040 DL545_08390 DL800_17595 DM129_02410 DMI04_11905 DMZ31_10725 DNB37_01040 DNQ41_16775 DNQ45_20785 DNR41_06090 DNX30_06345 DOY56_20230 DP258_17860 DP277_06535 DQE83_15930 DQF57_10050 DQO13_04385 DS966_01915 DTL43_00535 DTL90_12935 DTM25_04385 DTM45_16530 DU310_01550 DU321_21455 DU333_01695 DW236_07545 DWB25_08120 E2855_02948 E2863_02910 EAI42_16755 EAI44_03870 EAI46_17445 EAI52_04285 EB509_15280 EB510_16215 EB515_19220 EC1094V2_1362 EC1639_03285 EC3234A_175c00960 EC3426_03415 EC382_04670 EC95NR1_01423 Eco118UI_13570 ECONIH1_13475 ECs3200 ECTO124_01559 ECTO6_01611 ED225_18455 ED287_01465 ED600_10505 ED607_09590 ED611_20575 ED648_12270 ED903_12740 ED944_19155 EEA45_13905 EEP23_07305 EF173_06995 EFV01_04525 EFV02_03295 EFV04_00050 EFV06_18295 EFV11_03435 EFV12_13590 EFV14_18735 EFV16_17535 EFV17_05880 EGT48_07280 EGY17_26265 EIA08_03685 EIA13_00695 EIA21_10410 EJH97_07825 EL75_1315 EL79_1324 EL80_1347 EOL36_16965 EPS76_18950 ERS085365_00035 ERS085366_01185 ERS085374_00256 ERS085379_00221 ERS085383_01916 ERS085386_00175 ERS085404_01886 ERS085406_01061 ERS085416_03311 ERS139211_00974 ERS150873_00376 ERS150876_02626 FORC28_1699 GJ11_15515 HW43_15815 JD73_19120 MS6198_26500 MS8345_02432 NCTC10082_03977 NCTC10090_04587 NCTC10418_02465 NCTC10444_01549 NCTC10764_00825 NCTC10766_00246 NCTC10767_02793 NCTC10865_01993 NCTC11022_02313 NCTC11126_04245 NCTC11181_03783 NCTC11341_00667 NCTC13127_01978 NCTC13462_05265 NCTC13846_01642 NCTC7922_01198 NCTC7927_01783 NCTC7928_01092 NCTC8179_00790 NCTC8450_03975 NCTC8621_01654 NCTC8622_03850 NCTC8959_02253 NCTC8960_04339 NCTC8985_06455 NCTC9007_03430 NCTC9036_01608 NCTC9037_01680 NCTC9045_01838 NCTC9050_04842 NCTC9055_03491 NCTC9058_05280 NCTC9062_01575 NCTC9073_04231 NCTC9075_02235 NCTC9111_05405 NCTC9112_01644 NCTC9117_02148 NCTC9119_01725 NCTC9434_01580 NCTC9701_01685 NCTC9702_01840 NCTC9703_00830 NCTC9706_04820 NCTC9775_05421 NCTC9777_05034 NCTC9969_01750 PU06_12770 RG28_10250 RK56_005330 RX35_01224 SAMEA3446340_03658 SAMEA3472033_00453 SAMEA3472043_00830 SAMEA3472044_01675 SAMEA3472047_02573 SAMEA3472056_00609 SAMEA3472070_00270 SAMEA3472080_03253 SAMEA3472108_00768 SAMEA3472110_03636 SAMEA3472112_03651 SAMEA3472147_01507 SAMEA3484427_04420 SAMEA3484429_04511 SAMEA3484434_02461 SAMEA3485101_03103 SAMEA3485113_00630 SAMEA3752372_03694 SAMEA3752553_03316 SAMEA3752557_00659 SAMEA3752559_01767 SAMEA3753097_01640 SAMEA3753300_00057 SK85_02566 SY51_13225 UC41_09130 UN86_09770 UN91_13420 WQ89_02245 WR15_08745 YDC107_849] Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15)
[HFA1 SCY_4385] Acetyl-CoA carboxylase, mitochondrial (ACC) (EC 6.4.1.2) [Includes: Biotin carboxylase (EC 6.3.4.14)]
[acc-1 F58G6.4] Acetylcholine-gated chloride channel subunit acc-1
[pccA accA2 HFX_2490 BM92_13250 C439_14249] Propionyl-CoA carboxylase, biotin carboxylase and biotin-carboxyl carrier subunit (PCC) (EC 6.4.1.3) [Includes: Biotin carboxylase (BC) (EC 6.3.4.14); Biotin-carboxyl carrier protein (BCCP)]
[] Genome polyprotein [Cleaved into: P3; Protein 3AB; P2; P1; Capsid protein VP0 (VP4-VP2); Capsid protein VP4 (P1A) (Virion protein 4); Capsid protein VP2 (P1B) (Virion protein 2); Capsid protein VP3 (P1C) (Virion protein 3); Capsid protein VP1 (P1D) (Virion protein 1); Protease 2A (P2A) (EC 3.4.22.29) (Picornain 2A) (Protein 2A); Protein 2B (P2B); Protein 2C (P2C) (EC 3.6.1.15); Protein 3A (P3A); Viral protein genome-linked (VPg) (Protein 3B) (P3B); Protein 3CD (EC 3.4.22.28); Protease 3C (P3C) (EC 3.4.22.28); RNA-directed RNA polymerase (RdRp) (EC 2.7.7.48) (3D polymerase) (3Dpol) (Protein 3D) (3D)]
[] Genome polyprotein [Cleaved into: Core protein p21 (Capsid protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (p23) (EC 3.4.22.-); Serine protease NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3P) (p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)]
[accD dedB usg b2316 JW2313] Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15)
[PRKAA1 AMPK1] 5'-AMP-activated protein kinase catalytic subunit alpha-1 (AMPK subunit alpha-1) (EC 2.7.11.1) (AMPK 63 kDa subunit) (Acetyl-CoA carboxylase kinase) (ACACA kinase) (EC 2.7.11.27) (Hydroxymethylglutaryl-CoA reductase kinase) (HMGCR kinase) (EC 2.7.11.31) (Tau-protein kinase PRKAA1) (EC 2.7.11.26) (Fragments)
[accD ycf11 zfpA] Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, chloroplastic (ACCase subunit beta) (Acetyl-CoA carboxylase carboxyltransferase subunit beta) (EC 2.1.3.15)
[hmpA hmp A8C65_03855 A9R57_17040 ACN002_2592 ACN77_09545 ACN81_26320 ACU57_10360 ACU90_01485 AM270_07210 AM464_04560 AML07_10430 APZ14_05505 AUQ13_13215 AUS26_21665 AW106_11070 AWF80_015090 BANRA_01097 BANRA_03418 BANRA_04525 BB545_05760 BHS81_15570 BHS87_14445 BJJ90_06510 BK292_20760 BMT53_22940 BMT91_09730 BN17_18391 BUE81_08005 BVL39_14050 BW690_11150 BZL31_13550 C2U48_21325 C4J69_10505 C5N07_10115 C5P01_05560 C5P43_25010 C6986_16510 C7235_06805 C9E25_16695 CG691_06165 CG705_05290 CG706_03875 COD30_01045 COD46_11500 CRM83_27495 CWS33_10010 D2184_18725 D2185_06690 D3821_11445 D3O91_03570 D3Y67_23905 D9E22_02790 D9F57_20505 D9H68_00985 D9I18_09865 D9I97_07905 D9J11_04290 D9J44_00060 DIV22_11300 DL545_07245 DL800_19195 DMZ31_01715 DNQ41_17925 DP277_03620 DTL43_01910 E2855_03303 E2863_03210 EAI42_06330 EAI44_09410 EC1094V2_1116 EC3234A_44c01590 EC95NR1_01777 ECTO6_01279 ED600_07770 EEP23_02350 EFV01_13935 EFV02_11870 EFV04_05815 EFV08_03440 EFV11_08940 EFV12_11800 EFV15_03135 ERS085365_01518 ERS085374_00038 ERS085416_03760 ERS139211_00868 ERS150873_01392 ERS150876_00857 FORC28_1400 HW43_17160 NCTC11022_02631 NCTC11181_03552 NCTC13148_02382 NCTC8500_01411 NCTC8960_04037 NCTC8985_06124 NCTC9036_01390 NCTC9037_01459 NCTC9058_00631 NCTC9062_01812 NCTC9073_04581 NCTC9706_04593 NCTC9962_00729 PU06_05410 RG28_09110 RK56_022045 SAMEA3446340_03873 SAMEA3472043_01058 SAMEA3472044_03009 SAMEA3472070_00042 SAMEA3472080_01630 SAMEA3484427_00463 SAMEA3484429_00572 SAMEA3752553_02327 SAMEA3752557_00946 SAMEA3753097_02775 SK85_02808 WQ89_05840] Flavohemoprotein (Flavohemoglobin) (Hemoglobin-like protein) (Nitric oxide dioxygenase) (NO oxygenase) (NOD) (EC 1.14.12.17)

Bibliography :
No related Items