GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Bifunctional lycopene cyclase/phytoene synthase [Includes: Lycopene beta-cyclase (EC 5.5.1.19) (Lycopene cyclase); Phytoene synthase (EC 2.5.1.32)]

 LCPS_PHARH              Reviewed;         673 AA.
Q7Z859; Q7Z856; Q9UUQ0;
31-MAY-2011, integrated into UniProtKB/Swiss-Prot.
01-OCT-2003, sequence version 1.
05-DEC-2018, entry version 67.
RecName: Full=Bifunctional lycopene cyclase/phytoene synthase;
Includes:
RecName: Full=Lycopene beta-cyclase;
EC=5.5.1.19;
AltName: Full=Lycopene cyclase;
Includes:
RecName: Full=Phytoene synthase;
EC=2.5.1.32;
Name=crtYB; Synonyms=pbs;
Phaffia rhodozyma (Yeast) (Xanthophyllomyces dendrorhous).
Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
Tremellomycetes; Cystofilobasidiales; Mrakiaceae; Xanthophyllomyces.
NCBI_TaxID=5421;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND FUNCTION.
STRAIN=CBS 6938 / CCRC 22365 / VKM Y-2793;
PubMed=10589832; DOI=10.1007/s004380051105;
Verdoes J.C., Krubasik K.P., Sandmann G., van Ooyen A.J.;
"Isolation and functional characterisation of a novel type of
carotenoid biosynthetic gene from Xanthophyllomyces dendrorhous.";
Mol. Gen. Genet. 262:453-461(1999).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
STRAIN=ATCC 24230 / UCD 67-385;
PubMed=12902257; DOI=10.1128/AEM.69.8.4676-4682.2003;
Lodato P., Alcaino J., Barahona S., Retamales P., Cifuentes V.;
"Alternative splicing of transcripts from crtI and crtYB genes of
Xanthophyllomyces dendrorhous.";
Appl. Environ. Microbiol. 69:4676-4682(2003).
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND INDUCTION.
STRAIN=ATCC 24230 / UCD 67-385;
PubMed=18769767; DOI=10.4067/S0716-97602008000100011;
Niklitschek M., Alcaino J., Barahona S., Sepulveda D., Lozano C.,
Carmona M., Marcoleta A., Martinez C., Lodato P., Baeza M.,
Cifuentes V.;
"Genomic organization of the structural genes controlling the
astaxanthin biosynthesis pathway of Xanthophyllomyces dendrorhous.";
Biol. Res. 41:93-108(2008).
[4]
FUNCTION.
PubMed=16928467; DOI=10.1016/j.bbalip.2006.06.002;
Sandmann G., Zhu C., Krubasik P., Fraser P.D.;
"The biotechnological potential of the al-2 gene from Neurospora
crassa for the production of monocyclic keto hydroxy carotenoids.";
Biochim. Biophys. Acta 1761:1085-1092(2006).
[5]
INDUCTION.
STRAIN=ATCC 24230 / UCD 67-385;
PubMed=17657357;
Lodato P., Alcaino J., Barahona S., Niklitschek M., Carmona M.,
Wozniak A., Baeza M., Jimenez A., Cifuentes V.;
"Expression of the carotenoid biosynthesis genes in Xanthophyllomyces
dendrorhous.";
Biol. Res. 40:73-84(2007).
-!- FUNCTION: Bifunctional enzyme that catalyzes the reactions from
geranylgeranyl diphosphate to phytoene (phytoene synthase) and
lycopene to beta-carotene via the intermediate gamma-carotene
(lycopene cyclase). The cyclase preferentially catalyzes the
symmetric cyclization of both ends of the substrate to produce
dicyclic carotenoids. Beta-carotene is further processed to the
acidic carotenoid astaxanthin. {ECO:0000269|PubMed:10589832,
ECO:0000269|PubMed:16928467}.
-!- CATALYTIC ACTIVITY:
Reaction=a carotenoid psi-end group = a carotenoid beta-end
derivative; Xref=Rhea:RHEA:55620, ChEBI:CHEBI:139114,
ChEBI:CHEBI:139120; EC=5.5.1.19;
-!- CATALYTIC ACTIVITY:
Reaction=2 all-trans-geranylgeranyl diphosphate = 15-cis-phytoene
+ 2 diphosphate; Xref=Rhea:RHEA:34475, ChEBI:CHEBI:27787,
ChEBI:CHEBI:33019, ChEBI:CHEBI:58756; EC=2.5.1.32;
-!- PATHWAY: Carotenoid biosynthesis; beta-carotene biosynthesis.
-!- PATHWAY: Carotenoid biosynthesis; phytoene biosynthesis; all-
trans-phytoene from geranylgeranyl diphosphate: step 1/1.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Multi-pass membrane
protein {ECO:0000305}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q7Z859-1; Sequence=Displayed;
Name=2;
IsoId=Q7Z859-2; Sequence=VSP_041283;
-!- INDUCTION: Down-regulated in stationary phase.
{ECO:0000269|PubMed:17657357, ECO:0000269|PubMed:18769767}.
-!- SIMILARITY: In the N-terminal section; belongs to the lycopene
beta-cyclase family. {ECO:0000305}.
-!- SIMILARITY: In the C-terminal section; belongs to the
phytoene/squalene synthase family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AJ133646; CAB51949.1; -; Genomic_DNA.
EMBL; AY174117; AAO73816.1; -; mRNA.
EMBL; AY177204; AAO47570.1; -; mRNA.
EMBL; DQ016503; AAY33923.1; -; Genomic_DNA.
ProteinModelPortal; Q7Z859; -.
PRIDE; Q7Z859; -.
BioCyc; MetaCyc:MONOMER-17247; -.
UniPathway; UPA00799; UER00773.
UniPathway; UPA00802; -.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0004310; F:farnesyl-diphosphate farnesyltransferase activity; IEA:InterPro.
GO; GO:0016767; F:geranylgeranyl-diphosphate geranylgeranyltransferase activity; IDA:UniProtKB.
GO; GO:0016872; F:intramolecular lyase activity; IEA:InterPro.
GO; GO:0045436; F:lycopene beta cyclase activity; IDA:UniProtKB.
GO; GO:0046905; F:phytoene synthase activity; IDA:UniProtKB.
GO; GO:0051996; F:squalene synthase activity; IEA:InterPro.
GO; GO:0016120; P:carotene biosynthetic process; IDA:UniProtKB.
GO; GO:0016117; P:carotenoid biosynthetic process; IEA:UniProtKB-KW.
GO; GO:0006696; P:ergosterol biosynthetic process; IEA:InterPro.
CDD; cd00683; Trans_IPPS_HH; 1.
Gene3D; 1.10.600.10; -; 2.
InterPro; IPR008949; Isoprenoid_synthase_dom_sf.
InterPro; IPR017825; Lycopene_cyclase_dom.
InterPro; IPR002060; Squ/phyt_synthse.
InterPro; IPR019845; Squalene/phytoene_synthase_CS.
InterPro; IPR033904; Trans_IPPS_HH.
SFLD; SFLDG01018; Squalene/Phytoene_Synthase_Lik; 1.
SUPFAM; SSF48576; SSF48576; 1.
TIGRFAMs; TIGR03462; CarR_dom_SF; 2.
PROSITE; PS01045; SQUALEN_PHYTOEN_SYN_2; 1.
2: Evidence at transcript level;
Alternative splicing; Carotenoid biosynthesis; Isomerase; Membrane;
Multifunctional enzyme; Transferase; Transmembrane;
Transmembrane helix.
CHAIN 1 673 Bifunctional lycopene cyclase/phytoene
synthase.
/FTId=PRO_0000409239.
TRANSMEM 9 29 Helical. {ECO:0000255}.
TRANSMEM 36 56 Helical. {ECO:0000255}.
TRANSMEM 81 101 Helical. {ECO:0000255}.
TRANSMEM 117 137 Helical. {ECO:0000255}.
TRANSMEM 157 177 Helical. {ECO:0000255}.
TRANSMEM 187 207 Helical. {ECO:0000255}.
TRANSMEM 226 246 Helical. {ECO:0000255}.
REGION 1 251 Lycopene beta-cyclase.
REGION 258 673 Phytoene synthase.
COMPBIAS 367 405 Pro-rich.
VAR_SEQ 1 46 MTALAYYQIHLIYTLPILGLLGLLTSPILTKFDIYKISILV
FIAFS -> MSPYLFFVLHTTHVCICV (in isoform
2). {ECO:0000303|PubMed:12902257}.
/FTId=VSP_041283.
VARIANT 307 307 E -> K (in strain: CBS 6938 / CCRC 22365
/ VKM Y-2793).
SEQUENCE 673 AA; 74736 MW; ECAB54AF256240A2 CRC64;
MTALAYYQIH LIYTLPILGL LGLLTSPILT KFDIYKISIL VFIAFSATTP WDSWIIRNGA
WTYPSAESGQ GVFGTFLDVP YEEYAFFVIQ TVITGLVYVL ATRHLLPSLA LPKTRSSALS
LALKALIPLP IIYLFTAHPS PSPDPLVTDH YFYMRALSLL ITPPTMLLAA LSGEYAFDWK
SGRAKSTIAA IMIPTVYLIW VDYVAVGQDS WSINDEKIVG WRLGGVLPIE EAMFFLLTNL
MIVLGLSACD HTQALYLLHG RTIYGNKKMP SSFPLITPPV LSLFFSSRPY SSQPKRDLEL
AVKLLEEKSR SFFVASAGFP SEVRERLVGL YAFCRVTDDL IDSPEVSSNP HATIDMVSDF
LTLLFGPPLH PSQPDKILSS PLLPPSHPSR PTGMYPLPPP PSLSPAELVQ FLTERVPVQY
HFAFRLLAKL QGLIPRYPLD ELLRGYTTDL IFPLSTEAVQ ARKTPIETTA DLLDYGLCVA
GSVAELLVYV SWASAPSQVP ATIEEREAVL VASREMGTAL QLVNIARDIK GDATEGRFYL
PLSFFGLRDE SKLAIPTDWT EPRPQDFDKL LSLSPSSTLP SSNASESFRF EWKTYSLPLV
AYAEDLAKHS YKGIDRLPTE VQAGMRAACA SYLLIGREIK VVWKGDVGER RTVAGWRRVR
KVLSVVMSGW EGQ


Related products :

Catalog number Product name Quantity
AS13 2709 rabbit polyclonal LYC | Lycopene beta cyclase, chloroplastic 50
AS13 2709 LYC | Lycopene beta cyclase, chloroplastic Host:Rabbit polyclonal antibody serum Lyophilized 50
U1898h CLIA 2,3-epoxysqualene--lanosterol cyclase,Homo sapiens,hOSC,Human,Lanosterol synthase,LSS,OSC,OSC,Oxidosqualene--lanosterol cyclase 96T
E1898h ELISA 2,3-epoxysqualene--lanosterol cyclase,Homo sapiens,hOSC,Human,Lanosterol synthase,LSS,OSC,OSC,Oxidosqualene--lanosterol cyclase 96T
U1898h CLIA kit 2,3-epoxysqualene--lanosterol cyclase,Homo sapiens,hOSC,Human,Lanosterol synthase,LSS,OSC,OSC,Oxidosqualene--lanosterol cyclase 96T
E1898h ELISA kit 2,3-epoxysqualene--lanosterol cyclase,Homo sapiens,hOSC,Human,Lanosterol synthase,LSS,OSC,OSC,Oxidosqualene--lanosterol cyclase 96T
M80586083 Lycopene CAS: [502-65-8] 1 mg
BP0901 Lycopene 20mg
BP0901 Lycopene 1000mg
BP0901 Lycopene 100mg
U1898b CLIA 2,3-epoxysqualene--lanosterol cyclase,Bos taurus,Bovine,Lanosterol synthase,LSS,OSC,Oxidosqualene--lanosterol cyclase 96T
U1898m CLIA kit 2,3-epoxysqualene--lanosterol cyclase,Lanosterol synthase,Lss,Mouse,Mus musculus,OSC,Oxidosqualene--lanosterol cyclase 96T
E1898b ELISA 2,3-epoxysqualene--lanosterol cyclase,Bos taurus,Bovine,Lanosterol synthase,LSS,OSC,Oxidosqualene--lanosterol cyclase 96T
U1898b CLIA kit 2,3-epoxysqualene--lanosterol cyclase,Bos taurus,Bovine,Lanosterol synthase,LSS,OSC,Oxidosqualene--lanosterol cyclase 96T
E1898m ELISA 2,3-epoxysqualene--lanosterol cyclase,Lanosterol synthase,Lss,Mouse,Mus musculus,OSC,Oxidosqualene--lanosterol cyclase 96T
E1898r ELISA 2,3-epoxysqualene--lanosterol cyclase,Lanosterol synthase,Lss,OSC,Osc,Oxidosqualene--lanosterol cyclase,Rat,Rattus norvegicus 96T
E1898m ELISA kit 2,3-epoxysqualene--lanosterol cyclase,Lanosterol synthase,Lss,Mouse,Mus musculus,OSC,Oxidosqualene--lanosterol cyclase 96T
E1898r ELISA kit 2,3-epoxysqualene--lanosterol cyclase,Lanosterol synthase,Lss,OSC,Osc,Oxidosqualene--lanosterol cyclase,Rat,Rattus norvegicus 96T
E1898b ELISA kit 2,3-epoxysqualene--lanosterol cyclase,Bos taurus,Bovine,Lanosterol synthase,LSS,OSC,Oxidosqualene--lanosterol cyclase 96T
U1898r CLIA 2,3-epoxysqualene--lanosterol cyclase,Lanosterol synthase,Lss,OSC,Osc,Oxidosqualene--lanosterol cyclase,Rat,Rattus norvegicus 96T
U1898m CLIA 2,3-epoxysqualene--lanosterol cyclase,Lanosterol synthase,Lss,Mouse,Mus musculus,OSC,Oxidosqualene--lanosterol cyclase 96T
U1898r CLIA kit 2,3-epoxysqualene--lanosterol cyclase,Lanosterol synthase,Lss,OSC,Osc,Oxidosqualene--lanosterol cyclase,Rat,Rattus norvegicus 96T
L487502 Lycopene-d6 C40H50D6 CAS: 2.5 mg
L487500 Lycopene C40H56 CAS: 502-65-8 10 mg
2753 LYCOPENE, SERUM 1

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP668: Octadecanoid Pathway
WP1693: Purine metabolism
WP2204: Lycopene biosynthesis
WP1403: AMPK signaling
WP1422: Sphingolipid Metabolism
WP1423: Ganglio Sphingolipid Metabolism
WP1424: Globo Sphingolipid Metabolism
WP1461: Photosynthetic Carbon Reduction
WP1621: Arginine and proline metabolism
WP1708: Terpenoid backbone biosynthesis
WP2199: Seed Development
WP2208: Cardiolipin Biosynthesis
WP2210: Oryzalexin S biosynthesis
WP2211: Geranylgeranyldiphosphate biosynthesis II (plastidic)
WP2248: anthocyanin biosynthesis
WP2340: Thiamine (vitamin B1) biosynthesis and salvage
WP2341: vitamin B1 (thiamin) biosynthesis and salvage pathway
WP296: TCA Cycle - biocyc
WP626: Abscisic Acid Biosynthesis
WP677: Momilactone biosynthesis
WP1045: TGF-beta Receptor Signaling Pathway
WP1048: TGF Beta Signaling Pathway
WP105: Fatty Acid Beta Oxidation 2
WP1058: Senescence and Autophagy
WP1061: Fatty Acid Beta Oxidation

Related Genes :
[al-2 B22I21.230 NCU00585] Bifunctional lycopene cyclase/phytoene synthase (Protein albino-2) [Includes: Lycopene beta-cyclase (EC 5.5.1.19) (Carotene cyclase) (Lycopene cyclase); Phytoene synthase (EC 2.5.1.32)]
[NSY B Solyc06g074240.1] Neoxanthin synthase, chloroplastic (EC 5.3.99.9) (Lycopene beta-cyclase) (EC 5.5.1.19)
[LCY1 LCYB LYC SZL1 At3g10230 F14P13.17] Lycopene beta cyclase, chloroplastic (EC 5.5.1.19) (AtLCY) (Protein SUPPRESSOR OF ZEAXANTHIN-LESS 1)
[crtC] Acyclic carotenoid 1,2-hydratase (EC 4.2.1.131) (1-hydroxyneurosporene hydratase) (Hydroxylycopene hydratase) (Hydroxyneurosporene synthase) (Lycopene hydratase) (Neurosporene hydratase)
[PSY1] Bifunctional 15-cis-phytoene synthase, chromoplastic (EC 2.5.1.32) (Geranylgeranyl pyrophosphate geranylgeranyltransferase) (Phytoene synthase)
[LUT2 At5g57030 MHM17.16] Lycopene epsilon cyclase, chloroplastic (EC 5.5.1.18) (Protein LUTEIN DEFICIENT 2)
[PDS1 PDS OsI_010044] 15-cis-phytoene desaturase, chloroplastic/chromoplastic (EC 1.3.5.5) (Phytoene dehydrogenase) (Phytoene desaturase)
[AS ac22 ag22] Bifunctional abietadiene synthase, chloroplastic ((-)-abieta-7(8),13(14)-diene synthase) (Abietadiene cyclase) (AgAS) (Agggabi) [Includes: Abietadiene synthase (EC 4.2.3.18) (Neoabietadiene synthase) (EC 4.2.3.132); Copalyl diphosphate synthase (EC 5.5.1.12)]
[ZDS1 CLB5 PDE181 SPC1 ZDS At3g04870 T9J14.18] Zeta-carotene desaturase, chloroplastic/chromoplastic (EC 1.3.5.6) (9,9'-di-cis-zeta-carotene desaturase) (Carotene 7,8-desaturase) (Protein CHLOROPLAST BIOGENESIS 5) (Protein PIGMENT DEFECTIVE 181) (Protein SPONTANEOUS CELL DEATH 1)
[crtB/uppS3 SCP1.212] Bifunctional protein CrtB/UppS [Includes: Phytoene synthase (EC 2.5.1.32); Isoprenyl transferase (EC 2.5.1.-)]
[LAS] Bifunctional abietadiene synthase, chloroplastic (Abietadiene cyclase) (Diterpene synthase TPS1) (AbdiTPS1) (Levopimaradiene/abietadiene synthase) (AbLAS) [Includes: Abietadiene synthase (EC 4.2.3.18) (Levopimaradiene synthase) (EC 4.2.3.32) (Neoabietadiene synthase) (EC 4.2.3.132); Copalyl diphosphate synthase (EC 5.5.1.12)] (Fragment)
[hchA A8C65_13880 A9R57_25255 AKG99_20940 AMK83_16550 B7C53_22525 B9M99_11580 B9T59_01945 BJJ90_15205 BMT49_12710 BMT53_00170 BUE81_10670 BW690_17225 BZL69_29425 C2U48_24800 C5715_19445 C5N07_21380 C6669_19295 C7B06_02290 C7B07_03930 CDL37_00765 CG691_19145 CG705_13560 CG706_14580 CIJ94_05515 COD46_23180 CRD98_26150 D3I61_11545 DL800_09215 DNQ41_14245 DQE83_22775 DTL43_21780 DTL84_23375 DTM25_06080 EC95NR1_00961 ERS085379_01273 ERS085386_05041 HMPREF3040_01583 HW43_13705 NCTC10082_04431 NCTC10418_03071 NCTC10767_03558 NCTC11022_01867 NCTC11126_04427 NCTC11181_05650 NCTC12950_02263 NCTC13462_05714 NCTC8985_00529 NCTC9111_05933 NCTC9703_00277 PU06_24500 SAMEA3472055_03589 SAMEA3472056_01268 SAMEA3472070_00654 SAMEA3472080_04213 SAMEA3472090_03376 SAMEA3472110_00060 SAMEA3472112_00448 SAMEA3752372_00752 SAMEA3753106_00003 SAMEA3753391_00513 UN91_23615 WQ89_10695] Protein/nucleic acid deglycase HchA (EC 3.1.2.-) (EC 3.5.1.-) (EC 3.5.1.124) (Maillard deglycase)
[aro-1 aro-2 aro-4 aro-5 aro-9 B14H13.20 NCU016321] Pentafunctional AROM polypeptide [Includes: 3-dehydroquinate synthase (DHQS) (EC 4.2.3.4); 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS); Shikimate kinase (SK) (EC 2.7.1.71); 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10); Shikimate dehydrogenase (EC 1.1.1.25)]
[ADCY5] Adenylate cyclase type 5 (EC 4.6.1.1) (ATP pyrophosphate-lyase 5) (Adenylate cyclase type V) (Adenylyl cyclase 5) (Ca(2+)-inhibitable adenylyl cyclase)
[LSS OSC] Lanosterol synthase (EC 5.4.99.7) (2,3-epoxysqualene--lanosterol cyclase) (Oxidosqualene--lanosterol cyclase) (OSC) (hOSC)
[ERG7 YHR072W] Lanosterol synthase (EC 5.4.99.7) (2,3-epoxysqualene--lanosterol cyclase) (Oxidosqualene--lanosterol cyclase) (OSC)
[CAS1 CYC At2g07050 T4E14.16] Cycloartenol synthase (AtCYC) (EC 5.4.99.8) (2,3-epoxysqualene--cycloartenol cyclase)
[PSY1 PSY At5g17230 MKP11.8] Phytoene synthase, chloroplastic (EC 2.5.1.32)
[ADCY5] Adenylate cyclase type 5 (EC 4.6.1.1) (ATP pyrophosphate-lyase 5) (Adenylate cyclase type V) (Adenylyl cyclase 5) (AC5)
[LCY1 LYC] Lycopene beta cyclase, chloroplastic/chromoplastic (EC 5.5.1.19)
[LCY1 CRTL-1] Lycopene beta cyclase, chloroplastic (EC 5.5.1.19)
[Adcy5] Adenylate cyclase type 5 (EC 4.6.1.1) (ATP pyrophosphate-lyase 5) (Adenylate cyclase type V) (Adenylyl cyclase 5)
[Adcy5] Adenylate cyclase type 5 (EC 4.6.1.1) (ATP pyrophosphate-lyase 5) (Adenylate cyclase type V) (Adenylyl cyclase 5)
[ADCY5] Adenylate cyclase type 5 (EC 4.6.1.1) (ATP pyrophosphate-lyase 5) (Adenylate cyclase type V) (Adenylyl cyclase 5)
[crtB] 15-cis-phytoene synthase (EC 2.5.1.32) (Phytoene synthase) (PSase)
[TKFC DAK] Triokinase/FMN cyclase (Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing)) [Includes: ATP-dependent dihydroxyacetone kinase (DHA kinase) (EC 2.7.1.28) (EC 2.7.1.29) (Glycerone kinase) (Triokinase) (Triose kinase); FAD-AMP lyase (cyclizing) (EC 4.6.1.15) (FAD-AMP lyase (cyclic FMN forming)) (FMN cyclase)]
[al-3 B8P8.010 NCU01427] Geranylgeranyl pyrophosphate synthase (GGPP synthase) (GGPPSase) (EC 2.5.1.-) ((2E,6E)-farnesyl diphosphate synthase) (Albino-3 protein) (Dimethylallyltranstransferase) (EC 2.5.1.1) (Farnesyl diphosphate synthase) (Farnesyltranstransferase) (EC 2.5.1.29) (Geranylgeranyl diphosphate synthase) (Geranyltranstransferase) (EC 2.5.1.10)
[cya cyaA BP0760] Bifunctional hemolysin/adenylate cyclase (AC-HLY) (ACT) (Cyclolysin) [Cleaved into: Calmodulin-sensitive adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Adenylyl cyclase); Hemolysin]
[pyrG A6592_02570 A8M42_16405 A9R57_06965 AC067_22330 AC789_1c31020 ACN002_2797 ACN77_07080 ACN81_20385 ACU57_24415 ACU90_23015 AJ318_22735 AKG99_03555 AM270_00945 AM446_06950 AM464_05605 AM465_10605 AML07_12460 AML35_05300 APT94_17890 APU18_18535 APZ14_09290 ARC77_10140 AU473_08010 AUQ13_17535 AUS26_15660 AW059_10675 AW106_00665 AWP75_20610 AZZ83_003241 B1K96_20050 B7C53_10055 B9M99_21725 B9N33_09475 B9T59_19685 BB545_13920 BE963_03670 BEN53_16995 BET08_07180 BH694_13410 BHF46_05050 BHS81_16640 BHS87_15735 BIQ87_15835 BIU72_09520 BIZ41_16885 BJJ90_05265 BK248_12970 BK292_23205 BK334_11935 BK373_15870 BK375_10085 BK383_11680 BK400_05820 BMT49_17330 BMT53_21250 BMT91_11105 BN17_26661 BTQ04_11510 BTQ06_23845 BUE81_06975 BVL39_12970 BW690_04975 BWP17_05185 BXT93_24405 BZL31_00820 BZL69_02125 C1I57_04860 C2M16_17770 C2U48_20025 C3K24_08940 C4J69_11655 C4K41_05275 C4M78_00835 C5715_23540 C5N07_06155 C5P01_05005 C5P43_15935 C5P44_09340 C6669_14670 C6986_17750 C6B13_03370 C7235_05745 C7B02_19400 C7B06_11630 C7B07_14530 C7B08_01430 C9E25_03325 CA593_12975 CCZ14_04445 CCZ17_10850 CDL37_13440 CG691_07365 CG692_07005 CG705_05530 CG706_07860 CIJ94_12220 COD30_01795 COD46_07095 CR538_05495 CR539_18815 CRE06_03485 CRM83_26360 CSB64_15850 CT143_09630 CT146_00680 CV83915_03339 CVH05_06295 CWM24_00790 CWS33_03125 CXB56_08765 D0X26_06660 D1900_12730 D2183_19100 D2F89_14380 D3I61_16000 DD762_13665 DIV22_29760 DIV25_29790 DL545_05995 DL800_20505 DNQ41_18960 DNR41_08670 DQE83_04685 DS732_20695 DS966_06010 DTL43_09355 DTL84_00105 DTL90_02675 DTM10_03745 DTM25_22630 DTM27_13675 DTM45_13530 EC1094V2_904 EC3234A_48c00890 EC95NR1_02021 ECONIH1_15890 ECs3640 EL75_0914 EL79_0915 EL80_0918 ERS085365_02427 ERS085366_03042 ERS085374_03279 ERS085386_03410 ERS085416_02898 ERS139211_02072 ERS150873_02003 ERS150876_01467 FORC28_1110 GJ11_18025 HMPREF3040_01161 HW43_18180 JD73_16335 MJ49_17095 MS6198_30910 MS8345_02965 NCTC10082_03473 NCTC10090_04050 NCTC10418_01701 NCTC10764_00296 NCTC10766_00690 NCTC10767_02309 NCTC11022_02860 NCTC11112_00121 NCTC11181_03277 NCTC12950_01251 NCTC13125_04353 NCTC13127_01436 NCTC13462_04807 NCTC13846_01212 NCTC7152_00995 NCTC7927_01209 NCTC8500_01090 NCTC8960_03783 NCTC9007_03892 NCTC9010_01168 NCTC9036_01135 NCTC9037_01243 NCTC9045_01221 NCTC9050_04166 NCTC9058_00847 NCTC9062_02131 NCTC9075_01630 NCTC9077_01409 NCTC9081_05851 NCTC9117_01609 NCTC9119_01271 NCTC9434_01004 NCTC9706_03296 NCTC9775_04845 NCTC9777_02704 NCTC9969_01292 PU06_02080 RG28_07675 RK56_023165 SAMEA3472033_01264 SAMEA3472044_02272 SAMEA3472047_00339 SAMEA3472056_05455 SAMEA3472067_02540 SAMEA3472070_01673 SAMEA3472080_03155 SAMEA3472090_00131 SAMEA3472108_00527 SAMEA3472110_03462 SAMEA3472112_03722 SAMEA3472114_02432 SAMEA3472147_03296 SAMEA3484427_03298 SAMEA3484429_03415 SAMEA3484433_01660 SAMEA3484434_01581 SAMEA3485101_02257 SAMEA3485113_02257 SAMEA3752372_03639 SAMEA3752557_03040 SAMEA3752559_02995 SAMEA3752620_01282 SAMEA3753064_02287 SAMEA3753097_02219 SAMEA3753106_03183 SAMEA3753164_01192 SAMEA3753290_02847 SAMEA3753300_01107 SAMEA3753391_02580 SAMEA3753397_04005 SK85_03024 SY51_15605 UC41_20365 UN91_03645 WM48_14990 WQ89_10170 WR15_06090 YDC107_1339] CTP synthase (EC 6.3.4.2) (Cytidine 5'-triphosphate synthase) (Cytidine triphosphate synthetase) (CTP synthetase) (CTPS) (UTP--ammonia ligase)
[Adcy8] Adenylate cyclase type 8 (EC 4.6.1.1) (ATP pyrophosphate-lyase 8) (Adenylate cyclase type VIII) (Adenylyl cyclase 8) (Ca(2+)/calmodulin-activated adenylyl cyclase)

Bibliography :
[20580936] Protein-DNA interactions in the promoter region of the Phycomyces carB and carRA genes correlate with the kinetics of their mRNA accumulation in response to light.
[12730708] Genetic basis of microbial carotenogenesis.
[10951210] A bifunctional enzyme with lycopene cyclase and phytoene synthase activities is encoded by the carRP gene of Mucor circinelloides.
?>