GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Acylphosphatase-1 (EC 3.6.1.7) (Acylphosphatase, erythrocyte isozyme) (Acylphosphatase, organ-common type isozyme) (Acylphosphate phosphohydrolase 1)

 ACYP1_HUMAN             Reviewed;          99 AA.
P07311; A6NDV8; B2R590;
01-APR-1988, integrated into UniProtKB/Swiss-Prot.
23-JAN-2007, sequence version 2.
13-FEB-2019, entry version 174.
RecName: Full=Acylphosphatase-1;
EC=3.6.1.7;
AltName: Full=Acylphosphatase, erythrocyte isozyme;
AltName: Full=Acylphosphatase, organ-common type isozyme;
AltName: Full=Acylphosphate phosphohydrolase 1;
Name=ACYP1; Synonyms=ACYPE;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Placenta;
Raugei G.;
Submitted (FEB-1997) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Testis;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12508121; DOI=10.1038/nature01348;
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C.,
Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A.,
Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S.,
Sun H., Du H., Pepin K., Artiguenave F., Robert C., Cruaud C.,
Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P.,
Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N.,
Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C.,
Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S.,
Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B.,
Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M.,
Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S.,
Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D.,
Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A.,
Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M.,
Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V.,
Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L.,
Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J.,
Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W.,
Quetier F., Waterston R., Hood L., Weissenbach J.;
"The DNA sequence and analysis of human chromosome 14.";
Nature 421:601-607(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Embryonic carcinoma, and Mammary gland;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
PROTEIN SEQUENCE OF 2-99, CLEAVAGE OF INITIATOR METHIONINE, AND
ACETYLATION AT ALA-2.
PubMed=3026468; DOI=10.1021/bi00372a044;
Liguri G., Camici G., Manao G., Cappugi G., Nassi P., Modesti A.,
Ramponi G.;
"A new acylphosphatase isoenzyme from human erythrocytes:
purification, characterization, and primary structure.";
Biochemistry 25:8089-8094(1986).
[7]
PRELIMINARY NUCLEOTIDE SEQUENCE [MRNA] OF 10-86.
TISSUE=Placenta;
PubMed=7796909; DOI=10.1016/0014-5793(95)00553-L;
Fiaschi T., Raugei G., Marzocchini R., Chiarugi P., Cirri P.,
Ramponi G.;
"Cloning and expression of the cDNA coding for the erythrocyte
isoenzyme of human acylphosphatase.";
FEBS Lett. 367:145-148(1995).
[8]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[9]
X-RAY CRYSTALLOGRAPHY (1.45 ANGSTROMS).
PubMed=16511269; DOI=10.1107/S174430910504145X;
Yeung R.C., Lam S.Y., Wong K.B.;
"Crystallization and preliminary crystallographic analysis of human
common-type acylphosphatase.";
Acta Crystallogr. F 62:80-82(2006).
[10]
STRUCTURE BY NMR OF 2-99.
PubMed=19196981; DOI=10.1073/pnas.0808220106;
Gribenko A.V., Patel M.M., Liu J., McCallum S.A., Wang C.,
Makhatadze G.I.;
"Rational stabilization of enzymes by computational redesign of
surface charge-charge interactions.";
Proc. Natl. Acad. Sci. U.S.A. 106:2601-2606(2009).
-!- FUNCTION: Its physiological role is not yet clear.
-!- CATALYTIC ACTIVITY:
Reaction=an acyl phosphate + H2O = a carboxylate + H(+) +
phosphate; Xref=Rhea:RHEA:14965, ChEBI:CHEBI:15377,
ChEBI:CHEBI:15378, ChEBI:CHEBI:29067, ChEBI:CHEBI:43474,
ChEBI:CHEBI:59918; EC=3.6.1.7;
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=P07311-1; Sequence=Displayed;
Name=2;
IsoId=P07311-2; Sequence=VSP_045688;
Note=No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Organ-common type isozyme is found in many
different tissues.
-!- SIMILARITY: Belongs to the acylphosphatase family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; X84194; CAA58987.1; -; mRNA.
EMBL; AK312101; BAG35037.1; -; mRNA.
EMBL; AC007055; AAD31937.1; -; Genomic_DNA.
EMBL; AL049780; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471061; EAW81216.1; -; Genomic_DNA.
EMBL; BC035568; AAH35568.1; -; mRNA.
EMBL; BG614847; -; NOT_ANNOTATED_CDS; mRNA.
CCDS; CCDS9838.1; -. [P07311-1]
PIR; S66187; QPHUE.
RefSeq; NP_001098.1; NM_001107.4. [P07311-1]
RefSeq; NP_001289545.1; NM_001302616.1. [P07311-1]
UniGene; Hs.18573; -.
PDB; 2K7J; NMR; -; A=2-99.
PDB; 2K7K; NMR; -; A=2-99.
PDB; 2VH7; X-ray; 1.45 A; A=1-99.
PDB; 2W4C; X-ray; 1.52 A; A=1-99.
PDB; 2W4P; X-ray; 1.70 A; A=1-99.
PDB; 3TOQ; X-ray; 2.00 A; A=1-99.
PDBsum; 2K7J; -.
PDBsum; 2K7K; -.
PDBsum; 2VH7; -.
PDBsum; 2W4C; -.
PDBsum; 2W4P; -.
PDBsum; 3TOQ; -.
ProteinModelPortal; P07311; -.
SMR; P07311; -.
BioGrid; 106612; 1.
STRING; 9606.ENSP00000238618; -.
iPTMnet; P07311; -.
PhosphoSitePlus; P07311; -.
BioMuta; ACYP1; -.
EPD; P07311; -.
jPOST; P07311; -.
MaxQB; P07311; -.
PaxDb; P07311; -.
PeptideAtlas; P07311; -.
PRIDE; P07311; -.
ProteomicsDB; 51984; -.
TopDownProteomics; P07311-1; -. [P07311-1]
Ensembl; ENST00000238618; ENSP00000238618; ENSG00000119640. [P07311-1]
Ensembl; ENST00000357971; ENSP00000350655; ENSG00000119640. [P07311-2]
Ensembl; ENST00000555694; ENSP00000451581; ENSG00000119640. [P07311-1]
GeneID; 97; -.
KEGG; hsa:97; -.
UCSC; uc001xrf.4; human. [P07311-1]
CTD; 97; -.
EuPathDB; HostDB:ENSG00000119640.8; -.
GeneCards; ACYP1; -.
HGNC; HGNC:179; ACYP1.
HPA; HPA034944; -.
MIM; 600875; gene.
neXtProt; NX_P07311; -.
OpenTargets; ENSG00000119640; -.
PharmGKB; PA24499; -.
eggNOG; KOG3360; Eukaryota.
eggNOG; ENOG41126ER; LUCA.
GeneTree; ENSGT00390000011103; -.
HOGENOM; HOG000292688; -.
HOVERGEN; HBG050454; -.
InParanoid; P07311; -.
KO; K01512; -.
OrthoDB; 1502266at2759; -.
PhylomeDB; P07311; -.
TreeFam; TF300288; -.
SABIO-RK; P07311; -.
ChiTaRS; ACYP1; human.
EvolutionaryTrace; P07311; -.
GeneWiki; ACYP1; -.
GenomeRNAi; 97; -.
PRO; PR:P07311; -.
Proteomes; UP000005640; Chromosome 14.
Bgee; ENSG00000119640; Expressed in 218 organ(s), highest expression level in tendon.
ExpressionAtlas; P07311; baseline and differential.
Genevisible; P07311; HS.
GO; GO:0003998; F:acylphosphatase activity; IBA:GO_Central.
GO; GO:0006796; P:phosphate-containing compound metabolic process; TAS:ProtInc.
InterPro; IPR020456; Acylphosphatase.
InterPro; IPR001792; Acylphosphatase-like_dom.
InterPro; IPR036046; Acylphosphatase-like_dom_sf.
InterPro; IPR017968; Acylphosphatase_CS.
PANTHER; PTHR10029; PTHR10029; 1.
Pfam; PF00708; Acylphosphatase; 1.
PRINTS; PR00112; ACYLPHPHTASE.
SUPFAM; SSF54975; SSF54975; 1.
PROSITE; PS00150; ACYLPHOSPHATASE_1; 1.
PROSITE; PS00151; ACYLPHOSPHATASE_2; 1.
PROSITE; PS51160; ACYLPHOSPHATASE_3; 1.
1: Evidence at protein level;
3D-structure; Acetylation; Alternative splicing; Complete proteome;
Direct protein sequencing; Hydrolase; Reference proteome.
INIT_MET 1 1 Removed. {ECO:0000269|PubMed:3026468}.
CHAIN 2 99 Acylphosphatase-1.
/FTId=PRO_0000158535.
DOMAIN 9 99 Acylphosphatase-like.
{ECO:0000255|PROSITE-ProRule:PRU00520}.
ACT_SITE 24 24 {ECO:0000255|PROSITE-ProRule:PRU00520}.
ACT_SITE 42 42 {ECO:0000255|PROSITE-ProRule:PRU00520}.
MOD_RES 2 2 N-acetylalanine.
{ECO:0000269|PubMed:3026468}.
VAR_SEQ 29 99 AEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETR
GSPKSHIDKANFNNEKVILKLDYSDFQIVK -> EMTVENR
IAETHSKSCVPVSFATSYAG (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_045688.
STRAND 7 17 {ECO:0000244|PDB:2VH7}.
STRAND 19 21 {ECO:0000244|PDB:2VH7}.
HELIX 23 33 {ECO:0000244|PDB:2VH7}.
STRAND 37 42 {ECO:0000244|PDB:2VH7}.
STRAND 44 46 {ECO:0000244|PDB:2K7J}.
STRAND 48 55 {ECO:0000244|PDB:2VH7}.
HELIX 56 68 {ECO:0000244|PDB:2VH7}.
STRAND 72 74 {ECO:0000244|PDB:2K7J}.
STRAND 75 89 {ECO:0000244|PDB:2VH7}.
STRAND 93 97 {ECO:0000244|PDB:2VH7}.
SEQUENCE 99 AA; 11261 MW; F9F787E490BC8296 CRC64;
MAEGNTLISV DYEIFGKVQG VFFRKHTQAE GKKLGLVGWV QNTDRGTVQG QLQGPISKVR
HMQEWLETRG SPKSHIDKAN FNNEKVILKL DYSDFQIVK


Related products :

Catalog number Product name Quantity
GWB-F73602 Acylphosphatase Organ-common Type Isozyme (ACYP1) Goat anti-Human Polyclonal (Internal) Antibody
201-20-0174 ACYP1{acylphosphatase 1, erythrocyte (common) type}rabbit.pAb 0.1ml
AD10 ACYP1 Gene acylphosphatase 1, erythrocyte (common) type
abx110816 Polyclonal Rabbit Acylphosphatase 1, Erythrocyte (Common) Type Antibody 50 μl
CSB-EL001265PI Pig acylphosphatase 1, erythrocyte (common) type (ACYP1) ELISA kit, Species Pig, Sample Type serum, plasma 96T
ACYP1-1801H Recombinant Human Acylphosphatase 1, Erythrocyte (common) Type, GST-tagged species: Human 100
CSB-EL001265HU Human acylphosphatase 1, erythrocyte (common) type (ACYP1) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL001265MO Mouse acylphosphatase 1, erythrocyte (common) type (ACYP1) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL001265CH Chicken acylphosphatase 1, erythrocyte (common) type (ACYP1) ELISA kit, Species Chicken, Sample Type serum, plasma 96T
CSB-EL001265BO Bovine acylphosphatase 1, erythrocyte (common) type (ACYP1) ELISA kit, Species Bovine, Sample Type serum, plasma 96T
CSB-PA001265GA01HU Rabbit anti-human acylphosphatase 1, erythrocyte (common) type polyclonal Antibody Primary antibody Host:Rabbit IgG 150ul
CSB-PA001265GA01HU Rabbit anti-human acylphosphatase 1, erythrocyte (common) type polyclonal Antibody Primary antibody Host:Rabbit IgG 50ul
MCA5410Z MOUSE ANTI HUMAN ACYLPHOSPHATASE 2 Azide free, Product Type Monoclonal Antibody, Specificity ACYLPHOSPHATASE 2, Target Species Human, Host Mouse, Format Azide Free, Isotypes IgG1, Applications 0.1 mg
AD11 ACYP2 Gene acylphosphatase 2, muscle type
201-20-0175 ACYP2{acylphosphatase 2, muscle type}rabbit.pAb 0.1ml
abx110817 Polyclonal Rabbit Acylphosphatase 2, Muscle Type Antibody 50 μl
CSB-EL001266PI Pig acylphosphatase 2, muscle type (ACYP2) ELISA kit, Species Pig, Sample Type serum, plasma 96T
CSB-EL001266RA Rat acylphosphatase 2, muscle type (ACYP2) ELISA kit, Species Rat, Sample Type serum, plasma 96T
enz-078 Recombinant Human Acylphosphatase 1 1mg
enz-078 Recombinant Human Acylphosphatase 1 20
enz-078 Recombinant Human Acylphosphatase 1 5
EB07583 Acylphosphatase 1 (ACYP1) 0.1 mg
AP16670PU-N Acylphosphatase 1 (ACYP1) 0.1 mg
REN-078 Recombinant Human Acylphosphatase 1 5
EB07583 Acylphosphatase 1 (ACYP1) 0.1 mg

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1017: Type II interferon signaling (IFNG)
WP1136: Type II interferon signaling (IFNG)
WP1253: Type II interferon signaling (IFNG)
WP1289: Type II interferon signaling (IFNG)
WP1350: Type II interferon signaling (IFNG)
WP1584: Type II diabetes mellitus
WP2113: Type III interferon signaling
WP2272: Pathogenic Escherichia coli infection
WP585: Interferon type I
WP619: Type II interferon signaling (IFNG)
WP786: Type II interferon signaling (IFNG)
WP900: Type II interferon signaling (IFNG)

Related Genes :
[ACYP1 ACYPE] Acylphosphatase-1 (EC 3.6.1.7) (Acylphosphatase, erythrocyte/testis isozyme) (Acylphosphatase, organ-common type isozyme) (Acylphosphate phosphohydrolase 1)
[ACYP1 ACYPE] Acylphosphatase-1 (EC 3.6.1.7) (Acylphosphatase, organ-common type isozyme) (Acylphosphate phosphohydrolase 1)
[ACYP2] Acylphosphatase-2 (EC 3.6.1.7) (Acylphosphatase isozyme TU1) (Acylphosphatase, muscle type isozyme) (Acylphosphate phosphohydrolase 2)
[Pfkp Pfkc] ATP-dependent 6-phosphofructokinase, platelet type (ATP-PFK) (PFK-P) (EC 2.7.1.11) (6-phosphofructokinase type C) (Phosphofructo-1-kinase isozyme C) (PFK-C) (Phosphohexokinase)
[ADSSL1 ADSS1] Adenylosuccinate synthetase isozyme 1 (AMPSase 1) (AdSS 1) (EC 6.3.4.4) (Adenylosuccinate synthetase, basic isozyme) (Adenylosuccinate synthetase, muscle isozyme) (M-type adenylosuccinate synthetase) (IMP--aspartate ligase 1)
[ALPL] Alkaline phosphatase, tissue-nonspecific isozyme (AP-TNAP) (TNSALP) (EC 3.1.3.1) (Alkaline phosphatase liver/bone/kidney isozyme)
[HSD11B2 HSD11K SDR9C3] Corticosteroid 11-beta-dehydrogenase isozyme 2 (EC 1.1.1.-) (11-beta-hydroxysteroid dehydrogenase type 2) (11-DH2) (11-beta-HSD2) (11-beta-hydroxysteroid dehydrogenase type II) (11-HSD type II) (11-beta-HSD type II) (NAD-dependent 11-beta-hydroxysteroid dehydrogenase) (11-beta-HSD) (Short chain dehydrogenase/reductase family 9C member 3)
[FBP2] Fructose-1,6-bisphosphatase isozyme 2 (FBPase 2) (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 2) (Muscle FBPase)
[PKM OIP3 PK2 PK3 PKM2] Pyruvate kinase PKM (EC 2.7.1.40) (Cytosolic thyroid hormone-binding protein) (CTHBP) (Opa-interacting protein 3) (OIP-3) (Pyruvate kinase 2/3) (Pyruvate kinase muscle isozyme) (Thyroid hormone-binding protein 1) (THBP1) (Tumor M2-PK) (p58)
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[Fbp2] Fructose-1,6-bisphosphatase isozyme 2 (FBPase 2) (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 2) (Muscle FBPase) (RAE-30)
[Fbp2] Fructose-1,6-bisphosphatase isozyme 2 (FBPase 2) (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 2) (Muscle FBPase)
[PFKP PFKF] ATP-dependent 6-phosphofructokinase, platelet type (ATP-PFK) (PFK-P) (EC 2.7.1.11) (6-phosphofructokinase type C) (Phosphofructo-1-kinase isozyme C) (PFK-C) (Phosphohexokinase)
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[Fbp1 Fbp Fbp3] Fructose-1,6-bisphosphatase 1 (FBPase 1) (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 1) (Fructose-1,6-bisphosphatase isozyme 3) (FBPase 3) (Liver FBPase)
[Pfkp Pfkc] ATP-dependent 6-phosphofructokinase, platelet type (ATP-PFK) (PFK-P) (EC 2.7.1.11) (6-phosphofructokinase type C) (Phosphofructo-1-kinase isozyme C) (PFK-C) (Phosphohexokinase)
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[PDC6 YGR087C] Pyruvate decarboxylase isozyme 3 (EC 4.1.1.-) (EC 4.1.1.43) (EC 4.1.1.72) (EC 4.1.1.74) (Thiamine pyrophosphate-dependent 2-oxo-acid decarboxylase) (2ODC)
[Pfkm Pfk-m Pfka] ATP-dependent 6-phosphofructokinase, muscle type (ATP-PFK) (PFK-M) (EC 2.7.1.11) (6-phosphofructokinase type A) (Phosphofructo-1-kinase isozyme A) (PFK-A) (Phosphohexokinase)
[FBP2] Fructose-1,6-bisphosphatase isozyme 2 (FBPase 2) (EC 3.1.3.11) (D-fructose-1,6-bisphosphate 1-phosphohydrolase 2) (Muscle FBPase)
[] Genome polyprotein [Cleaved into: Capsid protein C (Capsid protein) (Core protein); Protein prM (Precursor membrane protein); Peptide pr (Peptide precursor); Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)]
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[Pfkl Pfk-l Pfkb] ATP-dependent 6-phosphofructokinase, liver type (ATP-PFK) (PFK-L) (EC 2.7.1.11) (6-phosphofructokinase type B) (Phosphofructo-1-kinase isozyme B) (PFK-B) (Phosphohexokinase)
[AMY1.1] Alpha-amylase type A isozyme (EC 3.2.1.1) (1,4-alpha-D-glucan glucanohydrolase) (HvAMY1) (Low pI alpha-amylase)
[Mbtps1 S1p Ski1] Membrane-bound transcription factor site-1 protease (EC 3.4.21.112) (Endopeptidase S1P) (Sterol-regulated luminal protease) (Subtilisin/kexin isozyme 1) (SKI-1)
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]

Bibliography :
?>