GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

C-C motif chemokine 4-like (Lymphocyte activation gene 1 protein) (LAG-1) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (Monocyte adherence-induced protein 5-alpha) (Small-inducible cytokine A4-like)

 CC4L_HUMAN              Reviewed;          92 AA.
Q8NHW4; B2RUZ3; B7ZMA8; Q50EM1; Q50EM2; Q50EM3; Q50EM4; Q50EM5; Q50EM6;
Q50EM7; Q50EM8; Q569J2; Q6NSB0;
18-MAR-2008, integrated into UniProtKB/Swiss-Prot.
01-OCT-2002, sequence version 1.
26-FEB-2020, entry version 145.
RecName: Full=C-C motif chemokine 4-like;
AltName: Full=Lymphocyte activation gene 1 protein;
Short=LAG-1;
AltName: Full=Macrophage inflammatory protein 1-beta;
Short=MIP-1-beta;
AltName: Full=Monocyte adherence-induced protein 5-alpha;
AltName: Full=Small-inducible cytokine A4-like;
Flags: Precursor;
Name=CCL4L1; Synonyms=CCL4L, LAG1, SCYA4L1;
and
Name=CCL4L2; Synonyms=CCL4L, SCYA4L2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
Nibbs R.J., Barcellos L.F., Townson J.R.;
"Variation in gene copy number of the human chemokines macrophage
inflammatory protein-1a/CCL3 and macrophage inflammatory protein-1b/CCL4.";
Submitted (FEB-2002) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7; 8;
9 AND 10).
PubMed=15843566; DOI=10.4049/jimmunol.174.9.5655;
Colobran R., Adreani P., Ashhab Y., Llano A., Este J.A., Dominguez O.,
Pujol-Borrell R., Juan M.;
"Multiple products derived from two CCL4 loci: high incidence of a new
polymorphism in HIV+ patients.";
J. Immunol. 174:5655-5664(2005).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 5).
TISSUE=Blood, and Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
IDENTIFICATION.
PubMed=11685466; DOI=10.1007/s002510100366;
Modi W.S., Bergeron J., Sanford M.;
"The human MIP-1beta chemokine is encoded by two paralogous genes, ACT-2
and LAG-1.";
Immunogenetics 53:543-549(2001).
[5]
FUNCTION, INTERACTION WITH CCR5, AND GENOMIC DUPLICATION.
PubMed=15240137; DOI=10.1016/j.bbrc.2004.06.039;
Howard O.M.Z., Turpin J.A., Goldman R., Modi W.S.;
"Functional redundancy of the human CCL4 and CCL4L1 chemokine genes.";
Biochem. Biophys. Res. Commun. 320:927-931(2004).
[6]
IDENTIFICATION, AND GENOMIC DUPLICATION.
PubMed=15028295; DOI=10.1016/j.ygeno.2003.09.019;
Modi W.S.;
"CCL3L1 and CCL4L1 chemokine genes are located in a segmental duplication
at chromosome 17q12.";
Genomics 83:735-738(2004).
[7]
TISSUE SPECIFICITY.
PubMed=14673550; DOI=10.1007/s00251-003-0636-z;
Lu J., Honczarenko M., Sloan S.R.;
"Independent expression of the two paralogous CCL4 genes in monocytes and B
lymphocytes.";
Immunogenetics 55:706-711(2004).
[8]
IDENTIFICATION, AND POLYMORPHISM OF GENE COPY NUMBER.
PubMed=17330138; DOI=10.1038/sj.gene.6364378;
Shao W., Tang J., Song W., Wang C., Li Y., Wilson C.M., Kaslow R.A.;
"CCL3L1 and CCL4L1: variable gene copy number in adolescents with and
without human immunodeficiency virus type 1 (HIV-1) infection.";
Genes Immun. 8:224-231(2007).
-!- FUNCTION: Chemokine that induces chemotaxis of cells expressing CCR5 or
CCR1. Inhibits HIV replication in peripheral blood monocytes that
express CCR5. {ECO:0000269|PubMed:15240137}.
-!- SUBUNIT: Interacts with CCR5. {ECO:0000269|PubMed:15240137}.
-!- INTERACTION:
Q9BRI3:SLC30A2; NbExp=3; IntAct=EBI-10271156, EBI-8644112;
-!- SUBCELLULAR LOCATION: Secreted {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=10;
Comment=CCL4L1 and CCL4L2 genes differ in their non-coding regions.
Thus, alternative splicing events differ between the two genes.;
Name=1;
IsoId=Q8NHW4-1; Sequence=Displayed;
Name=2; Synonyms=CCL4L2;
IsoId=Q8NHW4-2; Sequence=VSP_032633;
Name=3; Synonyms=CC4L2d;
IsoId=Q8NHW4-3; Sequence=VSP_032629;
Name=4; Synonyms=CC4L2f;
IsoId=Q8NHW4-4; Sequence=VSP_032630;
Name=5; Synonyms=CC4L2b1, CC4L2b2;
IsoId=Q8NHW4-5; Sequence=VSP_032631;
Name=6; Synonyms=CC4L2e;
IsoId=Q8NHW4-6; Sequence=VSP_032632;
Name=7; Synonyms=CC4L2d2;
IsoId=Q8NHW4-7; Sequence=VSP_032625;
Name=8; Synonyms=CC4L1d2;
IsoId=Q8NHW4-8; Sequence=VSP_032626;
Name=9; Synonyms=CC4L2bd2;
IsoId=Q8NHW4-9; Sequence=VSP_032627;
Name=10; Synonyms=CC44L2c;
IsoId=Q8NHW4-10; Sequence=VSP_032628;
-!- TISSUE SPECIFICITY: Detected in B-cells. {ECO:0000269|PubMed:14673550}.
-!- POLYMORPHISM: The copy number of the CC4L1 gene varies among
individuals; most individuals have 1 to 6 copies in the diploid genome.
{ECO:0000269|PubMed:17330138}.
-!- SIMILARITY: Belongs to the intercrine beta (chemokine CC) family.
{ECO:0000305}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AY079147; AAL87008.1; -; Genomic_DNA.
EMBL; AY766460; AAX07294.1; -; Genomic_DNA.
EMBL; AY766460; AAX07295.1; -; Genomic_DNA.
EMBL; AY766461; AAX07296.1; -; Genomic_DNA.
EMBL; AY766461; AAX07297.1; -; Genomic_DNA.
EMBL; AY766461; AAX07298.1; -; Genomic_DNA.
EMBL; AY766461; AAX07299.1; -; Genomic_DNA.
EMBL; AY766461; AAX07300.1; -; Genomic_DNA.
EMBL; AY766461; AAX07301.1; -; Genomic_DNA.
EMBL; AY766461; AAX07302.1; -; Genomic_DNA.
EMBL; AY766461; AAX07303.1; -; Genomic_DNA.
EMBL; AY766461; AAX07304.1; -; Genomic_DNA.
EMBL; AY766447; AAX07306.1; -; mRNA.
EMBL; AY766449; AAX07308.1; -; mRNA.
EMBL; AY766450; AAX07309.1; -; mRNA.
EMBL; AY766451; AAX07310.1; -; mRNA.
EMBL; AY766452; AAX07311.1; -; mRNA.
EMBL; AY766453; AAX07312.1; -; mRNA.
EMBL; AY766454; AAX07313.1; -; mRNA.
EMBL; AY766455; AAX07314.1; -; mRNA.
EMBL; AY766456; AAX07315.1; -; mRNA.
EMBL; AY766457; AAX07316.1; -; mRNA.
EMBL; AY766458; AAX07317.1; -; mRNA.
EMBL; BC070310; AAH70310.1; -; mRNA.
EMBL; BC092445; AAH92445.1; -; mRNA.
EMBL; BC130456; AAI30457.1; -; mRNA.
EMBL; BC130458; AAI30459.1; -; mRNA.
EMBL; BC144393; AAI44394.1; -; mRNA.
EMBL; BC144394; AAI44395.1; -; mRNA.
EMBL; BC171864; AAI71864.1; -; mRNA.
EMBL; BC146944; AAI46945.1; -; mRNA.
EMBL; BC146958; AAI46959.1; -; mRNA.
PIR; C60407; C60407.
RefSeq; NP_001278397.1; NM_001291468.1. [Q8NHW4-2]
RefSeq; NP_001278398.1; NM_001291469.1. [Q8NHW4-5]
RefSeq; NP_001278399.1; NM_001291470.1. [Q8NHW4-5]
RefSeq; NP_001278400.1; NM_001291471.1. [Q8NHW4-10]
RefSeq; NP_001278401.1; NM_001291472.1. [Q8NHW4-3]
RefSeq; NP_001278402.1; NM_001291473.1. [Q8NHW4-6]
RefSeq; NP_001278403.1; NM_001291474.1. [Q8NHW4-9]
RefSeq; NP_001278404.1; NM_001291475.1. [Q8NHW4-4]
RefSeq; NP_996890.1; NM_207007.3. [Q8NHW4-1]
SMR; Q8NHW4; -.
BioGrid; 114931; 1.
IntAct; Q8NHW4; 54.
STRING; 9606.ENSP00000483609; -.
BioMuta; HGNC:10631; -.
DMDM; 74727347; -.
MassIVE; Q8NHW4; -.
PaxDb; Q8NHW4; -.
PeptideAtlas; Q8NHW4; -.
PRIDE; Q8NHW4; -.
ProteomicsDB; 73769; -. [Q8NHW4-1]
ProteomicsDB; 73770; -. [Q8NHW4-10]
ProteomicsDB; 73771; -. [Q8NHW4-2]
ProteomicsDB; 73772; -. [Q8NHW4-3]
ProteomicsDB; 73773; -. [Q8NHW4-4]
ProteomicsDB; 73774; -. [Q8NHW4-5]
ProteomicsDB; 73775; -. [Q8NHW4-6]
ProteomicsDB; 73776; -. [Q8NHW4-7]
ProteomicsDB; 73777; -. [Q8NHW4-8]
ProteomicsDB; 73778; -. [Q8NHW4-9]
TopDownProteomics; Q8NHW4-4; -. [Q8NHW4-4]
DNASU; 388372; -.
DNASU; 9560; -.
Ensembl; ENST00000610565; ENSP00000484498; ENSG00000276070. [Q8NHW4-6]
Ensembl; ENST00000613173; ENSP00000484455; ENSG00000276070. [Q8NHW4-9]
Ensembl; ENST00000613828; ENSP00000484322; ENSG00000282604. [Q8NHW4-1]
Ensembl; ENST00000614182; ENSP00000482862; ENSG00000276125. [Q8NHW4-3]
Ensembl; ENST00000615418; ENSP00000483206; ENSG00000276070. [Q8NHW4-3]
Ensembl; ENST00000616100; ENSP00000484148; ENSG00000282604. [Q8NHW4-6]
Ensembl; ENST00000617405; ENSP00000483330; ENSG00000276070. [Q8NHW4-4]
Ensembl; ENST00000617416; ENSP00000480089; ENSG00000276070. [Q8NHW4-5]
Ensembl; ENST00000620055; ENSP00000481323; ENSG00000276070. [Q8NHW4-7]
Ensembl; ENST00000620063; ENSP00000478376; ENSG00000276125. [Q8NHW4-1]
Ensembl; ENST00000620098; ENSP00000479774; ENSG00000276070. [Q8NHW4-10]
Ensembl; ENST00000620250; ENSP00000483609; ENSG00000276070. [Q8NHW4-1]
Ensembl; ENST00000620576; ENSP00000479354; ENSG00000276070. [Q8NHW4-2]
Ensembl; ENST00000620708; ENSP00000479126; ENSG00000275313. [Q8NHW4-1]
Ensembl; ENST00000620732; ENSP00000481969; ENSG00000276070. [Q8NHW4-5]
Ensembl; ENST00000622783; ENSP00000479833; ENSG00000276125. [Q8NHW4-7]
Ensembl; ENST00000631554; ENSP00000487911; ENSG00000276125. [Q8NHW4-10]
Ensembl; ENST00000631660; ENSP00000488687; ENSG00000275313. [Q8NHW4-7]
Ensembl; ENST00000631768; ENSP00000488094; ENSG00000282604. [Q8NHW4-5]
Ensembl; ENST00000631782; ENSP00000488541; ENSG00000276125. [Q8NHW4-6]
Ensembl; ENST00000631808; ENSP00000487651; ENSG00000282604. [Q8NHW4-3]
Ensembl; ENST00000632416; ENSP00000487859; ENSG00000275313. [Q8NHW4-2]
Ensembl; ENST00000632480; ENSP00000488369; ENSG00000282604. [Q8NHW4-7]
Ensembl; ENST00000632699; ENSP00000488366; ENSG00000276125. [Q8NHW4-2]
Ensembl; ENST00000632710; ENSP00000488758; ENSG00000275313. [Q8NHW4-5]
Ensembl; ENST00000633309; ENSP00000488719; ENSG00000282604. [Q8NHW4-4]
Ensembl; ENST00000633550; ENSP00000488736; ENSG00000276125. [Q8NHW4-5]
Ensembl; ENST00000633849; ENSP00000487792; ENSG00000282604. [Q8NHW4-10]
Ensembl; ENST00000633897; ENSP00000488897; ENSG00000282604. [Q8NHW4-5]
Ensembl; ENST00000633927; ENSP00000488430; ENSG00000276125. [Q8NHW4-9]
Ensembl; ENST00000634027; ENSP00000488439; ENSG00000276125. [Q8NHW4-4]
Ensembl; ENST00000634078; ENSP00000488231; ENSG00000275313. [Q8NHW4-6]
Ensembl; ENST00000634191; ENSP00000487715; ENSG00000276125. [Q8NHW4-5]
GeneID; 388372; -.
GeneID; 9560; -.
KEGG; hsa:388372; -.
KEGG; hsa:9560; -.
UCSC; uc002hlh.2; human. [Q8NHW4-1]
CTD; 388372; -.
CTD; 9560; -.
DisGeNET; 388372; -.
DisGeNET; 6351; -.
DisGeNET; 9560; -.
GeneCards; CCL4L1; -.
GeneCards; CCL4L2; -.
HGNC; HGNC:10631; CCL4L1.
HGNC; HGNC:24066; CCL4L2.
MIM; 603782; gene.
MIM; 610757; gene.
neXtProt; NX_Q8NHW4; -.
OpenTargets; ENSG00000276070; -.
eggNOG; ENOG410J4I9; Eukaryota.
eggNOG; ENOG410YXJU; LUCA.
GeneTree; ENSGT00970000193363; -.
HOGENOM; CLU_2793265_0_0_1; -.
InParanoid; Q8NHW4; -.
KO; K12964; -.
OMA; GKQVCAN; -.
OrthoDB; 1575018at2759; -.
PhylomeDB; Q8NHW4; -.
TreeFam; TF334888; -.
Reactome; R-HSA-418594; G alpha (i) signalling events.
SIGNOR; Q8NHW4; -.
ChiTaRS; CCL4L2; human.
Pharos; Q8NHW4; Tbio.
PRO; PR:Q8NHW4; -.
Proteomes; UP000005640; Chromosome 17.
RNAct; Q8NHW4; protein.
Bgee; ENSG00000276070; Expressed in leukocyte and 86 other tissues.
GO; GO:0005615; C:extracellular space; IBA:GO_Central.
GO; GO:0048020; F:CCR chemokine receptor binding; IBA:GO_Central.
GO; GO:0008009; F:chemokine activity; IBA:GO_Central.
GO; GO:0071346; P:cellular response to interferon-gamma; IBA:GO_Central.
GO; GO:0071347; P:cellular response to interleukin-1; IBA:GO_Central.
GO; GO:0071356; P:cellular response to tumor necrosis factor; IBA:GO_Central.
GO; GO:0070098; P:chemokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0007186; P:G protein-coupled receptor signaling pathway; IBA:GO_Central.
GO; GO:0006954; P:inflammatory response; IBA:GO_Central.
GO; GO:0048247; P:lymphocyte chemotaxis; IBA:GO_Central.
GO; GO:0002548; P:monocyte chemotaxis; IBA:GO_Central.
GO; GO:0030593; P:neutrophil chemotaxis; IBA:GO_Central.
GO; GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; IBA:GO_Central.
GO; GO:0043547; P:positive regulation of GTPase activity; IBA:GO_Central.
InterPro; IPR039809; Chemokine_b/g/d.
InterPro; IPR000827; Chemokine_CC_CS.
InterPro; IPR001811; Chemokine_IL8-like_dom.
InterPro; IPR036048; Interleukin_8-like_sf.
PANTHER; PTHR12015; PTHR12015; 1.
Pfam; PF00048; IL8; 1.
SMART; SM00199; SCY; 1.
SUPFAM; SSF54117; SSF54117; 1.
PROSITE; PS00472; SMALL_CYTOKINES_CC; 1.
1: Evidence at protein level;
Alternative splicing; Chemotaxis; Cytokine; Disulfide bond;
Inflammatory response; Reference proteome; Secreted; Signal.
SIGNAL 1..23
/evidence="ECO:0000250"
CHAIN 24..92
/note="C-C motif chemokine 4-like"
/id="PRO_0000326234"
DISULFID 34..58
/evidence="ECO:0000250"
DISULFID 35..74
/evidence="ECO:0000250"
VAR_SEQ 26..92
/note="MGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADP
SESWVQEYVYDLELN -> KASKSALTPVSPGSRSTCMTWN (in isoform 7)"
/evidence="ECO:0000303|PubMed:15843566"
/id="VSP_032625"
VAR_SEQ 26..92
/note="MGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADP
SESWVQEYVYDLELN -> NSKPKEASKSALTPVSPGSRSTCMTWN (in isoform
8)"
/evidence="ECO:0000303|PubMed:15843566"
/id="VSP_032626"
VAR_SEQ 26..92
/note="MGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADP
SESWVQEYVYDLELN -> TKSSEWKLQGVCFQCCSGKDPIHQSCPTWTMVRQRKMPTT
GKG (in isoform 9)"
/evidence="ECO:0000303|PubMed:15843566"
/id="VSP_032627"
VAR_SEQ 65..92
/note="FQTKRGKQVCADPSESWVQEYVYDLELN -> YRESASSAAPGRIPSTRAAP
HGPWSGRGRCLPQARDKAR (in isoform 10)"
/evidence="ECO:0000303|PubMed:15843566"
/id="VSP_032628"
VAR_SEQ 65..92
/note="FQTKRGKQVCADPSESWVQEYVYDLELN -> AAPGRIPSTRAAPHGPWSGR
GRCLPQARDKAR (in isoform 3)"
/evidence="ECO:0000303|PubMed:15843566"
/id="VSP_032629"
VAR_SEQ 65..92
/note="FQTKRGKQVCADPSESWVQEYVYDLELN -> EWKLQGVCFQCCSGKDPIHQ
SCPTWTMVRQRKMPTTGKG (in isoform 4)"
/evidence="ECO:0000303|PubMed:15843566"
/id="VSP_032630"
VAR_SEQ 65..92
/note="Missing (in isoform 5)"
/evidence="ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:15843566"
/id="VSP_032631"
VAR_SEQ 65..92
/note="FQTKRGKQVCADPSESWVQEYVYDLELN -> AAPHGPWSGRGRCLPQARDK
AR (in isoform 6)"
/evidence="ECO:0000303|PubMed:15843566"
/id="VSP_032632"
VAR_SEQ 65..69
/note="Missing (in isoform 2)"
/evidence="ECO:0000303|PubMed:15843566"
/id="VSP_032633"
CONFLICT 45
/note="R -> H (in Ref. 3; AAH70310)"
/evidence="ECO:0000305"
SEQUENCE 92 AA; 10166 MW; 4C8D01E926CDE882 CRC64;
MKLCVTVLSL LVLVAAFCSL ALSAPMGSDP PTACCFSYTA RKLPRNFVVD YYETSSLCSQ
PAVVFQTKRG KQVCADPSES WVQEYVYDLE LN


Related products :

Catalog number Product name Quantity
EIAAB05849 C-C motif chemokine 4-like,CCL4L,CCL4L1,Homo sapiens,Human,LAG1,LAG-1,Lymphocyte activation gene 1 protein,Macrophage inflammatory protein 1-beta,MIP-1-beta,Monocyte adherence-induced protein 5-alpha,
15-288-21035 Small inducible cytokine A4 - CCL4; Macrophage inflammatory protein 1-beta; MIP-1-beta; MIP-1-beta(1-69); T-cell activation protein 2; ACT-2; PAT 744; H400; SIS-gamma; Lymphocyte activation gene 1 pro 0.1 mg
15-288-21035 Small inducible cytokine A4 - CCL4; Macrophage inflammatory protein 1-beta; MIP-1-beta; MIP-1-beta(1-69); T-cell activation protein 2; ACT-2; PAT 744; H400; SIS-gamma; Lymphocyte activation gene 1 pro 0.05 mg
E0093m ELISA ACT2,ACT-2,C-C motif chemokine 4,Ccl4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Mouse,Mus musculus,Protein H400,Scya4,SIS-gamma,Small-inducible cytokine 96T
U0093m CLIA ACT2,ACT-2,C-C motif chemokine 4,Ccl4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Mouse,Mus musculus,Protein H400,Scya4,SIS-gamma,Small-inducible cytokine 96T
U0093Rb CLIA ACT-2,C-C motif chemokine 4,CCL4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,MIP-1-beta,Oryctolagus cuniculus,Rabbit,SCYA4,Small-inducible cytokine A4 96T
E0093Rb ELISA kit ACT-2,C-C motif chemokine 4,CCL4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,MIP-1-beta,Oryctolagus cuniculus,Rabbit,SCYA4,Small-inducible cytokine A4 96T
E0093Rb ELISA ACT-2,C-C motif chemokine 4,CCL4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,MIP-1-beta,Oryctolagus cuniculus,Rabbit,SCYA4,Small-inducible cytokine A4 96T
U0093h CLIA ACT-2,C-C motif chemokine 4,CCL4,G-26 T-lymphocyte-secreted protein,HC21,Homo sapiens,Human,LAG1,LAG-1,Lymphocyte activation gene 1 protein,Macrophage inflammatory protein 1-beta,MIP1B,MIP-1-beta 96T
18-783-75647 RABBIT ANTI HUMAN MIP-3 ALPHA - CCL20; Small-inducible cytokine A20; Macrophage inflammatory protein 3 alpha; MIP-3-alpha; Liver and activation-regulated chemokine; CC chemokine LARC; Beta chemokine e 0.1 mg
E0093m ELISA kit ACT2,ACT-2,C-C motif chemokine 4,Ccl4,Immune activation protein 2,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Mouse,Mus musculus,Protein H400,Scya4,SIS-gamma,Small-inducible cyt 96T
18-783-78922 RABBIT ANTI HUMAN MIP-3 ALPHA Biotin - CCL20; Small-inducible cytokine A20; Macrophage inflammatory protein 3 alpha; MIP-3-alpha; Liver and activation-regulated chemokine; CC chemokine LARC; Beta chem 0.05 mg
18-783-78972 RABBIT ANTI HUMAN MIP-1 BETA - CCL4; Small-inducible cytokine A4; Macrophage inflammatory protein 1-beta; MIP-1-beta; MIP-1-beta(1-69); T-cell activation protein 2; ACT-2; PAT 744; Protein H400; SIS-g 0.1 mg
10-783-79047 RECOMBINANT HUMAN MIP-1 BETA - CCL4; Small-inducible cytokine A4; Macrophage inflammatory protein 1-beta; MIP-1-beta; MIP-1-beta(1-69); T-cell activation protein 2; ACT-2; PAT 744; Protein H400; SIS-g 0.01 mg
18-783-78899 RABBIT ANTI HUMAN MIP-1 BETA Biotin - CCL4; Small-inducible cytokine A4; Macrophage inflammatory protein 1-beta; MIP-1-beta; MIP-1-beta(1-69); T-cell activation protein 2; ACT-2; PAT 744; Protein H400 0.05 mg
E0093p ELISA C-C motif chemokine 4,CCL4,Macrophage inflammatory protein 1-beta,MIP1B,MIP-1-beta,Pig,SCY4A,Small-inducible cytokine A4,Sus scrofa 96T
U0093p CLIA C-C motif chemokine 4,CCL4,Macrophage inflammatory protein 1-beta,MIP1B,MIP-1-beta,Pig,SCY4A,Small-inducible cytokine A4,Sus scrofa 96T
E0093p ELISA kit C-C motif chemokine 4,CCL4,Macrophage inflammatory protein 1-beta,MIP1B,MIP-1-beta,Pig,SCY4A,Small-inducible cytokine A4,Sus scrofa 96T
E0093h ELISA kit ACT-2,C-C motif chemokine 4,CCL4,G-26 T-lymphocyte-secreted protein,HC21,Homo sapiens,Human,LAG1,LAG-1,Lymphocyte activation gene 1 protein,Macrophage inflammatory protein 1-beta,MIP1B,MIP- 96T
E0093h ELISA ACT-2,C-C motif chemokine 4,CCL4,G-26 T-lymphocyte-secreted protein,HC21,Homo sapiens,Human,LAG1,LAG-1,Lymphocyte activation gene 1 protein,Macrophage inflammatory protein 1-beta,MIP1B,MIP-1-bet 96T
E0093r ELISA C-C motif chemokine 4,Ccl4,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Rat,Rattus norvegicus,Scya4,Small-inducible cytokine A4 96T
U0093r CLIA C-C motif chemokine 4,Ccl4,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Rat,Rattus norvegicus,Scya4,Small-inducible cytokine A4 96T
E0093r ELISA kit C-C motif chemokine 4,Ccl4,Macrophage inflammatory protein 1-beta,Mip1b,MIP-1-beta,Rat,Rattus norvegicus,Scya4,Small-inducible cytokine A4 96T
18-783-75648 RABBIT ANTI HUMAN MIP-3 BETA - CCL19; Small-inducible cytokine A19; Macrophage inflammatory protein 3 beta; MIP-3-beta; EBI1-ligand chemokine; ELC; Beta chemokine exodus-3; CK beta-11 Polyclonal 0.1 mg
18-783-78923 RABBIT ANTI HUMAN MIP-3 BETA Biotin - CCL19; Small-inducible cytokine A19; Macrophage inflammatory protein 3 beta; MIP-3-beta; EBI1-ligand chemokine; ELC; Beta chemokine exodus-3; CK beta-11 Polyclona 0.05 mg
Pathways :
WP2292: Chemokine signaling pathway
WP210: Cytoplasmic Ribosomal Proteins
WP1566: Citrate cycle (TCA cycle)
WP2218: sGC
WP1531: Vitamin D synthesis
WP2199: Seed Development
WP1657: Glycerolipid metabolism
WP1888: Post-translational protein modification
WP1693: Purine metabolism
WP262: EBV LMP1 signaling
WP433: tRNA Synthetases
WP73: G Protein Signaling Pathways
WP1663: Homologous recombination
WP2324: AGE/RAGE pathway
WP1224: EBV LMP1 signaling
WP1672: Mismatch repair
WP537: Translation Factors
WP1614: 1- and 2-Methylnaphthalene degradation
WP215: noncanonical wnt pathway
WP2203: TSLP Signaling Pathway
WP1438: Influenza A virus infection
WP1676: Non-homologous end-joining
WP1963: The effect of Glucocorticoids on target gene expression
WP1624: Bacterial secretion system
WP1644: DNA replication

Related Genes :
[CCL4L1 CCL4L LAG1 SCYA4L1; CCL4L2 CCL4L SCYA4L2] C-C motif chemokine 4-like (Lymphocyte activation gene 1 protein) (LAG-1) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (Monocyte adherence-induced protein 5-alpha) (Small-inducible cytokine A4-like)
[CCL4 LAG1 MIP1B SCYA4] C-C motif chemokine 4 (G-26 T-lymphocyte-secreted protein) (HC21) (Lymphocyte activation gene 1 protein) (LAG-1) (MIP-1-beta(1-69)) (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (PAT 744) (Protein H400) (SIS-gamma) (Small-inducible cytokine A4) (T-cell activation protein 2) (ACT-2) [Cleaved into: MIP-1-beta(3-69)]
[CCL3 G0S19-1 MIP1A SCYA3] C-C motif chemokine 3 (G0/G1 switch regulatory protein 19-1) (Macrophage inflammatory protein 1-alpha) (MIP-1-alpha) (PAT 464.1) (SIS-beta) (Small-inducible cytokine A3) (Tonsillar lymphocyte LD78 alpha protein) [Cleaved into: MIP-1-alpha(4-69) (LD78-alpha(4-69))]
[CCL20 LARC MIP3A SCYA20] C-C motif chemokine 20 (Beta-chemokine exodus-1) (CC chemokine LARC) (Liver and activation-regulated chemokine) (Macrophage inflammatory protein 3 alpha) (MIP-3-alpha) (Small-inducible cytokine A20) [Cleaved into: CCL20(1-67); CCL20(1-64); CCL20(2-70)]
[CCL18 AMAC1 DCCK1 MIP4 PARC SCYA18] C-C motif chemokine 18 (Alternative macrophage activation-associated CC chemokine 1) (AMAC-1) (CC chemokine PARC) (Dendritic cell chemokine 1) (DC-CK1) (Macrophage inflammatory protein 4) (MIP-4) (Pulmonary and activation-regulated chemokine) (Small-inducible cytokine A18) [Cleaved into: CCL18(1-68); CCL18(3-69); CCL18(4-69)]
[CCL15 MIP5 NCC3 SCYA15] C-C motif chemokine 15 (Chemokine CC-2) (HCC-2) (Leukotactin-1) (LKN-1) (MIP-1 delta) (Macrophage inflammatory protein 5) (MIP-5) (Mrp-2b) (NCC-3) (Small-inducible cytokine A15) [Cleaved into: CCL15(22-92); CCL15(25-92); CCL15(29-92)]
[Ccl2 Je Mcp1 Scya2] C-C motif chemokine 2 (Monocyte chemoattractant protein 1) (Monocyte chemotactic protein 1) (MCP-1) (Platelet-derived growth factor-inducible protein JE) (Small-inducible cytokine A2)
[CXCL2 GRO2 GROB MIP2A SCYB2] C-X-C motif chemokine 2 (Growth-regulated protein beta) (Gro-beta) (Macrophage inflammatory protein 2-alpha) (MIP2-alpha) [Cleaved into: GRO-beta(5-73) (GRO-beta-T) (Hematopoietic synergistic factor) (HSF) (SB-251353)]
[CCL2 MCP1 SCYA2] C-C motif chemokine 2 (HC11) (Monocyte chemoattractant protein 1) (Monocyte chemotactic and activating factor) (MCAF) (Monocyte chemotactic protein 1) (MCP-1) (Monocyte secretory protein JE) (Small-inducible cytokine A2)
[CCL3L1 D17S1718 G0S19-2 SCYA3L1; CCL3L3] C-C motif chemokine 3-like 1 (G0/G1 switch regulatory protein 19-2) (LD78-beta(1-70)) (PAT 464.2) (Small-inducible cytokine A3-like 1) (Tonsillar lymphocyte LD78 beta protein) [Cleaved into: LD78-beta(3-70); LD78-beta(5-70)]
[Ccl2 Je Mcp1 Scya2] C-C motif chemokine 2 (Immediate-early serum-responsive protein JE) (Monocyte chemoattractant protein 1) (Monocyte chemotactic protein 1) (MCP-1) (Small-inducible cytokine A2)
[Cxcl2 Cinc3 Mip-2 Mip2 Scyb2] C-X-C motif chemokine 2 (Cytokine-induced neutrophil chemoattractant 3) (CINC-3) (Macrophage inflammatory protein 2) (MIP2)
[Ccl1 Scya1 Tca3] C-C motif chemokine 1 (P500) (SIS-epsilon) (Small-inducible cytokine A1) (T-cell activation protein 3) (TCA-3) (TCA3)
[PPBP CTAP3 CXCL7 SCYB7 TGB1 THBGB1] Platelet basic protein (PBP) (C-X-C motif chemokine 7) (Leukocyte-derived growth factor) (LDGF) (Macrophage-derived growth factor) (MDGF) (Small-inducible cytokine B7) [Cleaved into: Connective tissue-activating peptide III (CTAP-III) (LA-PF4) (Low-affinity platelet factor IV); TC-2; Connective tissue-activating peptide III(1-81) (CTAP-III(1-81)); Beta-thromboglobulin (Beta-TG); Neutrophil-activating peptide 2(74) (NAP-2(74)); Neutrophil-activating peptide 2(73) (NAP-2(73)); Neutrophil-activating peptide 2 (NAP-2); TC-1; Neutrophil-activating peptide 2(1-66) (NAP-2(1-66)); Neutrophil-activating peptide 2(1-63) (NAP-2(1-63))]
[CCL2 MCP1 SCYA2] C-C motif chemokine 2 (Monocyte chemoattractant protein 1) (Monocyte chemotactic protein 1) (MCP-1) (Small-inducible cytokine A2)
[Ccl19 Elc Scya19] C-C motif chemokine 19 (Epstein-Barr virus-induced molecule 1 ligand chemokine) (EBI1 ligand chemokine) (ELC) (Small-inducible cytokine A19)
[CCL2 SCYA2] C-C motif chemokine 2 (Monocyte chemoattractant protein 1) (Monocyte chemotactic protein 1) (MCP-1) (Small-inducible cytokine A2)
[CCL2 SCYA2] C-C motif chemokine 2 (Acidic seminal fluid protein) (Monocyte chemotactic protein 1A) (MCP-1) (MCP-1A) (Small-inducible cytokine A2)
[Cxcl10 Crg2 Ifi10 Inp10 Scyb10] C-X-C motif chemokine 10 (10 kDa interferon gamma-induced protein) (Gamma-IP10) (IP-10) (C7) (Interferon-gamma induced protein CRG-2) (Small-inducible cytokine B10)
[Ccl21a Scya21 Scya21a] C-C motif chemokine 21a (6Ckine) (Beta-chemokine exodus-2) (Small-inducible cytokine A21a) (Thymus-derived chemotactic agent 4) (TCA4)
[CXCL11 ITAC SCYB11 SCYB9B] C-X-C motif chemokine 11 (Beta-R1) (H174) (Interferon gamma-inducible protein 9) (IP-9) (Interferon-inducible T-cell alpha chemoattractant) (I-TAC) (Small-inducible cytokine B11)
[Ccr1 Cmkbr1] C-C chemokine receptor type 1 (C-C CKR-1) (CC-CKR-1) (CCR-1) (CCR1) (Macrophage inflammatory protein 1-alpha receptor) (MIP-1alpha-R) (RANTES-R) (CD antigen CD191)
[CCL2 MCP1 SCYA2] C-C motif chemokine 2 (Monocyte chemoattractant protein 1) (Monocyte chemotactic protein 1) (MCP-1) (Small-inducible cytokine A2)
[Cx3cl1 Cx3c Fkn Scyd1] Fractalkine (C-X3-C motif chemokine 1) (CX3C membrane-anchored chemokine) (Neurotactin) (Small-inducible cytokine D1) [Cleaved into: Processed fractalkine]
[CCR1 CMKBR1 CMKR1 SCYAR1] C-C chemokine receptor type 1 (C-C CKR-1) (CC-CKR-1) (CCR-1) (CCR1) (HM145) (LD78 receptor) (Macrophage inflammatory protein 1-alpha receptor) (MIP-1alpha-R) (RANTES-R) (CD antigen CD191)
[CCL17 SCYA17 TARC] C-C motif chemokine 17 (CC chemokine TARC) (Small-inducible cytokine A17) (Thymus and activation-regulated chemokine)
[CX3CL1 FKN NTT SCYD1 A-152E5.2] Fractalkine (C-X3-C motif chemokine 1) (CX3C membrane-anchored chemokine) (Neurotactin) (Small-inducible cytokine D1) [Cleaved into: Processed fractalkine]
[XCL1 LTN SCYC1] Lymphotactin (ATAC) (C motif chemokine 1) (Cytokine SCM-1) (Lymphotaxin) (SCM-1-alpha) (Small-inducible cytokine C1) (XC chemokine ligand 1)
[CCL8 MCP2 SCYA10 SCYA8] C-C motif chemokine 8 (HC14) (Monocyte chemoattractant protein 2) (Monocyte chemotactic protein 2) (MCP-2) (Small-inducible cytokine A8) [Cleaved into: MCP-2(6-76)]
[CCL4 MIP1B SCYA4] C-C motif chemokine 4 (Macrophage inflammatory protein 1-beta) (MIP-1-beta) (Small-inducible cytokine A4)

Bibliography :