GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Alsin (Amyotrophic lateral sclerosis 2 protein homolog)

 ALS2_MOUSE              Reviewed;        1651 AA.
Q920R0; G5E868; Q8JZR1; Q9CXJ3;
09-MAY-2003, integrated into UniProtKB/Swiss-Prot.
03-OCT-2012, sequence version 3.
16-JAN-2019, entry version 153.
RecName: Full=Alsin;
AltName: Full=Amyotrophic lateral sclerosis 2 protein homolog;
Name=Als2;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha;
Muroidea; Muridae; Murinae; Mus; Mus.
NCBI_TaxID=10090 {ECO:0000312|EMBL:BAB69016.1};
[1] {ECO:0000305}
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=11586298; DOI=10.1038/ng1001-166;
Hadano S., Hand C.K., Osuga H., Yanagisawa Y., Otomo A., Devon R.S.,
Miyamoto N., Showguchi-Miyata J., Okada Y., Singaraja R.,
Figlewicz D.A., Kwiatkowski T., Hosler B.A., Sagie T., Skaug J.,
Nasir J., Brown R.H. Jr., Scherer S.W., Rouleau G.A., Hayden M.R.,
Ikeda J.-E.;
"A gene encoding a putative GTPase regulator is mutated in familial
amyotrophic lateral sclerosis 2.";
Nat. Genet. 29:166-173(2001).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=C57BL/6J;
PubMed=19468303; DOI=10.1371/journal.pbio.1000112;
Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S.,
She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W.,
Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T.,
Zhou S., Teague B., Potamousis K., Churas C., Place M., Herschleb J.,
Runnheim R., Forrest D., Amos-Landgraf J., Schwartz D.C., Cheng Z.,
Lindblad-Toh K., Eichler E.E., Ponting C.P.;
"Lineage-specific biology revealed by a finished genome assembly of
the mouse.";
PLoS Biol. 7:E1000112-E1000112(2009).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[4] {ECO:0000305}
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
STRAIN=C57BL/6J {ECO:0000312|EMBL:AAH46828.1};
TISSUE=Brain {ECO:0000312|EMBL:AAH46828.1}, and
Mammary gland {ECO:0000312|EMBL:AAH31479.1};
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 847-1651 (ISOFORM 1).
STRAIN=C57BL/6J;
PubMed=16141072; DOI=10.1126/science.1112014;
Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N.,
Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K.,
Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M.,
Davis M.J., Wilming L.G., Aidinis V., Allen J.E.,
Ambesi-Impiombato A., Apweiler R., Aturaliya R.N., Bailey T.L.,
Bansal M., Baxter L., Beisel K.W., Bersano T., Bono H., Chalk A.M.,
Chiu K.P., Choudhary V., Christoffels A., Clutterbuck D.R.,
Crowe M.L., Dalla E., Dalrymple B.P., de Bono B., Della Gatta G.,
di Bernardo D., Down T., Engstrom P., Fagiolini M., Faulkner G.,
Fletcher C.F., Fukushima T., Furuno M., Futaki S., Gariboldi M.,
Georgii-Hemming P., Gingeras T.R., Gojobori T., Green R.E.,
Gustincich S., Harbers M., Hayashi Y., Hensch T.K., Hirokawa N.,
Hill D., Huminiecki L., Iacono M., Ikeo K., Iwama A., Ishikawa T.,
Jakt M., Kanapin A., Katoh M., Kawasawa Y., Kelso J., Kitamura H.,
Kitano H., Kollias G., Krishnan S.P., Kruger A., Kummerfeld S.K.,
Kurochkin I.V., Lareau L.F., Lazarevic D., Lipovich L., Liu J.,
Liuni S., McWilliam S., Madan Babu M., Madera M., Marchionni L.,
Matsuda H., Matsuzawa S., Miki H., Mignone F., Miyake S., Morris K.,
Mottagui-Tabar S., Mulder N., Nakano N., Nakauchi H., Ng P.,
Nilsson R., Nishiguchi S., Nishikawa S., Nori F., Ohara O.,
Okazaki Y., Orlando V., Pang K.C., Pavan W.J., Pavesi G., Pesole G.,
Petrovsky N., Piazza S., Reed J., Reid J.F., Ring B.Z., Ringwald M.,
Rost B., Ruan Y., Salzberg S.L., Sandelin A., Schneider C.,
Schoenbach C., Sekiguchi K., Semple C.A., Seno S., Sessa L., Sheng Y.,
Shibata Y., Shimada H., Shimada K., Silva D., Sinclair B.,
Sperling S., Stupka E., Sugiura K., Sultana R., Takenaka Y., Taki K.,
Tammoja K., Tan S.L., Tang S., Taylor M.S., Tegner J., Teichmann S.A.,
Ueda H.R., van Nimwegen E., Verardo R., Wei C.L., Yagi K.,
Yamanishi H., Zabarovsky E., Zhu S., Zimmer A., Hide W., Bult C.,
Grimmond S.M., Teasdale R.D., Liu E.T., Brusic V., Quackenbush J.,
Wahlestedt C., Mattick J.S., Hume D.A., Kai C., Sasaki D., Tomaru Y.,
Fukuda S., Kanamori-Katayama M., Suzuki M., Aoki J., Arakawa T.,
Iida J., Imamura K., Itoh M., Kato T., Kawaji H., Kawagashira N.,
Kawashima T., Kojima M., Kondo S., Konno H., Nakano K., Ninomiya N.,
Nishio T., Okada M., Plessy C., Shibata K., Shiraki T., Suzuki S.,
Tagami M., Waki K., Watahiki A., Okamura-Oho Y., Suzuki H., Kawai J.,
Hayashizaki Y.;
"The transcriptional landscape of the mammalian genome.";
Science 309:1559-1563(2005).
[6]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Embryonic brain;
PubMed=15345747; DOI=10.1074/mcp.M400085-MCP200;
Ballif B.A., Villen J., Beausoleil S.A., Schwartz D., Gygi S.P.;
"Phosphoproteomic analysis of the developing mouse brain.";
Mol. Cell. Proteomics 3:1093-1101(2004).
[7]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-477 AND SER-486, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=17242355; DOI=10.1073/pnas.0609836104;
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
"Large-scale phosphorylation analysis of mouse liver.";
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
[8]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-477 AND SER-486, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Brain, Brown adipose tissue, Heart, Kidney, Liver, Lung,
Pancreas, Spleen, and Testis;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and
expression.";
Cell 143:1174-1189(2010).
[9]
ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-527, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Embryonic fibroblast;
PubMed=23806337; DOI=10.1016/j.molcel.2013.06.001;
Park J., Chen Y., Tishkoff D.X., Peng C., Tan M., Dai L., Xie Z.,
Zhang Y., Zwaans B.M., Skinner M.E., Lombard D.B., Zhao Y.;
"SIRT5-mediated lysine desuccinylation impacts diverse metabolic
pathways.";
Mol. Cell 50:919-930(2013).
-!- FUNCTION: May act as a GTPase regulator. Controls survival and
growth of spinal motoneurons. {ECO:0000250}.
-!- SUBUNIT: Forms a heteromeric complex with ALS2CL. Interacts with
ALS2CL (By similarity). {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1 {ECO:0000305};
IsoId=Q920R0-1; Sequence=Displayed;
Name=2 {ECO:0000305};
IsoId=Q920R0-2; Sequence=VSP_050525, VSP_050526;
Note=No experimental confirmation available. {ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AB053307; BAB69016.1; -; mRNA.
EMBL; AC153652; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH466548; EDL00124.1; -; Genomic_DNA.
EMBL; BC031479; AAH31479.1; -; mRNA.
EMBL; BC046828; AAH46828.1; -; mRNA.
EMBL; AK014320; BAB29271.2; -; mRNA.
CCDS; CCDS35583.1; -. [Q920R0-1]
RefSeq; NP_001153420.2; NM_001159948.2. [Q920R0-1]
RefSeq; NP_082993.4; NM_028717.6. [Q920R0-1]
RefSeq; NP_666221.1; NM_146109.3.
UniGene; Mm.272078; -.
UniGene; Mm.474049; -.
BioGrid; 216427; 4.
STRING; 10090.ENSMUSP00000027178; -.
iPTMnet; Q920R0; -.
PhosphoSitePlus; Q920R0; -.
EPD; Q920R0; -.
jPOST; Q920R0; -.
PaxDb; Q920R0; -.
PeptideAtlas; Q920R0; -.
PRIDE; Q920R0; -.
Ensembl; ENSMUST00000027178; ENSMUSP00000027178; ENSMUSG00000026024. [Q920R0-1]
Ensembl; ENSMUST00000163058; ENSMUSP00000125753; ENSMUSG00000026024. [Q920R0-1]
GeneID; 74018; -.
KEGG; mmu:74018; -.
UCSC; uc007bdm.2; mouse. [Q920R0-1]
UCSC; uc007bdn.2; mouse. [Q920R0-2]
CTD; 57679; -.
MGI; MGI:1921268; Als2.
eggNOG; KOG0231; Eukaryota.
eggNOG; KOG1426; Eukaryota.
eggNOG; COG4642; LUCA.
GeneTree; ENSGT00940000155861; -.
HOGENOM; HOG000033908; -.
HOVERGEN; HBG037320; -.
InParanoid; Q920R0; -.
KO; K04575; -.
OMA; ATCFEVT; -.
OrthoDB; 37470at2759; -.
TreeFam; TF331793; -.
Reactome; R-MMU-8876198; RAB GEFs exchange GTP for GDP on RABs.
ChiTaRS; Als2; mouse.
PRO; PR:Q920R0; -.
Proteomes; UP000000589; Chromosome 1.
Bgee; ENSMUSG00000026024; Expressed in 107 organ(s), highest expression level in cerebellum.
ExpressionAtlas; Q920R0; baseline and differential.
Genevisible; Q920R0; MM.
GO; GO:0030424; C:axon; ISO:MGI.
GO; GO:0005813; C:centrosome; ISO:MGI.
GO; GO:0005737; C:cytoplasm; IDA:MGI.
GO; GO:0005829; C:cytosol; ISS:UniProtKB.
GO; GO:0030425; C:dendrite; ISS:UniProtKB.
GO; GO:0043197; C:dendritic spine; IDA:MGI.
GO; GO:0005769; C:early endosome; ISS:UniProtKB.
GO; GO:0030426; C:growth cone; ISS:UniProtKB.
GO; GO:0043231; C:intracellular membrane-bounded organelle; ISO:MGI.
GO; GO:0030027; C:lamellipodium; IDA:UniProtKB.
GO; GO:0016020; C:membrane; ISO:MGI.
GO; GO:0043005; C:neuron projection; ISO:MGI.
GO; GO:0043025; C:neuronal cell body; ISO:MGI.
GO; GO:0005634; C:nucleus; ISO:MGI.
GO; GO:0014069; C:postsynaptic density; IDA:MGI.
GO; GO:0032991; C:protein-containing complex; ISS:UniProtKB.
GO; GO:0001726; C:ruffle; IDA:UniProtKB.
GO; GO:0031982; C:vesicle; ISS:UniProtKB.
GO; GO:0005096; F:GTPase activator activity; ISO:MGI.
GO; GO:0042802; F:identical protein binding; ISO:MGI.
GO; GO:0042803; F:protein homodimerization activity; ISS:UniProtKB.
GO; GO:0043539; F:protein serine/threonine kinase activator activity; ISS:UniProtKB.
GO; GO:0017137; F:Rab GTPase binding; ISS:UniProtKB.
GO; GO:0017112; F:Rab guanyl-nucleotide exchange factor activity; ISS:UniProtKB.
GO; GO:0048365; F:Rac GTPase binding; ISO:MGI.
GO; GO:0030676; F:Rac guanyl-nucleotide exchange factor activity; ISS:UniProtKB.
GO; GO:0007409; P:axonogenesis; ISO:MGI.
GO; GO:0001662; P:behavioral fear response; IMP:MGI.
GO; GO:0008219; P:cell death; ISO:MGI.
GO; GO:0016197; P:endosomal transport; IMP:MGI.
GO; GO:0007032; P:endosome organization; ISO:MGI.
GO; GO:0001701; P:in utero embryonic development; IEA:Ensembl.
GO; GO:0007626; P:locomotory behavior; IMP:MGI.
GO; GO:0007041; P:lysosomal transport; ISO:MGI.
GO; GO:0007528; P:neuromuscular junction development; IMP:MGI.
GO; GO:0048812; P:neuron projection morphogenesis; ISS:UniProtKB.
GO; GO:0043547; P:positive regulation of GTPase activity; ISS:UniProtKB.
GO; GO:0045860; P:positive regulation of protein kinase activity; ISS:UniProtKB.
GO; GO:0051260; P:protein homooligomerization; ISO:MGI.
GO; GO:0008104; P:protein localization; IMP:MGI.
GO; GO:0016601; P:Rac protein signal transduction; ISO:MGI.
GO; GO:0001881; P:receptor recycling; IMP:MGI.
GO; GO:0051036; P:regulation of endosome size; ISS:UniProtKB.
GO; GO:0043087; P:regulation of GTPase activity; IDA:MGI.
GO; GO:0035023; P:regulation of Rho protein signal transduction; IEA:InterPro.
GO; GO:0006979; P:response to oxidative stress; IMP:MGI.
GO; GO:0035249; P:synaptic transmission, glutamatergic; IMP:MGI.
GO; GO:0016050; P:vesicle organization; IDA:MGI.
Gene3D; 1.20.1050.80; -; 1.
Gene3D; 1.20.900.10; -; 1.
Gene3D; 2.130.10.30; -; 2.
Gene3D; 2.30.29.30; -; 1.
InterPro; IPR035899; DBL_dom_sf.
InterPro; IPR000219; DH-domain.
InterPro; IPR003409; MORN.
InterPro; IPR011993; PH-like_dom_sf.
InterPro; IPR009091; RCC1/BLIP-II.
InterPro; IPR000408; Reg_chr_condens.
InterPro; IPR003123; VPS9.
InterPro; IPR037191; VPS9_dom_sf.
Pfam; PF02493; MORN; 7.
Pfam; PF00415; RCC1; 4.
Pfam; PF00621; RhoGEF; 1.
Pfam; PF02204; VPS9; 1.
PRINTS; PR00633; RCCNDNSATION.
SMART; SM00698; MORN; 8.
SUPFAM; SSF109993; SSF109993; 1.
SUPFAM; SSF48065; SSF48065; 1.
SUPFAM; SSF50985; SSF50985; 2.
PROSITE; PS50010; DH_2; 1.
PROSITE; PS00626; RCC1_2; 2.
PROSITE; PS50012; RCC1_3; 4.
PROSITE; PS51205; VPS9; 1.
1: Evidence at protein level;
Acetylation; Alternative splicing; Complete proteome;
Guanine-nucleotide releasing factor; Phosphoprotein;
Reference proteome; Repeat.
CHAIN 1 1651 Alsin.
/FTId=PRO_0000080904.
REPEAT 59 108 RCC1 1. {ECO:0000305}.
REPEAT 109 167 RCC1 2. {ECO:0000305}.
REPEAT 169 218 RCC1 3. {ECO:0000305}.
REPEAT 519 570 RCC1 4. {ECO:0000305}.
REPEAT 572 621 RCC1 5. {ECO:0000305}.
DOMAIN 684 879 DH. {ECO:0000255|PROSITE-
ProRule:PRU00062}.
DOMAIN 895 1001 PH. {ECO:0000305}.
REPEAT 1043 1065 MORN 1.
REPEAT 1066 1088 MORN 2.
REPEAT 1094 1116 MORN 3.
REPEAT 1117 1139 MORN 4.
REPEAT 1145 1167 MORN 5.
REPEAT 1169 1191 MORN 6.
REPEAT 1192 1214 MORN 7.
REPEAT 1215 1238 MORN 8.
DOMAIN 1507 1651 VPS9. {ECO:0000255|PROSITE-
ProRule:PRU00550}.
MOD_RES 459 459 Phosphoserine.
{ECO:0000250|UniProtKB:Q96Q42}.
MOD_RES 460 460 Phosphoserine.
{ECO:0000250|UniProtKB:Q96Q42}.
MOD_RES 477 477 Phosphoserine.
{ECO:0000244|PubMed:17242355,
ECO:0000244|PubMed:21183079}.
MOD_RES 486 486 Phosphoserine.
{ECO:0000244|PubMed:17242355,
ECO:0000244|PubMed:21183079}.
MOD_RES 504 504 Phosphothreonine.
{ECO:0000250|UniProtKB:P0C5Y8}.
MOD_RES 527 527 N6-acetyllysine.
{ECO:0000244|PubMed:23806337}.
MOD_RES 1329 1329 Phosphoserine.
{ECO:0000250|UniProtKB:P0C5Y8}.
VAR_SEQ 855 928 TSPEYQKLQDSSSCYESLALHLGKKRKEAEYTLSFWKTFPG
KMTDSLRKPERRLLCESSNRALSLQHAGRFSVN -> VGFV
CAPPNTREAKSQSSLFALSLLKMLGPGAGEMAQWVRAPDCS
SEGLEFKSQQPHGGSQPPVMRSDALFWSV (in isoform
2). {ECO:0000303|PubMed:15489334}.
/FTId=VSP_050525.
VAR_SEQ 929 1651 Missing (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_050526.
CONFLICT 318 318 V -> I (in Ref. 1; BAB69016 and 4;
AAH31479). {ECO:0000305}.
CONFLICT 469 469 L -> S (in Ref. 1; BAB69016 and 4;
AAH31479). {ECO:0000305}.
CONFLICT 764 764 V -> F (in Ref. 4; AAH46828).
{ECO:0000305}.
CONFLICT 1206 1206 V -> L (in Ref. 5; BAB29271).
{ECO:0000305}.
CONFLICT 1296 1296 R -> H (in Ref. 1; BAB69016).
{ECO:0000305}.
CONFLICT 1452 1452 S -> L (in Ref. 1; BAB69016).
{ECO:0000305}.
SEQUENCE 1651 AA; 182566 MW; F9A9DBCA1ED423B2 CRC64;
MDSKKKSSTE AEGSKERGLV HVWQAGSFSL TPERLPGWGG KTVLQAALGV RHGVLLTEDG
EVYSFGTLPW KSESAEICPS SPLLESALVG HHVITVATGS FHSGAVTESG VVYMWGENAA
GQCAVANQQY VPEPSPVSIS DSETSPSLAV RILQLACGEE HTLALSLSRE IWAWGTGCQL
GLITTTFPVT KPQKVEHLAG RVVLQVACGA FHSLALVQCL PPQDLKPVPE RCNQCSQLLI
TMTDKEDHVI ISDSHCCPLG VTLSESQAEK HASPAPSPHP EALDEQGEVF ENTVVEAELN
MGSSQTTSGS AISTQQNVVG TAEVSSARTA PSYPDTHAVT AYLQKLSEHS MRENHEPGEK
PPQVQPLVEE AVPDLHSPPT TSTSALNSLV VSCASAVGVR VAATYEAGAL SLKKVMNFYS
TAPCETAAQS GSASTGPESL KDLREEQVKQ ESLQGKKSSS LMDIREEELE GGSRRLSLPG
LLSQVSPRLL RKAARVKTRT VVLTPTYSGE ADALLPSLRT EVWTWGKGKE GQLGHGDVLP
RLQPLCVKCL DGKEVIHLEA GGSHSLALTA KSQVYSWGSN TFGQLGHSEF PTTVPRLSKV
SSENGVWSVA AGQDYSLFLV DTEDFQPGLY YSGRQDRAEG DTLPENPSGT KTPVLLSCSK
LGYISRVTAG KDSYLALVDK NIMGYIASLH ELASTERRFY SKLSEIKSQI LRPLLSLENL
GTVTTVQLLQ EVASRFSKLC YLIGQHGASL SSYLQGMKEA SSLVIMKHSS LFLDSYTEYC
TSVSNFLVMG GFQLLAKPAI DFLNKNQELL QDLSEVNDEN TQLMEILNML FFLPIRRLHN
YAKVLLKLAT CFEVTSPEYQ KLQDSSSCYE SLALHLGKKR KEAEYTLSFW KTFPGKMTDS
LRKPERRLLC ESSNRALSLQ HAGRFSVNWF ILFNDALVHA QFSTHHVFPL ATLWAEPLSE
EAGSVNGLKI TTPEEQFTLI SSTPQEKTKW LRAISQAVDQ ALRGTSDFPL YGGGSSVQRQ
EPPISRSAKY TFYKDTRLKD ATYDGRWLSG KPHGRGVLKW PDGKMYSGMF RNGLEDGYGE
YRIPNKALNK EDHYVGHWKE GKMCGQGVYS YASGEVFEGC FQDNMRHGHG LLRSGKLTSS
SPSMFIGQWV MDKKAGYGVF DDITRGEKYM GMWQDDVCQG NGVVVTQFGL YYEGNFHLNK
MMGNGVLLSE DDTIYEGEFS DDWTLSGKGT LTMPHGDYIE GYFSGEWGSG IKITGTYFKP
SLYESDKDKP KAFRKLGNLA VAADEKWRAV FEECWRQLGC ESPGQGEVWK AWDNIAVALT
TNRRQHKDSP EILSRSQTQT LESLEYIPQH IGAFSVEKYD DIKKYLIKAC DTPLHPLGRL
VETLVAVYRM TYVGVGANRR LLQEAVKEIK SYLKRIFQLV RFLFPELPEE GSTIPLSAPL
PTGRRSFCTG KSDSRSESPE PGYVVTSSGL LLPVLLPRLY PPLFMLYALD NDREEDIYWE
CVLRLNKQPD IALLGFLGVQ KKFWPATLSI LGESKKVLST TKDACFASAV ECLQQISTTF
TPSDKLKVIQ QTFEEISQSV LASLQEDFLW SMDDLFPVFL YVVLRARIRN LGSEVHLIED
LMDPFLQHGE QGIMFTTLKA CYFQIQREKL N


Related products :

Catalog number Product name Quantity
EIAAB33770 ALS2CR18,ALS2CR9,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 18 protein,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 9 protein,Homo sapiens,Human,KIAA1681,La
EIAAB26446 ALS2CR16,ALS2CR17,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 16 protein,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 17 protein,Homo sapiens,Human,NBEAL1,Ne
EIAAB37985 Als4,Amyotrophic lateral sclerosis 4 protein homolog,Kiaa0625,Mouse,Mus musculus,Probable helicase senataxin,SEN1 homolog,Setx
EIAAB40404 Als2cr2,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein homolog,ILP-interacting protein homolog,Mouse,Mus musculus,Papk,Polyploidy-associated protein kinase,Pseudokinase AL
E2027m Bovine ELISA Kit FOR Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein homolog 96T
EIAAB42844 Als2cr4,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 4 protein homolog,Mouse,Mus musculus,Tmem237,Transmembrane protein 237
EIAAB37984 ALS4,Amyotrophic lateral sclerosis 4 protein,Homo sapiens,Human,KIAA0625,Probable helicase senataxin,SCAR1,SEN1 homolog,SETX
AL2S8_BOVIN ELISA Kit FOR Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein homolog; organism: Bovine; gene name: ALS2CR8 96T
EIAAB13628 Als2cr13,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 13 protein homolog,Fam117b,Mouse,Mus musculus,Protein FAM117B
EIAAB29886 Als2cr19,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein homolog,Mouse,Mus musculus,PAR3-beta,Par3l,PAR3-L protein,Pard3b,Partitioning defective 3 homolog B,Partitioning d
EIAAB25286 ALS2CR5,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 5 protein,Discs large homolog 6,DLG6,Homo sapiens,Human,MAGUK p55 subfamily member 4,MPP4
EIAAB43783 Als2cr3,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 3 protein homolog,GABA-A receptor-interacting factor 1,Grif1,GRIF-1,O-GlcNAc transferase-interacting protein of 98 kDa,Oip98,R
EIAAB06512 Als2cr7,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 7 protein homolog,Cdk15,Cell division protein kinase 15,Cyclin-dependent kinase 15,Mouse,Mus musculus,Pftk2,Serine_threonine-p
TM-151-55 Rabbit anti_Human Amyotrophic lateral sclerosis protein 2 (ALS2) IgG fraction polyclonal antibody 150 µg
15-288-21292 Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein - Polyclonal 0.05 mg
15-288-21292 Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein - Polyclonal 0.1 mg
EIAAB29887 ALS2CR19,Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein,Homo sapiens,Human,PAR3B,PAR3-beta,PAR3L,PAR3-L protein,PARD3B,Partitioning defective 3 homolog B,Partitioning def
E1328c Human ELISA Kit FOR Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein 96T
PN-7100a-9 Rabbit anti_Human Amyotrophic lateral sclerosis protein 2 (ALS2) IgG fraction polyclonal antibody 1mg
PN-7100a-9 Rabbit anti_Human Amyotrophic lateral sclerosis protein 2 (ALS2) IgG fraction polyclonal antibody 1 mg
CSB-EL001639RA Rat Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein(ALS2CR12) ELISA kit 96T
CSB-EL001642MO Mouse Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8 protein(ALS2CR8) ELISA kit 96T
CSB-EL001639RA Rat Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein(ALS2CR12) ELISA kit SpeciesRat 96T
CSB-EL001639MO Mouse Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 12 protein(ALS2CR12) ELISA kit 96T
CSB-EL001638HU Human Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 11 protein(ALS2CR11) ELISA kit 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1049: G Protein Signaling Pathways
WP1165: G Protein Signaling Pathways
WP1371: G Protein Signaling Pathways
WP1438: Influenza A virus infection
WP1493: Carbon assimilation C4 pathway
WP1502: Mitochondrial biogenesis
WP1531: Vitamin D synthesis
WP1566: Citrate cycle (TCA cycle)
WP1613: 1,4-Dichlorobenzene degradation
WP1616: ABC transporters
WP1624: Bacterial secretion system
WP1625: Base excision repair
WP1644: DNA replication
WP1650: Fluorobenzoate degradation
WP1654: gamma-Hexachlorocyclohexane degradation
WP1657: Glycerolipid metabolism
WP1659: Glycine, serine and threonine metabolism
WP1661: Glyoxylate and dicarboxylate metabolism
WP1663: Homologous recombination
WP1665: Limonene and pinene degradation
WP1672: Mismatch repair
WP1673: Naphthalene and anthracene degradation
WP1675: Nitrogen metabolism
WP1676: Non-homologous end-joining
WP1678: Nucleotide excision repair

Related Genes :
[SETX ALS4 KIAA0625 SCAR1] Probable helicase senataxin (EC 3.6.4.-) (Amyotrophic lateral sclerosis 4 protein) (SEN1 homolog) (Senataxin)
[PARD3B ALS2CR19 PAR3B PAR3L] Partitioning defective 3 homolog B (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein) (PAR3-beta) (Partitioning defective 3-like protein) (PAR3-L protein)
[STRADB ALS2CR2 ILPIP PRO1038] STE20-related kinase adapter protein beta (STRAD beta) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein) (CALS-21) (ILP-interacting protein) (Pseudokinase ALS2CR2)
[Stradb Als2cr2 Papk Syradb] STE20-related kinase adapter protein beta (STRAD beta) (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 2 protein homolog) (ILP-interacting protein homolog) (Polyploidy-associated protein kinase) (Pseudokinase ALS2CR2)
[Pard3b Als2cr19 Par3l] Partitioning defective 3 homolog B (Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 19 protein homolog) (PAR3-beta) (Partitioning defective 3-like protein) (PAR3-L protein)
[Setx Als4 Kiaa0625] Probable helicase senataxin (EC 3.6.4.-) (Amyotrophic lateral sclerosis 4 protein homolog) (SEN1 homolog)
[UBQLN2 N4BP4 PLIC2 HRIHFB2157] Ubiquilin-2 (Chap1) (DSK2 homolog) (Protein linking IAP with cytoskeleton 2) (PLIC-2) (hPLIC-2) (Ubiquitin-like product Chap1/Dsk2)
[Tsc2] Tuberin (Tuberous sclerosis 2 protein homolog)
[SOD1] Superoxide dismutase [Cu-Zn] (EC 1.15.1.1) (Superoxide dismutase 1) (hSod1)
[Tsc2] Tuberin (Tuberous sclerosis 2 protein homolog)
[SQSTM1 ORCA OSIL] Sequestosome-1 (EBI3-associated protein of 60 kDa) (EBIAP) (p60) (Phosphotyrosine-independent ligand for the Lck SH2 domain of 62 kDa) (Ubiquitin-binding protein p62)
[OPTN FIP2 GLC1E HIP7 HYPL NRP] Optineurin (E3-14.7K-interacting protein) (FIP-2) (Huntingtin yeast partner L) (Huntingtin-interacting protein 7) (HIP-7) (Huntingtin-interacting protein L) (NEMO-related protein) (Optic neuropathy-inducing protein) (Transcription factor IIIA-interacting protein) (TFIIIA-IntP)
[TBK1 NAK] Serine/threonine-protein kinase TBK1 (EC 2.7.11.1) (NF-kappa-B-activating kinase) (T2K) (TANK-binding kinase 1)
[CHMP2B CGI-84] Charged multivesicular body protein 2b (CHMP2.5) (Chromatin-modifying protein 2b) (CHMP2b) (Vacuolar protein sorting-associated protein 2-2) (Vps2-2) (hVps2-2)
[TARDBP TDP43] TAR DNA-binding protein 43 (TDP-43)
[VCP] Transitional endoplasmic reticulum ATPase (TER ATPase) (EC 3.6.4.6) (15S Mg(2+)-ATPase p97 subunit) (Valosin-containing protein) (VCP)
[NEK1 KIAA1901] Serine/threonine-protein kinase Nek1 (EC 2.7.11.1) (Never in mitosis A-related kinase 1) (NimA-related protein kinase 1) (Renal carcinoma antigen NY-REN-55)
[ERBB4 HER4] Receptor tyrosine-protein kinase erbB-4 (EC 2.7.10.1) (Proto-oncogene-like protein c-ErbB-4) (Tyrosine kinase-type cell surface receptor HER4) (p180erbB4) [Cleaved into: ERBB4 intracellular domain (4ICD) (E4ICD) (s80HER4)]
[FUS TLS] RNA-binding protein FUS (75 kDa DNA-pairing protein) (Oncogene FUS) (Oncogene TLS) (POMp75) (Translocated in liposarcoma protein)
[TSC2 TSC4] Tuberin (Tuberous sclerosis 2 protein)
[ANG RNASE5] Angiogenin (EC 3.1.27.-) (Ribonuclease 5) (RNase 5)
[C9orf72] Guanine nucleotide exchange C9orf72
[PARK7] Protein/nucleic acid deglycase DJ-1 (EC 3.1.2.-) (EC 3.5.1.-) (EC 3.5.1.124) (Maillard deglycase) (Oncogene DJ1) (Parkinson disease protein 7) (Parkinsonism-associated deglycase) (Protein DJ-1) (DJ-1)
[VAPB UNQ484/PRO983] Vesicle-associated membrane protein-associated protein B/C (VAMP-B/VAMP-C) (VAMP-associated protein B/C) (VAP-B/VAP-C)
[CHCHD10 C22orf16] Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial (Protein N27C7-4)
[OMA1 MPRP1] Metalloendopeptidase OMA1, mitochondrial (EC 3.4.24.-) (Metalloprotease-related protein 1) (MPRP-1) (Overlapping with the m-AAA protease 1 homolog)
[HNRNPA1 HNRPA1] Heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) (Helix-destabilizing protein) (Single-strand RNA-binding protein) (hnRNP core protein A1) [Cleaved into: Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed]
[TMEM106B] Transmembrane protein 106B
[Tsc1] Hamartin (Tuberous sclerosis 1 protein homolog)
[DNAJB2 HSJ1 HSPF3] DnaJ homolog subfamily B member 2 (Heat shock 40 kDa protein 3) (Heat shock protein J1) (HSJ-1)

Bibliography :
No related Items