GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Caspase recruitment domain-containing protein 16 (Caspase recruitment domain-only protein 1) (CARD-only protein 1) (Caspase-1 inhibitor COP) (Pseudo interleukin-1 beta converting enzyme) (Pseudo-ICE) (Pseudo-IL1B-converting enzyme)

 CAR16_HUMAN             Reviewed;         197 AA.
Q5EG05; Q96RJ9;
02-SEP-2008, integrated into UniProtKB/Swiss-Prot.
15-MAR-2005, sequence version 1.
18-SEP-2019, entry version 113.
RecName: Full=Caspase recruitment domain-containing protein 16;
AltName: Full=Caspase recruitment domain-only protein 1;
Short=CARD-only protein 1;
AltName: Full=Caspase-1 inhibitor COP;
AltName: Full=Pseudo interleukin-1 beta converting enzyme;
Short=Pseudo-ICE;
Short=Pseudo-IL1B-converting enzyme;
Name=CARD16; Synonyms=COP, COP1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, TISSUE SPECIFICITY,
AND INTERACTION WITH CASP1 AND RIPK2.
PubMed=11536016; DOI=10.1038/sj.cdd.4400881;
Druilhe A., Srinivasula S.M., Razmara M., Ahmad M., Alnemri E.S.;
"Regulation of IL-1beta generation by Pseudo-ICE and ICEBERG, two
dominant negative caspase recruitment domain proteins.";
Cell Death Differ. 8:649-657(2001).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Wang P.Z., Wang F., Wang X., Wu J.;
"Novel splicing variants of some human genes.";
Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Spleen;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
FUNCTION, TISSUE SPECIFICITY, SUBUNIT, AND INTERACTION WITH CASP1 AND
RIPK2.
PubMed=11432859; DOI=10.1074/jbc.m101415200;
Lee S.H., Stehlik C., Reed J.C.;
"Cop, a caspase recruitment domain-containing protein and inhibitor of
caspase-1 activation processing.";
J. Biol. Chem. 276:34495-34500(2001).
[7]
INTERACTION WITH CARD8.
PubMed=11821383; DOI=10.1074/jbc.m107811200;
Razmara M., Srinivasula S.M., Wang L., Poyet J.-L., Geddes B.J.,
DiStefano P.S., Bertin J., Alnemri E.S.;
"CARD-8 protein, a new CARD family member that regulates caspase-1
activation and apoptosis.";
J. Biol. Chem. 277:13952-13958(2002).
[8]
INDUCTION.
PubMed=16354923; DOI=10.1523/jneurosci.4181-05.2005;
Wang X., Wang H., Figueroa B.E., Zhang W.-H., Huo C., Guan Y.,
Zhang Y., Bruey J.-M., Reed J.C., Friedlander R.M.;
"Dysregulation of receptor interacting protein-2 and caspase
recruitment domain only protein mediates aberrant caspase-1 activation
in Huntington's disease.";
J. Neurosci. 25:11645-11654(2005).
[9]
FUNCTION, AND INTERACTION WITH CASP4.
PubMed=16920334; DOI=10.1016/j.bbadis.2006.06.015;
Wang X., Narayanan M., Bruey J.-M., Rigamonti D., Cattaneo E.,
Reed J.C., Friedlander R.M.;
"Protective role of Cop in Rip2/caspase-1/caspase-4-mediated HeLa cell
death.";
Biochim. Biophys. Acta 1762:742-754(2006).
[10]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
-!- FUNCTION: Caspase inhibitor. Acts as a regulator of procaspase-
1/CASP1 activation implicated in the regulation of the proteolytic
maturation of pro-interleukin-1 beta (IL1B) and its release during
inflammation. Inhibits the release of IL1B in response to LPS in
monocytes. Also induces NF-kappa-B activation during the pro-
inflammatory cytokine response. Also able to inhibit CASP1-
mediated neuronal cell death, TNF-alpha, hypoxia-, UV-, and
staurosporine-mediated cell death but not ER stress-mediated cell
death. Acts by preventing activation of caspases CASP1 and CASP4,
possibly by preventing the interaction between CASP1 and RIPK2.
{ECO:0000269|PubMed:11432859, ECO:0000269|PubMed:11536016,
ECO:0000269|PubMed:16920334}.
-!- SUBUNIT: Homooligomer. Interacts with CASP1, CASP4, CARD8 and
RIPK2. {ECO:0000269|PubMed:11432859, ECO:0000269|PubMed:11536016,
ECO:0000269|PubMed:11821383, ECO:0000269|PubMed:16920334}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q5EG05-1; Sequence=Displayed;
Name=2;
IsoId=Q5EG05-2; Sequence=VSP_035216;
-!- TISSUE SPECIFICITY: Widely expressed. Expressed at higher level in
placenta, spleen, lymph node and bone marrow. Weakly or not
expressed in thymus. {ECO:0000269|PubMed:11432859,
ECO:0000269|PubMed:11536016}.
-!- INDUCTION: Down-regulated in patients suffering of Huntington
disease. {ECO:0000269|PubMed:16354923}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF367017; AAK71682.1; -; mRNA.
EMBL; AY885669; AAW78563.1; -; mRNA.
EMBL; AK311902; BAG34843.1; -; mRNA.
EMBL; CH471065; EAW67062.1; -; Genomic_DNA.
EMBL; BC117478; AAI17479.1; -; mRNA.
EMBL; BC117480; AAI17481.1; -; mRNA.
CCDS; CCDS31661.1; -. [Q5EG05-1]
CCDS; CCDS41705.1; -. [Q5EG05-2]
RefSeq; NP_001017534.1; NM_001017534.1. [Q5EG05-1]
RefSeq; NP_443121.1; NM_052889.2. [Q5EG05-2]
SMR; Q5EG05; -.
BioGrid; 125339; 3.
IntAct; Q5EG05; 1.
MINT; Q5EG05; -.
STRING; 9606.ENSP00000364858; -.
iPTMnet; Q5EG05; -.
PhosphoSitePlus; Q5EG05; -.
BioMuta; CARD16; -.
DMDM; 74722547; -.
jPOST; Q5EG05; -.
MassIVE; Q5EG05; -.
MaxQB; Q5EG05; -.
PaxDb; Q5EG05; -.
PeptideAtlas; Q5EG05; -.
PRIDE; Q5EG05; -.
ProteomicsDB; 62773; -. [Q5EG05-1]
ProteomicsDB; 62774; -. [Q5EG05-2]
Ensembl; ENST00000375704; ENSP00000364856; ENSG00000204397. [Q5EG05-2]
Ensembl; ENST00000375706; ENSP00000364858; ENSG00000204397. [Q5EG05-1]
Ensembl; ENST00000525374; ENSP00000433700; ENSG00000204397. [Q5EG05-2]
GeneID; 114769; -.
KEGG; hsa:114769; -.
UCSC; uc001pio.2; human. [Q5EG05-1]
CTD; 114769; -.
DisGeNET; 114769; -.
GeneCards; CARD16; -.
HGNC; HGNC:33701; CARD16.
HPA; HPA053981; -.
HPA; HPA062805; -.
MIM; 615680; gene.
neXtProt; NX_Q5EG05; -.
OpenTargets; ENSG00000204397; -.
PharmGKB; PA164717628; -.
eggNOG; KOG3573; Eukaryota.
eggNOG; ENOG410ZQIE; LUCA.
GeneTree; ENSGT00940000159114; -.
HOGENOM; HOG000111300; -.
InParanoid; Q5EG05; -.
KO; K12806; -.
OMA; CITDICE; -.
OrthoDB; 1327703at2759; -.
PhylomeDB; Q5EG05; -.
TreeFam; TF330675; -.
ChiTaRS; CARD16; human.
GeneWiki; COP1; -.
GenomeRNAi; 114769; -.
Pharos; Q5EG05; -.
PRO; PR:Q5EG05; -.
Proteomes; UP000005640; Chromosome 11.
Bgee; ENSG00000204397; Expressed in 171 organ(s), highest expression level in leukocyte.
ExpressionAtlas; Q5EG05; baseline and differential.
Genevisible; Q5EG05; HS.
GO; GO:0097179; C:protease inhibitor complex; IDA:UniProtKB.
GO; GO:0032991; C:protein-containing complex; IDA:UniProtKB.
GO; GO:0050700; F:CARD domain binding; IPI:UniProtKB.
GO; GO:0089720; F:caspase binding; IPI:UniProtKB.
GO; GO:0004869; F:cysteine-type endopeptidase inhibitor activity; IDA:UniProtKB.
GO; GO:0042802; F:identical protein binding; IDA:UniProtKB.
GO; GO:0019900; F:kinase binding; IPI:UniProtKB.
GO; GO:0071456; P:cellular response to hypoxia; IDA:UniProtKB.
GO; GO:0071222; P:cellular response to lipopolysaccharide; IDA:UniProtKB.
GO; GO:0071494; P:cellular response to UV-C; IDA:UniProtKB.
GO; GO:0097340; P:inhibition of cysteine-type endopeptidase activity; IDA:UniProtKB.
GO; GO:0043154; P:negative regulation of cysteine-type endopeptidase activity involved in apoptotic process; IDA:UniProtKB.
GO; GO:0050713; P:negative regulation of interleukin-1 beta secretion; IDA:UniProtKB.
GO; GO:0031665; P:negative regulation of lipopolysaccharide-mediated signaling pathway; IDA:UniProtKB.
GO; GO:0032091; P:negative regulation of protein binding; IDA:UniProtKB.
GO; GO:0010804; P:negative regulation of tumor necrosis factor-mediated signaling pathway; IMP:UniProtKB.
GO; GO:0043123; P:positive regulation of I-kappaB kinase/NF-kappaB signaling; IDA:UniProtKB.
GO; GO:0051092; P:positive regulation of NF-kappaB transcription factor activity; IDA:UniProtKB.
InterPro; IPR001315; CARD.
InterPro; IPR011029; DEATH-like_dom_sf.
Pfam; PF00619; CARD; 1.
SMART; SM00114; CARD; 1.
SUPFAM; SSF47986; SSF47986; 1.
PROSITE; PS50209; CARD; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Polymorphism;
Protease inhibitor; Reference proteome; Thiol protease inhibitor.
CHAIN 1 197 Caspase recruitment domain-containing
protein 16.
/FTId=PRO_0000349180.
DOMAIN 1 91 CARD. {ECO:0000255|PROSITE-
ProRule:PRU00046}.
VAR_SEQ 92 197 ALQAVQDNPAMPTCSSPEGRIKLCFLEDAQRIWKQKLQRCH
VQNTIIKWSERYTSGSFEMQWLFLRTNFIERFWRNILLLPL
HKGSLYPRIPGLGKELQTGTHKLS -> GPIPGN (in
isoform 2). {ECO:0000303|PubMed:11536016,
ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_035216.
VARIANT 33 33 R -> S (in dbSNP:rs35966314).
/FTId=VAR_046279.
VARIANT 37 37 Q -> K (in dbSNP:rs1042744).
/FTId=VAR_046280.
VARIANT 56 56 A -> D (in dbSNP:rs34534919).
/FTId=VAR_046281.
VARIANT 167 167 N -> I (in dbSNP:rs542571).
/FTId=VAR_046282.
SEQUENCE 197 AA; 22625 MW; 5DCAC6A9B2FAE82F CRC64;
MADKVLKEKR KLFIHSMGEG TINGLLDELL QTRVLNQEEM EKVKRENATV MDKTRALIDS
VIPKGAQACQ ICITYICEED SYLAETLGLS AALQAVQDNP AMPTCSSPEG RIKLCFLEDA
QRIWKQKLQR CHVQNTIIKW SERYTSGSFE MQWLFLRTNF IERFWRNILL LPLHKGSLYP
RIPGLGKELQ TGTHKLS


Related products :

Catalog number Product name Quantity
EIAAB05319 CARD only domain-containing protein 1,CARD16,Caspase recruitment domain-containing protein 16,Caspase-1 inhibitor COP,COP,COP1,Homo sapiens,Human,Pseudo interleukin-1 beta converting enzyme,Pseudo-ICE
EIAAB05320 CARD17,Caspase recruitment domain-containing protein 17,Caspase-1 inhibitor INCA,Homo sapiens,Human,INCA,Inhibitory caspase recruitment domain protein
20-272-191255 NALP1 - Mouse monoclonal [Nalpy1 - 4] to NALP1; Death effector filament-forming ced-4-like apoptosis protein; Nucleotide-binding domain and caspase recruitment domain; Caspase recruitment domain prote 0.05 mg
18-272-197016 Caspase 10 - Rabbit polyclonal to Caspase 10; EC 3.4.22.63; CASP-10; ICE-like apoptotic protease 4; Apoptotic protease Mch-4; FAS-associated death domain protein interleukin-1B-converting enzyme 2; FL 0.1 mg
20-272-190222 Caspase 10 - Rat monoclonal [25C2] to Caspase 10; EC 3.4.22.63; CASP-10; ICE-like apoptotic protease 4; Apoptotic protease Mch-4; FAS-associated death domain protein interleukin-1B-converting enzyme 2 0.1 ml
18-272-195092 Caspase 10 - Rabbit polyclonal to Caspase 10; EC 3.4.22.63; CASP-10; ICE-like apoptotic protease 4; Apoptotic protease Mch-4; FAS-associated death domain protein interleukin-1B-converting enzyme 2; FL 0.1 ml
20-272-191021 Caspase 1 - Mouse monoclonal [14F468] to Caspase 1; EC 3.4.22.36; CASP-1; Interleukin-1 beta convertase; IL-1BC; IL-1 beta-converting enzyme; ICE; Interleukin-1 beta-converting enzyme; p45 Monoclonal 0.05 mg
18-272-196462 Caspase 1 prediluted - Rabbit polyclonal to Caspase 1 prediluted; EC 3.4.22.36; CASP-1; Interleukin-1 beta convertase; IL-1BC; IL-1 beta-converting enzyme; ICE; Interleukin-1 beta-converting enzyme; p 7 ml
18-272-196188 Caspase 1 - Rabbit polyclonal to Caspase 1; EC 3.4.22.36; CASP-1; Interleukin-1 beta convertase; IL-1BC; IL-1 beta-converting enzyme; ICE; Interleukin-1 beta-converting enzyme; p45 Polyclonal 0.05 mg
18-272-195237 Caspase 1 - Rabbit polyclonal to Caspase 1; EC 3.4.22.36; CASP-1; Interleukin-1 beta convertase; IL-1BC; IL-1 beta-converting enzyme; ICE; Interleukin-1 beta-converting enzyme; p45 Polyclonal 0.05 mg
18-272-197000 Caspase 1 - Rabbit polyclonal to Caspase 1; EC 3.4.22.36; CASP-1; Interleukin-1 beta convertase; IL-1BC; IL-1 beta-converting enzyme; ICE; Interleukin-1 beta-converting enzyme; p45 Polyclonal 0.5 ml
18-661-15095 Apoptosis-associated speck-like protein containing a CARD - hASC; PYD and CARD domain-containing protein; Target of methylation-induced silencing 1; Caspase recruitment domain-containing protein 5 Pol 0.1 mg
18-661-15159 Caspase recruitment domain-containing protein 8 - Apoptotic protein NDPP1; DACAR; CARD-inhibitor of NF-kappa-B-activating ligand; CARDINAL; Tumor-up-regulated CARD-containing antagonist of CASP9; TUCA 0.1 mg
E1592h ELISA kit CASP1,CASP-1,Caspase-1,Homo sapiens,Human,ICE,IL-1 beta-converting enzyme,IL1BC,IL-1BC,IL1BCE,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,p45 96T
E1592h ELISA CASP1,CASP-1,Caspase-1,Homo sapiens,Human,ICE,IL-1 beta-converting enzyme,IL1BC,IL-1BC,IL1BCE,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,p45 96T
U1592h CLIA CASP1,CASP-1,Caspase-1,Homo sapiens,Human,ICE,IL-1 beta-converting enzyme,IL1BC,IL-1BC,IL1BCE,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,p45 96T
E1592r ELISA Casp1,CASP-1,Caspase-1,ICE,IL-1 beta-converting enzyme,Il1bc,IL-1BC,Il1bce,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,p45,Rat,Rattus norvegicus 96T
E1592r ELISA kit Casp1,CASP-1,Caspase-1,ICE,IL-1 beta-converting enzyme,Il1bc,IL-1BC,Il1bce,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,p45,Rat,Rattus norvegicus 96T
U1592r CLIA Casp1,CASP-1,Caspase-1,ICE,IL-1 beta-converting enzyme,Il1bc,IL-1BC,Il1bce,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,p45,Rat,Rattus norvegicus 96T
E1592m ELISA kit Casp1,CASP-1,Caspase-1,ICE,IL-1 beta-converting enzyme,Il1bc,IL-1BC,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,Mouse,Mus musculus,p45 96T
U1592m CLIA Casp1,CASP-1,Caspase-1,ICE,IL-1 beta-converting enzyme,Il1bc,IL-1BC,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,Mouse,Mus musculus,p45 96T
E1592m ELISA Casp1,CASP-1,Caspase-1,ICE,IL-1 beta-converting enzyme,Il1bc,IL-1BC,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,Mouse,Mus musculus,p45 96T
E1592p ELISA CASP1,CASP-1,Caspase-1,ICE,IL-1 beta-converting enzyme,IL1BC,IL-1BC,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,p45,Pig,Sus scrofa 96T
U1592p CLIA CASP1,CASP-1,Caspase-1,ICE,IL-1 beta-converting enzyme,IL1BC,IL-1BC,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,p45,Pig,Sus scrofa 96T
E1592p ELISA kit CASP1,CASP-1,Caspase-1,ICE,IL-1 beta-converting enzyme,IL1BC,IL-1BC,Interleukin-1 beta convertase,Interleukin-1 beta-converting enzyme,p45,Pig,Sus scrofa 96T
Pathways :
WP1689: Porphyrin and chlorophyll metabolism
WP1493: Carbon assimilation C4 pathway
WP210: Cytoplasmic Ribosomal Proteins
WP2218: sGC
WP1566: Citrate cycle (TCA cycle)
WP1675: Nitrogen metabolism
WP525: Mitochondrial Unfolded-Protein Response
WP731: Sterol regulatory element binding protein related
WP1625: Base excision repair
WP1888: Post-translational protein modification
WP2359: Parkin-Ubiquitin Proteasomal System pathway
WP1685: Peptidoglycan biosynthesis
WP1690: Propanoate metabolism
WP2203: TSLP Signaling Pathway
WP1650: Fluorobenzoate degradation
WP1438: Influenza A virus infection
WP1694: Pyrimidine metabolism
WP2272: Pathogenic Escherichia coli infection
WP1657: Glycerolipid metabolism
WP232: G Protein Signaling Pathways
WP1663: Homologous recombination
WP1531: Vitamin D synthesis
WP1714: Tyrosine metabolism
WP1613: 1,4-Dichlorobenzene degradation
WP73: G Protein Signaling Pathways

Related Genes :
[psbX] Photosystem II reaction center X protein
[ndhA] NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic (EC 7.1.1.-) (NAD(P)H dehydrogenase subunit 1) (NDH subunit 1) (NADH-plastoquinone oxidoreductase subunit 1)
[KK1_045969] 40S ribosomal protein SA
[KK1_006657] Uncharacterized protein
[ndhF] NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (EC 7.1.1.-) (NADH-plastoquinone oxidoreductase subunit 5) (Fragment)
[KK1_031928] Tyrosine N-monooxygenase
[] UDP-glycosyltransferase homolog (Fragment)
[ndhA] NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic (EC 7.1.1.-) (NAD(P)H dehydrogenase subunit 1) (NDH subunit 1) (NADH-plastoquinone oxidoreductase subunit 1)
[KK1_005898] Secologanin synthase
[ndhD] NAD(P)H-quinone oxidoreductase chain 4, chloroplastic (EC 7.1.1.-) (NAD(P)H dehydrogenase, chain 4) (NADH-plastoquinone oxidoreductase chain 4)
[psbH] Photosystem II reaction center protein H (PSII-H)
[KK1_044146] Uncharacterized protein
[petB] Cytochrome b6
[ARD1] 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54) (Acireductone dioxygenase (Fe(2+)-requiring)) (ARD) (Fe-ARD)
[COB] Cytochrome b (Fragment)
[ndhF] NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (EC 7.1.1.-) (NADH-plastoquinone oxidoreductase subunit 5)
[ndhF] NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (EC 7.1.1.-) (NADH-plastoquinone oxidoreductase subunit 5) (Fragment)
[atpF] ATP synthase subunit b, chloroplastic (ATP synthase F(0) sector subunit b) (ATPase subunit I)
[malate dehydrogenase] Malate dehydrogenase
[ndhE] NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic (EC 7.1.1.-) (NAD(P)H dehydrogenase subunit 4L) (NADH-plastoquinone oxidoreductase subunit 4L)
[g.33360] 4-alpha-glucanotransferase (EC 2.4.1.25) (Amylomaltase) (Disproportionating enzyme) (Fragment)
[ndhI] NAD(P)H-quinone oxidoreductase subunit I, chloroplastic (EC 7.1.1.-) (NAD(P)H dehydrogenase subunit I) (NDH subunit I) (NADH-plastoquinone oxidoreductase subunit I)
[ndhK] NAD(P)H-quinone oxidoreductase subunit K, chloroplastic (EC 7.1.1.-) (NAD(P)H dehydrogenase subunit K) (NADH-plastoquinone oxidoreductase subunit K)
[psbA] Photosystem II protein D1 (PSII D1 protein) (EC 1.10.3.9) (Photosystem II Q(B) protein)
[LOC101502735] Lipoxygenase (EC 1.13.11.-)
[AM588_10001736] Uncharacterized protein
[ndhF] NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic (EC 7.1.1.-) (NADH-plastoquinone oxidoreductase subunit 5) (Fragment)
[LOC101491357] cytochrome P450 734A1-like isoform X1
[psbI] Photosystem II reaction center protein I (PSII-I) (PSII 4.8 kDa protein)
[petB] Cytochrome b6

Bibliography :