GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Calcium and integrin-binding family member 2 (Kinase-interacting protein 2) (KIP 2)

 CIB2_HUMAN              Reviewed;         187 AA.
O75838; B4DDF0; H0YM71; Q05BT6;
11-JAN-2001, integrated into UniProtKB/Swiss-Prot.
01-NOV-1998, sequence version 1.
13-FEB-2019, entry version 153.
RecName: Full=Calcium and integrin-binding family member 2;
AltName: Full=Kinase-interacting protein 2;
Short=KIP 2;
Name=CIB2; Synonyms=KIP2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Fetal brain;
PubMed=9931475; DOI=10.1016/S0167-4781(98)00253-X;
Seki N., Hattori A., Hayashi A., Kozuma S., Ohira M., Hori T.,
Saito T.;
"Structure, expression profile and chromosomal location of an isolog
of DNA-PKcs interacting protein (KIP) gene.";
Biochim. Biophys. Acta 1444:143-147(1999).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16572171; DOI=10.1038/nature04601;
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K.,
Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K.,
FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N.,
Abouelleil A., Arachchi H.M., Baradarani L., Birditt B., Bloom S.,
Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K.,
DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R.,
Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G.,
Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A.,
Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W.,
Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X.,
Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K.,
Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S.,
Nusbaum C.;
"Analysis of the DNA sequence and duplication history of human
chromosome 15.";
Nature 440:671-675(2006).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
TISSUE=Brain, and Skin;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
INTERACTION WITH ITGA2B AND ITGA7, CALCIUM-BINDING, AND
MAGNESIUM-BINDING.
PubMed=22779914; DOI=10.1139/o2012-021;
Huang H., Bogstie J.N., Vogel H.J.;
"Biophysical and structural studies of the human calcium- and
integrin-binding protein family: understanding their functional
similarities and differences.";
Biochem. Cell Biol. 90:646-656(2012).
[7]
VARIANTS DFNB48 SER-91; TRP-99 AND THR-123, VARIANT USH1J ASP-64,
FUNCTION, SUBUNIT, INTERACTION WITH WHRN AND MYO7A, AND TISSUE
SPECIFICITY.
PubMed=23023331; DOI=10.1038/ng.2426;
Riazuddin S., Belyantseva I.A., Giese A.P., Lee K., Indzhykulian A.A.,
Nandamuri S.P., Yousaf R., Sinha G.P., Lee S., Terrell D., Hegde R.S.,
Ali R.A., Anwar S., Andrade-Elizondo P.B., Sirmaci A., Parise L.V.,
Basit S., Wali A., Ayub M., Ansar M., Ahmad W., Khan S.N., Akram J.,
Tekin M., Riazuddin S., Cook T., Buschbeck E.K., Frolenkov G.I.,
Leal S.M., Friedman T.B., Ahmed Z.M.;
"Alterations of the CIB2 calcium- and integrin-binding protein cause
Usher syndrome type 1J and nonsyndromic deafness DFNB48.";
Nat. Genet. 44:1265-1271(2012).
[8]
VARIANT MET-75.
PubMed=26416264; DOI=10.1002/ajmg.a.37274;
Booth K.T., Azaiez H., Kahrizi K., Simpson A.C., Tollefson W.T.,
Sloan C.M., Meyer N.C., Babanejad M., Ardalani F., Arzhangi S.,
Schnieders M.J., Najmabadi H., Smith R.J.;
"PDZD7 and hearing loss: More than just a modifier.";
Am. J. Med. Genet. A 167A:2957-2965(2015).
[9]
VARIANT DFNB48 TRP-186, CHARACTERIZATION OF VARIANTS DFNB48 SER-91 AND
TRP-186, INTERACTION WITH WHRN, FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=26426422; DOI=10.1371/journal.pone.0133082;
Patel K., Giese A.P., Grossheim J.M., Hegde R.S., Hegde R.S.,
Delio M., Samanich J., Riazuddin S., Frolenkov G.I., Cai J.,
Ahmed Z.M., Morrow B.E.;
"A novel c-terminal CIB2 (calcium and integrin binding protein 2)
mutation associated with non-syndromic hearing loss in a hispanic
family.";
PLoS ONE 10:E0133082-E0133082(2015).
[10]
VARIANTS DFNB48 TRP-66 AND SER-91, CHARACTERIZATION OF VARIANTS DFNB48
TRP-66 AND SER-91, FUNCTION, AND SUBCELLULAR LOCATION.
PubMed=26173970; DOI=10.1038/ejhg.2015.157;
Seco C.Z., Giese A.P., Shafique S., Schraders M., Oonk A.M.,
Grossheim M., Oostrik J., Strom T., Hegde R., van Wijk E.,
Frolenkov G.I., Azam M., Yntema H.G., Free R.H., Riazuddin S.,
Verheij J.B., Admiraal R.J., Qamar R., Ahmed Z.M., Kremer H.;
"Novel and recurrent CIB2 variants, associated with nonsyndromic
deafness, do not affect calcium buffering and localization in hair
cells.";
Eur. J. Hum. Genet. 24:542-549(2016).
-!- FUNCTION: Calcium-binding protein critical for proper
photoreceptor cell maintenance and function. Plays a role in
intracellular calcium homeostasis by decreasing ATP-induced
calcium release (PubMed:23023331, PubMed:26173970,
PubMed:26426422). May be involved in the mechanotransduction
process (By similarity). {ECO:0000250,
ECO:0000269|PubMed:23023331, ECO:0000269|PubMed:26173970,
ECO:0000269|PubMed:26426422}.
-!- SUBUNIT: Homodimer (PubMed:23023331). Interacts with WHRN and
MYO7A (PubMed:23023331, PubMed:26426422). Interacts with ITGA2B
(via C-terminus cytoplasmic tail region) and ITGA7 (via C-terminus
cytoplasmic tail region); the interactions are
stabilized/increased in a calcium and magnesium-dependent manner
(PubMed:22779914). {ECO:0000269|PubMed:22779914,
ECO:0000269|PubMed:23023331, ECO:0000269|PubMed:26426422}.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250|UniProtKB:Q9Z309}.
Cell projection, stereocilium {ECO:0000269|PubMed:26173970,
ECO:0000269|PubMed:26426422}. Photoreceptor inner segment
{ECO:0000250|UniProtKB:Q9Z309}. Cell projection, cilium,
photoreceptor outer segment {ECO:0000250|UniProtKB:Q9Z309}. Cell
membrane, sarcolemma {ECO:0000250|UniProtKB:Q9Z309}.
Note=Colocalized with ITGA7 at the myotendinous junctions (MTJ)
and at the neuromuscular junctions (NMJ) (By similarity).
Localizes in the cuticular plate along and at the tip of the
stereocilia of vestibular sensory hair cells (PubMed:26173970,
PubMed:26426422). {ECO:0000250|UniProtKB:Q9Z309,
ECO:0000269|PubMed:26173970, ECO:0000269|PubMed:26426422}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=O75838-1; Sequence=Displayed;
Name=2;
IsoId=O75838-2; Sequence=VSP_053864;
Note=No experimental confirmation available.;
Name=3;
IsoId=O75838-3; Sequence=VSP_053863;
Note=No experimental confirmation available.;
Name=4;
IsoId=O75838-4; Sequence=VSP_054777;
Note=No experimental confirmation available. Derived from EST
data.;
-!- TISSUE SPECIFICITY: Widely expressed (PubMed:23023331).
{ECO:0000269|PubMed:23023331}.
-!- DISEASE: Deafness, autosomal recessive, 48 (DFNB48) [MIM:609439]:
A form of non-syndromic sensorineural hearing loss. Sensorineural
deafness results from damage to the neural receptors of the inner
ear, the nerve pathways to the brain, or the area of the brain
that receives sound information. DFNB48 patients have prelingual
onset of severe to profound sensorineural hearing loss affecting
all frequencies. {ECO:0000269|PubMed:23023331,
ECO:0000269|PubMed:26173970, ECO:0000269|PubMed:26426422}.
Note=The disease is caused by mutations affecting the gene
represented in this entry.
-!- DISEASE: Usher syndrome 1J (USH1J) [MIM:614869]: USH is a
genetically heterogeneous condition characterized by the
association of retinitis pigmentosa with sensorineural deafness.
Age at onset and differences in auditory and vestibular function
distinguish Usher syndrome type 1 (USH1), Usher syndrome type 2
(USH2) and Usher syndrome type 3 (USH3). USH1 is characterized by
profound congenital sensorineural deafness, absent vestibular
function and prepubertal onset of progressive retinitis pigmentosa
leading to blindness. {ECO:0000269|PubMed:23023331}. Note=The
disease is caused by mutations affecting the gene represented in
this entry.
-!- MISCELLANEOUS: The binding of either calcium or magnesium
significantly increases the structural stability of the protein in
comparison to apo-CIB (calcium- and magnesium-free form)
(PubMed:22779914). {ECO:0000269|PubMed:22779914}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AB012955; BAA33584.1; -; mRNA.
EMBL; AK293167; BAG56711.1; -; mRNA.
EMBL; AC090260; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471136; EAW99183.1; -; Genomic_DNA.
EMBL; CH471136; EAW99184.1; -; Genomic_DNA.
EMBL; CH471136; EAW99186.1; -; Genomic_DNA.
EMBL; BC033108; AAH33108.1; -; mRNA.
EMBL; BC047381; AAH47381.1; -; mRNA.
CCDS; CCDS10296.1; -. [O75838-1]
CCDS; CCDS61722.1; -. [O75838-3]
CCDS; CCDS61723.1; -. [O75838-4]
RefSeq; NP_001258817.1; NM_001271888.1. [O75838-3]
RefSeq; NP_001258818.1; NM_001271889.1. [O75838-4]
RefSeq; NP_001288153.1; NM_001301224.1.
RefSeq; NP_006374.1; NM_006383.3. [O75838-1]
RefSeq; XP_005254183.1; XM_005254126.3. [O75838-2]
RefSeq; XP_006720437.1; XM_006720374.2. [O75838-3]
UniGene; Hs.129867; -.
ProteinModelPortal; O75838; -.
SMR; O75838; -.
BioGrid; 115773; 16.
STRING; 9606.ENSP00000258930; -.
iPTMnet; O75838; -.
PhosphoSitePlus; O75838; -.
BioMuta; CIB2; -.
PaxDb; O75838; -.
PeptideAtlas; O75838; -.
PRIDE; O75838; -.
ProteomicsDB; 50222; -.
DNASU; 10518; -.
Ensembl; ENST00000258930; ENSP00000258930; ENSG00000136425. [O75838-1]
Ensembl; ENST00000539011; ENSP00000442459; ENSG00000136425. [O75838-3]
Ensembl; ENST00000557846; ENSP00000453488; ENSG00000136425. [O75838-4]
GeneID; 10518; -.
KEGG; hsa:10518; -.
UCSC; uc002bdb.3; human. [O75838-1]
CTD; 10518; -.
DisGeNET; 10518; -.
EuPathDB; HostDB:ENSG00000136425.12; -.
GeneCards; CIB2; -.
GeneReviews; CIB2; -.
HGNC; HGNC:24579; CIB2.
HPA; HPA036697; -.
MalaCards; CIB2; -.
MIM; 605564; gene.
MIM; 609439; phenotype.
MIM; 614869; phenotype.
neXtProt; NX_O75838; -.
OpenTargets; ENSG00000136425; -.
Orphanet; 90636; Autosomal recessive non-syndromic sensorineural deafness type DFNB.
Orphanet; 231169; Usher syndrome type 1.
PharmGKB; PA134927274; -.
eggNOG; KOG0038; Eukaryota.
eggNOG; COG5126; LUCA.
GeneTree; ENSGT00940000157327; -.
HOGENOM; HOG000233019; -.
HOVERGEN; HBG107344; -.
InParanoid; O75838; -.
OrthoDB; 1271942at2759; -.
PhylomeDB; O75838; -.
TreeFam; TF313865; -.
GenomeRNAi; 10518; -.
PRO; PR:O75838; -.
Proteomes; UP000005640; Chromosome 15.
Bgee; ENSG00000136425; Expressed in 219 organ(s), highest expression level in right atrium auricular region.
ExpressionAtlas; O75838; baseline and differential.
Genevisible; O75838; HS.
GO; GO:0072562; C:blood microparticle; HDA:UniProtKB.
GO; GO:0032437; C:cuticular plate; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; ISS:UniProtKB.
GO; GO:0005927; C:muscle tendon junction; IEA:Ensembl.
GO; GO:0031594; C:neuromuscular junction; IEA:Ensembl.
GO; GO:0001917; C:photoreceptor inner segment; ISS:UniProtKB.
GO; GO:0001750; C:photoreceptor outer segment; ISS:UniProtKB.
GO; GO:0042383; C:sarcolemma; IEA:UniProtKB-SubCell.
GO; GO:0032420; C:stereocilium; IDA:UniProtKB.
GO; GO:0005509; F:calcium ion binding; IDA:UniProtKB.
GO; GO:0005178; F:integrin binding; IEA:Ensembl.
GO; GO:0000287; F:magnesium ion binding; IDA:UniProtKB.
GO; GO:0042803; F:protein homodimerization activity; IDA:UniProtKB.
GO; GO:0055074; P:calcium ion homeostasis; ISS:UniProtKB.
GO; GO:0071318; P:cellular response to ATP; IDA:UniProtKB.
GO; GO:0045494; P:photoreceptor cell maintenance; ISS:UniProtKB.
GO; GO:0007204; P:positive regulation of cytosolic calcium ion concentration; IDA:UniProtKB.
CDD; cd00051; EFh; 1.
InterPro; IPR011992; EF-hand-dom_pair.
InterPro; IPR018247; EF_Hand_1_Ca_BS.
InterPro; IPR002048; EF_hand_dom.
Pfam; PF13499; EF-hand_7; 1.
SMART; SM00054; EFh; 2.
SUPFAM; SSF47473; SSF47473; 1.
PROSITE; PS00018; EF_HAND_1; 2.
PROSITE; PS50222; EF_HAND_2; 3.
1: Evidence at protein level;
Alternative splicing; Calcium; Cell membrane; Cell projection; Cilium;
Complete proteome; Cytoplasm; Deafness; Disease mutation; Magnesium;
Membrane; Metal-binding; Non-syndromic deafness; Reference proteome;
Repeat; Retinitis pigmentosa; Usher syndrome.
CHAIN 1 187 Calcium and integrin-binding family
member 2.
/FTId=PRO_0000073534.
DOMAIN 66 101 EF-hand 1. {ECO:0000255|PROSITE-
ProRule:PRU00448}.
DOMAIN 103 138 EF-hand 2. {ECO:0000255|PROSITE-
ProRule:PRU00448}.
DOMAIN 144 179 EF-hand 3. {ECO:0000255|PROSITE-
ProRule:PRU00448}.
CA_BIND 116 127 1. {ECO:0000305}.
CA_BIND 157 168 2. {ECO:0000305}.
VAR_SEQ 1 43 Missing (in isoform 3).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_053863.
VAR_SEQ 18 66 Missing (in isoform 4). {ECO:0000305}.
/FTId=VSP_054777.
VAR_SEQ 181 187 STFHIRI -> RCCHYRGRAWAGQSRAGRDVGAEAPITRYL
(in isoform 2).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_053864.
VARIANT 64 64 E -> D (in USH1J; dbSNP:rs145415848).
{ECO:0000269|PubMed:23023331}.
/FTId=VAR_069086.
VARIANT 66 66 R -> W (in DFNB48; unknown pathological
significance; no loss on localization to
stereocilia; does not affect ATP-induced
calcium release; dbSNP:rs780168150).
{ECO:0000269|PubMed:26173970}.
/FTId=VAR_074552.
VARIANT 75 75 V -> M (found in a family with deafness
carrying a likely pathogenic mutation in
PDZD7; unknown pathological significance;
dbSNP:rs758743502).
{ECO:0000269|PubMed:26416264}.
/FTId=VAR_080825.
VARIANT 91 91 F -> S (in DFNB48; no loss on
localization to stereocilia; does not
affect ATP-induced calcium release;;
dbSNP:rs397515411).
{ECO:0000269|PubMed:23023331,
ECO:0000269|PubMed:26173970,
ECO:0000269|PubMed:26426422}.
/FTId=VAR_069087.
VARIANT 99 99 C -> W (in DFNB48; inhibits the ability
to decrease ATP-induced calcium release;
dbSNP:rs370965183).
{ECO:0000269|PubMed:23023331}.
/FTId=VAR_069088.
VARIANT 123 123 I -> T (in DFNB48; stimulates the ability
to decrease ATP-induced calcium release;
dbSNP:rs397515412).
{ECO:0000269|PubMed:23023331}.
/FTId=VAR_069089.
VARIANT 186 186 R -> W (in DFNB48; does not affect the
localization in the cuticular plate or to
the tip of stereocilia; inhibits the
ability to decrease ATP-induced calcium
release; does not affect binding with
WHRN; dbSNP:rs370359511).
{ECO:0000269|PubMed:26426422}.
/FTId=VAR_077559.
SEQUENCE 187 AA; 21644 MW; D51F6C25AD381BEF CRC64;
MGNKQTIFTE EQLDNYQDCT FFNKKDILKL HSRFYELAPN LVPMDYRKSP IVHVPMSLII
QMPELRENPF KERIVAAFSE DGEGNLTFND FVDMFSVLCE SAPRELKANY AFKIYDFNTD
NFICKEDLEL TLARLTKSEL DEEEVVLVCD KVIEEADLDG DGKLGFADFE DMIAKAPDFL
STFHIRI


Related products :

Catalog number Product name Quantity
EIAAB07392 Calcium and integrin-binding family member 2,Cib2,Kinase-interacting protein 2,KIP 2,Kip2,Mouse,Mus musculus
EIAAB07393 Calcium and integrin-binding family member 3,CIB3,Homo sapiens,Human,Kinase-interacting protein 3,KIP 3,KIP3
EIAAB07390 Calcium and integrin-binding family member 2,CIB2,Homo sapiens,Human,Kinase-interacting protein 2,KIP 2,KIP2
E1394h ELISA Calcium- and integrin-binding protein,Calcium and integrin-binding protein 1,Calmyrin,CIB,CIB,CIB1,CIBP,DNA-PKcs-interacting protein,Homo sapiens,Human,Kinase-interacting protein,KIP,KIP,PRKDCIP 96T
U1394h CLIA Calcium- and integrin-binding protein,Calcium and integrin-binding protein 1,Calmyrin,CIB,CIB,CIB1,CIBP,DNA-PKcs-interacting protein,Homo sapiens,Human,Kinase-interacting protein,KIP,KIP,PRKDCIP, 96T
E1394h ELISA kit Calcium- and integrin-binding protein,Calcium and integrin-binding protein 1,Calmyrin,CIB,CIB,CIB1,CIBP,DNA-PKcs-interacting protein,Homo sapiens,Human,Kinase-interacting protein,KIP,KIP,PR 96T
20-372-60089 calcium and integrin binding family member 2. mRNA (cDNA clone MGC 48487 IMAGE 5287072). complete cds - Mouse monoclonal anti-human CIB2 antibody; Kinase-interacting protein 2; KIP 2 Monoclonal 0.1 mg
EIAAB26847 Amyloid beta A4 protein-binding family A member 2-binding protein,APBA2BP,Homo sapiens,Human,NECAB3,Nek2-interacting protein 1,Neuronal calcium-binding protein 3,NIP1,N-terminal EF-hand calcium-bindin
10-288-21983F Calcium and integrin-binding protein 1 - Calmyrin; DNA-PKcs-interacting protein; Kinase-interacting protein; KIP; CIB; SNK-interacting protein 2-28; SIP2-28 0.1 mg
10-288-21983F Calcium and integrin-binding protein 1 - Calmyrin; DNA-PKcs-interacting protein; Kinase-interacting protein; KIP; CIB; SNK-interacting protein 2-28; SIP2-28 0.05 mg
E1394m ELISA kit Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Mouse,Mus musculus,Prkdcip 96T
E1394m ELISA Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Mouse,Mus musculus,Prkdcip 96T
U1394r CLIA Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Prkdcip,Rat,Rattus norvegicus 96T
E1394r ELISA kit Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Prkdcip,Rat,Rattus norvegicus 96T
E1394r ELISA Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Prkdcip,Rat,Rattus norvegicus 96T
U1394m CLIA Calcium and integrin-binding protein 1,Calmyrin,CIB,Cib,Cib1,DNA-PKcs-interacting protein,Kinase-interacting protein,KIP,Kip,Mouse,Mus musculus,Prkdcip 96T
CIC CIB3 Gene calcium and integrin binding family member 3
CIB4 CIB2 Gene calcium and integrin binding family member 2
CSB-EL005427RA Rat Calcium and integrin-binding family member 2(CIB2) ELISA kit 96T
CIDEA CIB4 Gene calcium and integrin binding family member 4
CIB2_HUMAN Human ELISA Kit FOR Calcium and integrin-binding family member 2 96T
GWB-6EFFE7 Calcium and integrin binding family member 2 (CIB2), Antibody
E1053Rb Mouse ELISA Kit FOR Calcium and integrin-binding family member 3 96T
CSB-EL005429HU Human Calcium and integrin-binding family member 4(CIB4) ELISA kit 96T
abx111300 Polyclonal Rabbit Calcium And Integrin Binding Family Member 4 Antibody 50 μl

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1493: Carbon assimilation C4 pathway
WP1531: Vitamin D synthesis
WP1616: ABC transporters
WP1909: Signal regulatory protein (SIRP) family interactions
WP2292: Chemokine signaling pathway
WP731: Sterol regulatory element binding protein related
WP1043: Calcium Regulation in the Cardiac Cell
WP1049: G Protein Signaling Pathways
WP1069: Integrin-mediated cell adhesion
WP1103: Alpha6-Beta4 Integrin Signaling Pathway
WP1159: Calcium Regulation in the Cardiac Cell
WP1165: G Protein Signaling Pathways
WP1185: Integrin-mediated cell adhesion
WP1329: Alpha6-Beta4 Integrin Signaling Pathway
WP1365: Calcium Regulation in the Cardiac Cell
WP1371: G Protein Signaling Pathways
WP1386: Integrin-mediated cell adhesion
WP1438: Influenza A virus infection
WP1485: Interactions between CFTR and other ion channels
WP1502: Mitochondrial biogenesis
WP1566: Citrate cycle (TCA cycle)
WP1567: Glycolysis and Gluconeogenesis
WP1613: 1,4-Dichlorobenzene degradation
WP1619: Amino sugar and nucleotide sugar metabolism
WP1624: Bacterial secretion system

Related Genes :
[CIB2 KIP2] Calcium and integrin-binding family member 2 (Kinase-interacting protein 2) (KIP 2)
[CIB1 CIB KIP PRKDCIP] Calcium and integrin-binding protein 1 (CIB) (Calcium- and integrin-binding protein) (CIBP) (Calmyrin) (DNA-PKcs-interacting protein) (Kinase-interacting protein) (KIP) (SNK-interacting protein 2-28) (SIP2-28)
[Cib2 Kip2] Calcium and integrin-binding family member 2 (Kinase-interacting protein 2) (KIP 2)
[Cib1 Cib Kip Prkdcip] Calcium and integrin-binding protein 1 (CIB) (Calmyrin) (DNA-PKcs-interacting protein) (Kinase-interacting protein) (KIP)
[Cib1 Cib Kip Prkdcip] Calcium and integrin-binding protein 1 (CIB) (Calmyrin) (DNA-PKcs-interacting protein) (Kinase-interacting protein) (KIP)
[CIB3 KIP3] Calcium and integrin-binding family member 3 (Kinase-interacting protein 3) (KIP 3)
[Ptk2b Fak2 Pyk2 Raftk] Protein-tyrosine kinase 2-beta (EC 2.7.10.2) (Calcium-dependent tyrosine kinase) (CADTK) (Calcium-regulated non-receptor proline-rich tyrosine kinase) (Cell adhesion kinase beta) (CAK-beta) (CAKB) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine kinase 2) (Related adhesion focal tyrosine kinase) (RAFTK)
[PLEKHO1 CKIP1 OC120 HQ0024c] Pleckstrin homology domain-containing family O member 1 (PH domain-containing family O member 1) (C-Jun-binding protein) (JBP) (Casein kinase 2-interacting protein 1) (CK2-interacting protein 1) (CKIP-1) (Osteoclast maturation-associated gene 120 protein)
[MAPK14 CSBP CSBP1 CSBP2 CSPB1 MXI2 SAPK2A] Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (Cytokine suppressive anti-inflammatory drug-binding protein) (CSAID-binding protein) (CSBP) (MAP kinase MXI2) (MAX-interacting protein 2) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha) (Stress-activated protein kinase 2a) (SAPK2a)
[PTK2B FAK2 PYK2 RAFTK] Protein-tyrosine kinase 2-beta (EC 2.7.10.2) (Calcium-dependent tyrosine kinase) (CADTK) (Calcium-regulated non-receptor proline-rich tyrosine kinase) (Cell adhesion kinase beta) (CAK-beta) (CAKB) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine kinase 2) (Related adhesion focal tyrosine kinase) (RAFTK)
[Ptk2b Fak2 Pyk2] Protein-tyrosine kinase 2-beta (EC 2.7.10.2) (Calcium-dependent tyrosine kinase) (CADTK) (Calcium-regulated non-receptor proline-rich tyrosine kinase) (Cell adhesion kinase beta) (CAK-beta) (CAKB) (Focal adhesion kinase 2) (FADK 2) (Proline-rich tyrosine kinase 2)
[NMRK2 ITGB1BP3 NRK2] Nicotinamide riboside kinase 2 (NRK 2) (NmR-K 2) (EC 2.7.1.22) (Integrin beta-1-binding protein 3) (Muscle integrin-binding protein) (MIBP) (Nicotinic acid riboside kinase 2) (EC 2.7.1.173) (Ribosylnicotinamide kinase 2) (RNK 2) (Ribosylnicotinic acid kinase 2)
[CDKN1C KIP2] Cyclin-dependent kinase inhibitor 1C (Cyclin-dependent kinase inhibitor p57) (p57Kip2)
[SLC25A23 APC2 MCSC2 SCAMC3] Calcium-binding mitochondrial carrier protein SCaMC-3 (Mitochondrial ATP-Mg/Pi carrier protein 2) (Mitochondrial Ca(2+)-dependent solute carrier protein 2) (Small calcium-binding mitochondrial carrier protein 3) (Solute carrier family 25 member 23)
[Nmrk2 Itgb1bp3 Nrk2] Nicotinamide riboside kinase 2 (NRK 2) (NmR-K 2) (EC 2.7.1.22) (Integrin beta-1-binding protein 3) (Muscle integrin-binding protein) (MIBP) (Nicotinic acid riboside kinase 2) (EC 2.7.1.173) (Ribosylnicotinamide kinase 2) (RNK 2) (Ribosylnicotinic acid kinase 2)
[ITGA2B GP2B ITGAB] Integrin alpha-IIb (GPalpha IIb) (GPIIb) (Platelet membrane glycoprotein IIb) (CD antigen CD41) [Cleaved into: Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2]
[CLCA2 CACC3] Calcium-activated chloride channel regulator 2 (EC 3.4.-.-) (Calcium-activated chloride channel family member 2) (hCLCA2) (Calcium-activated chloride channel protein 3) (CaCC-3) (hCaCC-3) [Cleaved into: Calcium-activated chloride channel regulator 2, 109 kDa form; Calcium-activated chloride channel regulator 2, 35 kDa form]
[Tab2 Kiaa0733 Map3k7ip2] TGF-beta-activated kinase 1 and MAP3K7-binding protein 2 (Mitogen-activated protein kinase kinase kinase 7-interacting protein 2) (TAK1-binding protein 2) (TAB-2) (TGF-beta-activated kinase 1-binding protein 2)
[Eef2k] Eukaryotic elongation factor 2 kinase (eEF-2 kinase) (eEF-2K) (EC 2.7.11.20) (Calcium/calmodulin-dependent eukaryotic elongation factor 2 kinase)
[Cacna2d2 Kiaa0558] Voltage-dependent calcium channel subunit alpha-2/delta-2 (Protein ducky) (Voltage-gated calcium channel subunit alpha-2/delta-2) [Cleaved into: Voltage-dependent calcium channel subunit alpha-2-2; Voltage-dependent calcium channel subunit delta-2]
[Ptk2 Fadk Fak Fak1 Kiaa4203] Focal adhesion kinase 1 (FADK 1) (EC 2.7.10.2) (Focal adhesion kinase-related nonkinase) (FRNK) (Protein-tyrosine kinase 2) (p125FAK) (pp125FAK)
[NECAB2 EFCBP2] N-terminal EF-hand calcium-binding protein 2 (EF-hand calcium-binding protein 2) (Neuronal calcium-binding protein 2) (Synaptotagmin-interacting protein 2) (Stip-2)
[unc-43 K11E8.1] Calcium/calmodulin-dependent protein kinase type II (CaM kinase II) (EC 2.7.11.17) (Uncoordinated protein 43)
[RIPK2 CARDIAK RICK RIP2 UNQ277/PRO314/PRO34092] Receptor-interacting serine/threonine-protein kinase 2 (EC 2.7.11.1) (CARD-containing interleukin-1 beta-converting enzyme-associated kinase) (CARD-containing IL-1 beta ICE-kinase) (RIP-like-interacting CLARP kinase) (Receptor-interacting protein 2) (RIP-2) (Tyrosine-protein kinase RIPK2) (EC 2.7.10.2)
[SLC25A25 APC3 KIAA1896 MCSC3 SCAMC2 UNQ549/PRO1106] Calcium-binding mitochondrial carrier protein SCaMC-2 (Mitochondrial ATP-Mg/Pi carrier protein 3) (Mitochondrial Ca(2+)-dependent solute carrier protein 3) (Small calcium-binding mitochondrial carrier protein 2) (Solute carrier family 25 member 25)
[Eif2ak2 Pkr Prkr Tik] Interferon-induced, double-stranded RNA-activated protein kinase (EC 2.7.11.1) (Eukaryotic translation initiation factor 2-alpha kinase 2) (eIF-2A protein kinase 2) (Interferon-inducible RNA-dependent protein kinase) (P1/eIF-2A protein kinase) (Protein kinase RNA-activated) (PKR) (Protein kinase R) (Serine/threonine-protein kinase TIK) (Tyrosine-protein kinase EIF2AK2) (EC 2.7.10.2) (p68 kinase)
[Ripk3 Rip3] Receptor-interacting serine/threonine-protein kinase 3 (EC 2.7.11.1) (RIP-like protein kinase 3) (Receptor-interacting protein 3) (RIP-3) (mRIP3)
[CLEC4M CD209L CD209L1 CD299] C-type lectin domain family 4 member M (CD209 antigen-like protein 1) (DC-SIGN-related protein) (DC-SIGNR) (Dendritic cell-specific ICAM-3-grabbing non-integrin 2) (DC-SIGN2) (Liver/lymph node-specific ICAM-3-grabbing non-integrin) (L-SIGN) (CD antigen CD299)
[ITGA2 CD49B] Integrin alpha-2 (CD49 antigen-like family member B) (Collagen receptor) (Platelet membrane glycoprotein Ia) (GPIa) (VLA-2 subunit alpha) (CD antigen CD49b)
[CIPK6 PKS4 SIP3 SnRK3.14 At4g30960 F6I18.130] CBL-interacting serine/threonine-protein kinase 6 (EC 2.7.11.1) (SNF1-related kinase 3.14) (SOS2-like protein kinase PKS4) (SOS3-interacting protein 3)

Bibliography :