GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Caspase recruitment domain-containing protein 8 (Apoptotic protein NDPP1) (CARD-inhibitor of NF-kappa-B-activating ligand) (CARDINAL) (DACAR) (Tumor up-regulated CARD-containing antagonist of CASP9) (TUCAN)

 CARD8_HUMAN             Reviewed;         431 AA.
Q9Y2G2; B5KVR6; B7Z496; B7Z4A2; E9PEM7; G3XAM9; Q6PGP8; Q96P82;
20-JUN-2001, integrated into UniProtKB/Swiss-Prot.
01-NOV-1999, sequence version 1.
05-JUN-2019, entry version 172.
RecName: Full=Caspase recruitment domain-containing protein 8;
AltName: Full=Apoptotic protein NDPP1;
AltName: Full=CARD-inhibitor of NF-kappa-B-activating ligand;
Short=CARDINAL;
AltName: Full=DACAR;
AltName: Full=Tumor up-regulated CARD-containing antagonist of CASP9;
Short=TUCAN;
Name=CARD8; Synonyms=KIAA0955, NDPP1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=10231032; DOI=10.1093/dnares/6.1.63;
Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M.,
Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.;
"Prediction of the coding sequences of unidentified human genes. XIII.
The complete sequences of 100 new cDNA clones from brain which code
for large proteins in vitro.";
DNA Res. 6:63-70(1999).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND INTERACTION WITH CARD16
AND CARD18.
PubMed=11821383; DOI=10.1074/jbc.M107811200;
Razmara M., Srinivasula S.M., Wang L., Poyet J.-L., Geddes B.J.,
DiStefano P.S., Bertin J., Alnemri E.S.;
"CARD-8 protein, a new CARD family member that regulates caspase-1
activation and apoptosis.";
J. Biol. Chem. 277:13952-13958(2002).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=11956601;
Zhang H., Fu W.;
"NDPP1 is a novel CARD domain containing protein which can inhibit
apoptosis and suppress NF-kappaB activation.";
Int. J. Oncol. 20:1035-1040(2002).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Guiet C., Vito P.;
"DACAR, a novel CARD-containing protein.";
Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=11551959; DOI=10.1074/jbc.M107373200;
Bouchier-Hayes L., Conroy H., Egan H., Adrain C., Creagh E.M.,
MacFarlane M., Martin S.J.;
"CARDINAL, a novel caspase recruitment domain protein, is an inhibitor
of multiple NF-kappa B activation pathways.";
J. Biol. Chem. 276:44069-44077(2001).
[6]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), AND ALTERNATIVE SPLICING.
PubMed=18212821; DOI=10.1038/sj.ejhg.5201996;
Bagnall R.D., Roberts R.G., Mirza M.M., Torigoe T., Prescott N.J.,
Mathew C.G.;
"Novel isoforms of the CARD8 (TUCAN) gene evade a nonsense mutation.";
Eur. J. Hum. Genet. 16:619-625(2008).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Kidney;
Guo J.H., Yu L.;
Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), AND
VARIANTS VAL-68 AND ALA-99.
TISSUE=Umbilical cord blood;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057824; DOI=10.1038/nature02399;
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J.,
Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M.,
Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E.,
Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M.,
Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C.,
Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M.,
Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T.,
Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H.,
Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S.,
Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J.,
Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M.,
Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J.,
Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D.,
Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A.,
Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I.,
Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
Rubin E.M., Lucas S.M.;
"The DNA sequence and biology of human chromosome 19.";
Nature 428:529-535(2004).
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[11]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Eye;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[12]
PROTEIN SEQUENCE OF 178-198, AUTOCATALYTIC CLEAVAGE, AND MUTAGENESIS
OF GLU-135; GLU-137; HIS-147; HIS-164; GLU-173; HIS-174; SER-189;
PHE-190; SER-191 AND HIS-227.
PubMed=22087307; DOI=10.1371/journal.pone.0027396;
D'Osualdo A., Weichenberger C.X., Wagner R.N., Godzik A., Wooley J.,
Reed J.C.;
"CARD8 and NLRP1 undergo autoproteolytic processing through a ZU5-like
domain.";
PLoS ONE 6:E27396-E27396(2011).
[13]
CHARACTERIZATION.
PubMed=11408476; DOI=10.1074/jbc.M100433200;
Pathan N., Marusawa H., Krajewska M., Matsuzawa S., Kim H., Okada K.,
Torii S., Kitada S., Krajewski S., Welsh K., Pio F., Godzik A.,
Reed J.C.;
"TUCAN, an antiapoptotic caspase-associated recruitment domain family
protein overexpressed in cancer.";
J. Biol. Chem. 276:32220-32229(2001).
[14]
CHARACTERIZATION, AND MUTAGENESIS OF LEU-366.
PubMed=12067710; DOI=10.1016/S0014-5793(02)02869-7;
Stilo R., Leonardi A., Formisano L., Di Jeso B., Vito P., Liguoro D.;
"TUCAN/CARDINAL and DRAL participate in a common pathway for
modulation of NF-kappaB activation.";
FEBS Lett. 521:165-169(2002).
[15]
INTERACTION WITH NALP2, AND SUBCELLULAR LOCATION.
PubMed=15030775; DOI=10.1016/S1074-7613(04)00046-9;
Agostini L., Martinon F., Burns K., McDermott M.F., Hawkins P.N.,
Tschopp J.;
"NALP3 forms an IL-1beta-processing inflammasome with increased
activity in Muckle-Wells autoinflammatory disorder.";
Immunity 20:319-325(2004).
[16]
X-RAY CRYSTALLOGRAPHY (2.46 ANGSTROMS) OF 345-431.
PubMed=23695559; DOI=10.1107/S1744309113010075;
Jin T., Huang M., Smith P., Jiang J., Xiao T.S.;
"The structure of the CARD8 caspase-recruitment domain suggests its
association with the FIIND domain and procaspases through adjacent
surfaces.";
Acta Crystallogr. F 69:482-487(2013).
-!- FUNCTION: Inhibits NF-kappa-B activation. May participate in a
regulatory mechanism that coordinates cellular responses
controlled by NF-kappa-B transcription factor. May be a component
of the inflammasome, a protein complex which also includes PYCARD,
NALP2 and CASP1 and whose function would be the activation of
proinflammatory caspases.
-!- SUBUNIT: May form homodimers. Interacts with NEMO and DRAL. Binds
to caspase-1, CARD16/pseudo-ICE and CARD18/ICEBERG. Interacts with
FNBP3 (By similarity). Interacts with NALP2 NACHT domain.
{ECO:0000250, ECO:0000269|PubMed:11821383,
ECO:0000269|PubMed:15030775}.
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:15030775}.
Nucleus {ECO:0000269|PubMed:15030775}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1; Synonyms=Long;
IsoId=Q9Y2G2-1; Sequence=Displayed;
Name=2; Synonyms=Short;
IsoId=Q9Y2G2-2; Sequence=VSP_000782, VSP_000783;
Name=3;
IsoId=Q9Y2G2-3; Sequence=VSP_012770, VSP_012771, VSP_000782,
VSP_000783;
Name=4;
IsoId=Q9Y2G2-4; Sequence=VSP_045253, VSP_012771;
Note=No experimental confirmation available.;
Name=5; Synonyms=T60;
IsoId=Q9Y2G2-5; Sequence=VSP_012770, VSP_012771;
Note=Ref.6 (ABW96891) sequence is in conflict in position:
84:D->G. Ref.6 (ABW96891) sequence is in conflict in position:
107:E->D. {ECO:0000305};
-!- TISSUE SPECIFICITY: High expression in lung, ovary, testis and
placenta. Lower expression in heart, kidney and liver. Also
expressed in spleen, lymph node and bone marrow.
-!- SEQUENCE CAUTION:
Sequence=BAA76799.2; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology
and Haematology;
URL="http://atlasgeneticsoncology.org/Genes/CARD8ID913ch19q13.html";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AB023172; BAA76799.2; ALT_INIT; mRNA.
EMBL; AF322184; AAG50014.1; -; mRNA.
EMBL; AF331519; AAK01126.1; -; mRNA.
EMBL; AY026322; AAK08982.1; -; mRNA.
EMBL; AF405558; AAL02427.1; -; mRNA.
EMBL; EU118120; ABW96891.1; -; mRNA.
EMBL; AF511652; AAM46959.1; -; mRNA.
EMBL; AK297045; BAH12482.1; -; mRNA.
EMBL; AK297069; BAH12488.1; -; mRNA.
EMBL; AC008392; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC011466; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471177; EAW52321.1; -; Genomic_DNA.
EMBL; CH471177; EAW52323.1; -; Genomic_DNA.
EMBL; BC056891; AAH56891.1; -; mRNA.
CCDS; CCDS12712.2; -. [Q9Y2G2-4]
CCDS; CCDS54288.1; -. [Q9Y2G2-3]
CCDS; CCDS54289.1; -. [Q9Y2G2-5]
RefSeq; NP_001171829.1; NM_001184900.1. [Q9Y2G2-5]
RefSeq; NP_001171830.1; NM_001184901.1. [Q9Y2G2-4]
RefSeq; NP_001171831.1; NM_001184902.1. [Q9Y2G2-3]
RefSeq; NP_001171832.1; NM_001184903.1. [Q9Y2G2-3]
RefSeq; NP_055774.2; NM_014959.3. [Q9Y2G2-4]
RefSeq; XP_006723154.1; XM_006723091.3. [Q9Y2G2-5]
RefSeq; XP_006723155.1; XM_006723092.3. [Q9Y2G2-5]
RefSeq; XP_006723156.1; XM_006723093.3. [Q9Y2G2-5]
RefSeq; XP_006723158.1; XM_006723095.3.
RefSeq; XP_006723159.1; XM_006723096.3. [Q9Y2G2-4]
RefSeq; XP_006723160.1; XM_006723097.3. [Q9Y2G2-4]
RefSeq; XP_006723167.1; XM_006723104.3. [Q9Y2G2-1]
RefSeq; XP_006723169.1; XM_006723106.3. [Q9Y2G2-3]
RefSeq; XP_006723172.1; XM_006723109.3. [Q9Y2G2-2]
RefSeq; XP_011524943.1; XM_011526641.2. [Q9Y2G2-5]
RefSeq; XP_011524944.1; XM_011526642.2.
RefSeq; XP_011524945.1; XM_011526643.2. [Q9Y2G2-5]
RefSeq; XP_011524946.1; XM_011526644.2. [Q9Y2G2-5]
RefSeq; XP_011524952.1; XM_011526650.2. [Q9Y2G2-3]
RefSeq; XP_016881972.1; XM_017026483.1. [Q9Y2G2-4]
RefSeq; XP_016881979.1; XM_017026490.1.
RefSeq; XP_016881987.1; XM_017026498.1. [Q9Y2G2-2]
PDB; 4IKM; X-ray; 2.46 A; A=345-431.
PDBsum; 4IKM; -.
SMR; Q9Y2G2; -.
BioGrid; 116564; 45.
CORUM; Q9Y2G2; -.
IntAct; Q9Y2G2; 4.
MINT; Q9Y2G2; -.
STRING; 9606.ENSP00000375767; -.
MEROPS; S79.001; -.
iPTMnet; Q9Y2G2; -.
PhosphoSitePlus; Q9Y2G2; -.
BioMuta; CARD8; -.
DMDM; 14424229; -.
EPD; Q9Y2G2; -.
jPOST; Q9Y2G2; -.
PaxDb; Q9Y2G2; -.
PeptideAtlas; Q9Y2G2; -.
PRIDE; Q9Y2G2; -.
ProteomicsDB; 85761; -.
ProteomicsDB; 85762; -. [Q9Y2G2-2]
ProteomicsDB; 85763; -. [Q9Y2G2-3]
Ensembl; ENST00000391898; ENSP00000375767; ENSG00000105483. [Q9Y2G2-5]
Ensembl; ENST00000447740; ENSP00000391248; ENSG00000105483. [Q9Y2G2-4]
Ensembl; ENST00000519940; ENSP00000428883; ENSG00000105483. [Q9Y2G2-5]
Ensembl; ENST00000520015; ENSP00000430747; ENSG00000105483. [Q9Y2G2-3]
Ensembl; ENST00000520153; ENSP00000428736; ENSG00000105483. [Q9Y2G2-4]
Ensembl; ENST00000520753; ENSP00000429839; ENSG00000105483. [Q9Y2G2-3]
Ensembl; ENST00000521613; ENSP00000427858; ENSG00000105483. [Q9Y2G2-4]
Ensembl; ENST00000651546; ENSP00000499211; ENSG00000105483. [Q9Y2G2-5]
GeneID; 22900; -.
KEGG; hsa:22900; -.
UCSC; uc002pih.5; human. [Q9Y2G2-1]
CTD; 22900; -.
DisGeNET; 22900; -.
GeneCards; CARD8; -.
H-InvDB; HIX0020041; -.
HGNC; HGNC:17057; CARD8.
HPA; HPA042071; -.
HPA; HPA043513; -.
MIM; 609051; gene.
neXtProt; NX_Q9Y2G2; -.
OpenTargets; ENSG00000105483; -.
PharmGKB; PA134916154; -.
eggNOG; KOG3573; Eukaryota.
eggNOG; ENOG410ZQIE; LUCA.
GeneTree; ENSGT00830000128447; -.
HOGENOM; HOG000082406; -.
InParanoid; Q9Y2G2; -.
KO; K12801; -.
OMA; DPYLMSY; -.
OrthoDB; 559093at2759; -.
PhylomeDB; Q9Y2G2; -.
TreeFam; TF352798; -.
Reactome; R-HSA-111458; Formation of apoptosome.
Reactome; R-HSA-9627069; Regulation of the apoptosome activity.
SIGNOR; Q9Y2G2; -.
ChiTaRS; CARD8; human.
GeneWiki; CARD8; -.
GenomeRNAi; 22900; -.
PRO; PR:Q9Y2G2; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000105483; Expressed in 205 organ(s), highest expression level in spleen.
ExpressionAtlas; Q9Y2G2; baseline and differential.
Genevisible; Q9Y2G2; HS.
GO; GO:0005737; C:cytoplasm; IDA:HGNC.
GO; GO:0005829; C:cytosol; IDA:HPA.
GO; GO:0061702; C:inflammasome complex; IBA:GO_Central.
GO; GO:0072559; C:NLRP3 inflammasome complex; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0005634; C:nucleus; IDA:HGNC.
GO; GO:0032991; C:protein-containing complex; IDA:UniProtKB.
GO; GO:0050700; F:CARD domain binding; IPI:UniProtKB.
GO; GO:0008656; F:cysteine-type endopeptidase activator activity involved in apoptotic process; IDA:HGNC.
GO; GO:0032089; F:NACHT domain binding; IPI:HGNC.
GO; GO:0042803; F:protein homodimerization activity; IDA:HGNC.
GO; GO:0006919; P:activation of cysteine-type endopeptidase activity involved in apoptotic process; IBA:GO_Central.
GO; GO:0097340; P:inhibition of cysteine-type endopeptidase activity; IDA:UniProtKB.
GO; GO:0043124; P:negative regulation of I-kappaB kinase/NF-kappaB signaling; IDA:HGNC.
GO; GO:0050713; P:negative regulation of interleukin-1 beta secretion; IDA:UniProtKB.
GO; GO:0031665; P:negative regulation of lipopolysaccharide-mediated signaling pathway; IDA:UniProtKB.
GO; GO:0032088; P:negative regulation of NF-kappaB transcription factor activity; IMP:UniProtKB.
GO; GO:0010804; P:negative regulation of tumor necrosis factor-mediated signaling pathway; IMP:UniProtKB.
GO; GO:0043280; P:positive regulation of cysteine-type endopeptidase activity involved in apoptotic process; IDA:UniProtKB.
GO; GO:0050718; P:positive regulation of interleukin-1 beta secretion; IDA:HGNC.
InterPro; IPR001315; CARD.
InterPro; IPR011029; DEATH-like_dom_sf.
InterPro; IPR025307; FIIND_dom.
Pfam; PF00619; CARD; 1.
Pfam; PF13553; FIIND; 1.
SUPFAM; SSF47986; SSF47986; 1.
PROSITE; PS50209; CARD; 1.
PROSITE; PS51830; FIIND; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Apoptosis; Complete proteome;
Cytoplasm; Direct protein sequencing; Nucleus; Polymorphism;
Reference proteome.
CHAIN 1 431 Caspase recruitment domain-containing
protein 8.
/FTId=PRO_0000144080.
DOMAIN 56 340 FIIND. {ECO:0000255|PROSITE-
ProRule:PRU01174}.
DOMAIN 340 430 CARD. {ECO:0000255|PROSITE-
ProRule:PRU00046}.
SITE 190 191 Cleavage; by autolysis.
{ECO:0000255|PROSITE-ProRule:PRU01174,
ECO:0000269|PubMed:22087307}.
VAR_SEQ 1 25 MMRQRQSHYCSVLFLSVNYLGGTFP -> MEKKECPEKSSS
SEEELPRRDSGSSRNIDASKLIRLQGSRKLLVDNSIRELQY
TKTGIFFQAEACVTNDTVYRELPCVSETLCDISHFFQEDDE
TEAEPLLFRAVPECQLSGGDIPSVSEEQESSEGQDS (in
isoform 3 and isoform 5).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:18212821}.
/FTId=VSP_012770.
VAR_SEQ 1 25 MMRQRQSHYCSVLFLSVNYLGGTFP -> MEKKECPEKSSS
SEEELPRRVYRELPCVSETLCDISHFFQEDDETEAEPLLFR
AVPECQLSGGDIPSVSEEQESSEGQDS (in isoform
4). {ECO:0000303|PubMed:14702039}.
/FTId=VSP_045253.
VAR_SEQ 152 152 Q -> QA (in isoform 3, isoform 4 and
isoform 5). {ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:18212821}.
/FTId=VSP_012771.
VAR_SEQ 282 286 ELKLS -> WISSL (in isoform 2 and isoform
3). {ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334,
ECO:0000303|Ref.7}.
/FTId=VSP_000782.
VAR_SEQ 287 431 Missing (in isoform 2 and isoform 3).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334,
ECO:0000303|Ref.7}.
/FTId=VSP_000783.
VARIANT 68 68 I -> V (in dbSNP:rs11881179).
{ECO:0000269|PubMed:14702039}.
/FTId=VAR_048606.
VARIANT 99 99 E -> A (in dbSNP:rs59878320).
{ECO:0000269|PubMed:14702039}.
/FTId=VAR_061079.
MUTAGEN 135 135 E->A: No effect on autocatalytic
cleavage. {ECO:0000269|PubMed:22087307}.
MUTAGEN 137 137 E->A: No effect on autocatalytic
cleavage. {ECO:0000269|PubMed:22087307}.
MUTAGEN 147 147 H->A: Severe loss of autocatalytic
cleavage. {ECO:0000269|PubMed:22087307}.
MUTAGEN 164 164 H->A: Severe loss of autocatalytic
cleavage. {ECO:0000269|PubMed:22087307}.
MUTAGEN 173 173 E->A: Partial loss of autocatalytic
cleavage. {ECO:0000269|PubMed:22087307}.
MUTAGEN 174 174 H->A: No effect on autocatalytic
cleavage. {ECO:0000269|PubMed:22087307}.
MUTAGEN 189 189 S->A: Partial loss of autocatalytic
cleavage. {ECO:0000269|PubMed:22087307}.
MUTAGEN 189 189 S->Q: No effect on autocatalytic
cleavage. {ECO:0000269|PubMed:22087307}.
MUTAGEN 190 190 F->H: Severe loss of autocatalytic
cleavage. {ECO:0000269|PubMed:22087307}.
MUTAGEN 191 191 S->A: Complete loss of autocatalytic
cleavage. {ECO:0000269|PubMed:22087307}.
MUTAGEN 227 227 H->A: No effect on autocatalytic
cleavage. {ECO:0000269|PubMed:22087307}.
MUTAGEN 366 366 L->R: Inhibits homodimer formation.
{ECO:0000269|PubMed:12067710}.
CONFLICT 60 60 E -> G (in Ref. 5; AAL02427).
{ECO:0000305}.
CONFLICT 148 148 F -> S (in Ref. 11; AAH56891).
{ECO:0000305}.
CONFLICT 219 219 P -> R (in Ref. 8; BAH12488).
{ECO:0000305}.
CONFLICT 326 326 V -> M (in Ref. 5; AAL02427).
{ECO:0000305}.
CONFLICT 417 417 E -> G (in Ref. 6; ABW96891).
{ECO:0000305}.
CONFLICT 422 422 L -> P (in Ref. 5; AAL02427).
{ECO:0000305}.
HELIX 345 350 {ECO:0000244|PDB:4IKM}.
HELIX 352 358 {ECO:0000244|PDB:4IKM}.
HELIX 363 371 {ECO:0000244|PDB:4IKM}.
HELIX 377 385 {ECO:0000244|PDB:4IKM}.
STRAND 386 388 {ECO:0000244|PDB:4IKM}.
HELIX 389 401 {ECO:0000244|PDB:4IKM}.
HELIX 405 418 {ECO:0000244|PDB:4IKM}.
HELIX 420 424 {ECO:0000244|PDB:4IKM}.
HELIX 427 431 {ECO:0000244|PDB:4IKM}.
SEQUENCE 431 AA; 48933 MW; CB54D130807732E6 CRC64;
MMRQRQSHYC SVLFLSVNYL GGTFPGDICS EENQIVSSYA SKVCFEIEED YKNRQFLGPE
GNVDVELIDK STNRYSVWFP TAGWYLWSAT GLGFLVRDEV TVTIAFGSWS QHLALDLQHH
EQWLVGGPLF DVTAEPEEAV AEIHLPHFIS LQGEVDVSWF LVAHFKNEGM VLEHPARVEP
FYAVLESPSF SLMGILLRIA SGTRLSIPIT SNTLIYYHPH PEDIKFHLYL VPSDALLTKA
IDDEEDRFHG VRLQTSPPME PLNFGSSYIV SNSANLKVMP KELKLSYRSP GEIQHFSKFY
AGQMKEPIQL EITEKRHGTL VWDTEVKPVD LQLVAASAPP PFSGAAFVKE NHRQLQARMG
DLKGVLDDLQ DNEVLTENEK ELVEQEKTRQ SKNEALLSMV EKKGDLALDV LFRSISERDP
YLVSYLRQQN L


Related products :

Catalog number Product name Quantity
18-661-15159 Caspase recruitment domain-containing protein 8 - Apoptotic protein NDPP1; DACAR; CARD-inhibitor of NF-kappa-B-activating ligand; CARDINAL; Tumor-up-regulated CARD-containing antagonist of CASP9; TUCA 0.1 mg
EIAAB05323 Apoptotic protein NDPP1,CARD8,CARDINAL,CARD-inhibitor of NF-kappa-B-activating ligand,Caspase recruitment domain-containing protein 8,DACAR,Homo sapiens,Human,KIAA0955,NDPP1,TUCAN,Tumor up-regulated C
U1535h CLIA CARD, LRR, and NACHT-containing protein,CARD12,Caspase recruitment domain-containing protein 12,CLAN,Clan protein,CLAN1,Homo sapiens,Human,Ice protease-activating factor,Ipaf,IPAF,NLR family CARD 96T
18-661-15095 Apoptosis-associated speck-like protein containing a CARD - hASC; PYD and CARD domain-containing protein; Target of methylation-induced silencing 1; Caspase recruitment domain-containing protein 5 Pol 0.1 mg
18-661-15141 Caspase recruitment domain-containing protein 12 - Ice protease-activating factor; Ipaf; CARD. LRR. and NACHT-containing protein; Clan protein Polyclonal 0.1 mg
18-003-42864 Caspase recruitment domain-containing protein 12 - Ice protease-activating factor; Ipaf; CARD. LRR. and NACHT-containing protein; Clan protein Polyclonal 0.05 mg Aff Pur
18-001-30061 Caspase recruitment domain-containing protein 12 - Ice protease-activating factor; Ipaf; CARD. LRR. and NACHT-containing protein; Clan protein Polyclonal 0.1 mg
EIAAB05319 CARD only domain-containing protein 1,CARD16,Caspase recruitment domain-containing protein 16,Caspase-1 inhibitor COP,COP,COP1,Homo sapiens,Human,Pseudo interleukin-1 beta converting enzyme,Pseudo-ICE
E1535h ELISA CARD, LRR, and NACHT-containing protein,CARD12,Caspase recruitment domain-containing protein 12,CLAN,Clan protein,CLAN1,Homo sapiens,Human,Ice protease-activating factor,Ipaf,IPAF,NLR family CAR 96T
E1535h ELISA kit CARD, LRR, and NACHT-containing protein,CARD12,Caspase recruitment domain-containing protein 12,CLAN,Clan protein,CLAN1,Homo sapiens,Human,Ice protease-activating factor,Ipaf,IPAF,NLR famil 96T
10-288-21980F Caspase recruitment domain-containing protein 14 - CARD-containing MAGUK protein 2; Carma 2 0.1 mg
10-288-21980F Caspase recruitment domain-containing protein 14 - CARD-containing MAGUK protein 2; Carma 2 0.05 mg
15-288-21980A Caspase recruitment domain-containing protein 14 - CARD-containing MAGUK protein 2; Carma 2 Polyclonal 0.05 mg
15-288-21980B Caspase recruitment domain-containing protein 14 - CARD-containing MAGUK protein 2; Carma 2 Polyclonal 0.05 mg
15-288-21980A Caspase recruitment domain-containing protein 14 - CARD-containing MAGUK protein 2; Carma 2 Polyclonal 0.1 mg
18-661-15160 Caspase recruitment domain-containing protein 11 - CARD-containing MAGUK protein 3; Carma 1 Polyclonal 0.1 mg
15-288-21980B Caspase recruitment domain-containing protein 14 - CARD-containing MAGUK protein 2; Carma 2 Polyclonal 0.1 mg
EIAAB05313 CARD10,CARD-containing MAGUK protein 3,Carma 3,CARMA3,Caspase recruitment domain-containing protein 10,Homo sapiens,Human
EIAAB05316 CARD11,CARD-containing MAGUK protein 1,Carma 1,CARMA1,Caspase recruitment domain-containing protein 11,Homo sapiens,Human
EIAAB05318 CARD14,CARD-containing MAGUK protein 2,Carma 2,CARMA2,Caspase recruitment domain-containing protein 14,Homo sapiens,Human
32-115 B-cell CLL_lymphoma 10, also known as CLAP, Me10, CIPER, c-E10, CARMEN. Entrez Protein NP_003912. It is a protein containing a caspase recruitment domain (CARD). It plays an important role in apoptosi 0.1 mg
EIAAB05320 CARD17,Caspase recruitment domain-containing protein 17,Caspase-1 inhibitor INCA,Homo sapiens,Human,INCA,Inhibitory caspase recruitment domain protein
E0627h ELISA APAF-3,Apoptotic protease Mch-6,Apoptotic protease-activating factor 3,CASP9,CASP-9,Caspase-9,Homo sapiens,Human,ICE-LAP6,ICE-like apoptotic protease 6,MCH6 96T
U0627h CLIA APAF-3,Apoptotic protease Mch-6,Apoptotic protease-activating factor 3,CASP9,CASP-9,Caspase-9,Homo sapiens,Human,ICE-LAP6,ICE-like apoptotic protease 6,MCH6 96T
E0627h ELISA kit APAF-3,Apoptotic protease Mch-6,Apoptotic protease-activating factor 3,CASP9,CASP-9,Caspase-9,Homo sapiens,Human,ICE-LAP6,ICE-like apoptotic protease 6,MCH6 96T
Pathways :
WP1689: Porphyrin and chlorophyll metabolism
WP2371: Parkinsons Disease Pathway
WP1714: Tyrosine metabolism
WP1661: Glyoxylate and dicarboxylate metabolism
WP210: Cytoplasmic Ribosomal Proteins
WP73: G Protein Signaling Pathways
WP1672: Mismatch repair
WP1613: 1,4-Dichlorobenzene degradation
WP1909: Signal regulatory protein (SIRP) family interactions
WP1049: G Protein Signaling Pathways
WP1676: Non-homologous end-joining
WP2218: sGC
WP1256: NLR proteins
WP1625: Base excision repair
WP1654: gamma-Hexachlorocyclohexane degradation
WP2032: TSH signaling pathway
WP346: Protein Modifications
WP1438: Influenza A virus infection
WP1693: Purine metabolism
WP2292: Chemokine signaling pathway
WP914: NLR proteins
WP1502: Mitochondrial biogenesis
WP1713: Two-component system
WP2355: Corticotropin-releasing hormone
WP813: G Protein Signaling Pathways

Related Genes :
[CARD16 COP COP1] Caspase recruitment domain-containing protein 16 (Caspase recruitment domain-only protein 1) (CARD-only protein 1) (Caspase-1 inhibitor COP) (Pseudo interleukin-1 beta converting enzyme) (Pseudo-ICE) (Pseudo-IL1B-converting enzyme)
[BCL10 CIPER CLAP] B-cell lymphoma/leukemia 10 (B-cell CLL/lymphoma 10) (Bcl-10) (CARD-containing molecule enhancing NF-kappa-B) (CARD-like apoptotic protein) (hCLAP) (CED-3/ICH-1 prodomain homologous E10-like regulator) (CIPER) (Cellular homolog of vCARMEN) (cCARMEN) (Cellular-E10) (c-E10) (Mammalian CARD-containing adapter molecule E10) (mE10)
[PYCARD ASC CARD5 TMS1] Apoptosis-associated speck-like protein containing a CARD (hASC) (Caspase recruitment domain-containing protein 5) (PYD and CARD domain-containing protein) (Target of methylation-induced silencing 1)
[NLRC4 CARD12 CLAN CLAN1 IPAF UNQ6189/PRO20215] NLR family CARD domain-containing protein 4 (CARD, LRR, and NACHT-containing protein) (Clan protein) (Caspase recruitment domain-containing protein 12) (Ice protease-activating factor) (Ipaf)
[NOD2 CARD15 IBD1] Nucleotide-binding oligomerization domain-containing protein 2 (Caspase recruitment domain-containing protein 15) (Inflammatory bowel disease protein 1)
[Nlrc4 Card12 Ipaf] NLR family CARD domain-containing protein 4 (Caspase recruitment domain-containing protein 12) (Ice protease-activating factor) (Ipaf)
[CARD14 CARMA2] Caspase recruitment domain-containing protein 14 (CARD-containing MAGUK protein 2) (Carma 2)
[CARD9] Caspase recruitment domain-containing protein 9 (hCARD9)
[MAVS IPS1 KIAA1271 VISA] Mitochondrial antiviral-signaling protein (MAVS) (CARD adapter inducing interferon beta) (Cardif) (Interferon beta promoter stimulator protein 1) (IPS-1) (Putative NF-kappa-B-activating protein 031N) (Virus-induced-signaling adapter) (VISA)
[NLRP1 CARD7 DEFCAP KIAA0926 NAC NALP1] NACHT, LRR and PYD domains-containing protein 1 (Caspase recruitment domain-containing protein 7) (Death effector filament-forming ced-4-like apoptosis protein) (Nucleotide-binding domain and caspase recruitment domain)
[CARD11 CARMA1] Caspase recruitment domain-containing protein 11 (CARD-containing MAGUK protein 1) (Carma 1)
[IKBKB IKKB] Inhibitor of nuclear factor kappa-B kinase subunit beta (I-kappa-B-kinase beta) (IKK-B) (IKK-beta) (IkBKB) (EC 2.7.11.10) (I-kappa-B kinase 2) (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB)
[CASP8 MCH5] Caspase-8 (CASP-8) (EC 3.4.22.61) (Apoptotic cysteine protease) (Apoptotic protease Mch-5) (CAP4) (FADD-homologous ICE/ced-3-like protease) (FADD-like ICE) (FLICE) (ICE-like apoptotic protease 5) (MORT1-associated ced-3 homolog) (MACH) [Cleaved into: Caspase-8 subunit p18; Caspase-8 subunit p10]
[Card11] Caspase recruitment domain-containing protein 11
[IKBKG FIP3 NEMO] NF-kappa-B essential modulator (NEMO) (FIP-3) (IkB kinase-associated protein 1) (IKKAP1) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)
[BIRC2 API1 MIHB RNF48] Baculoviral IAP repeat-containing protein 2 (EC 2.3.2.27) (Cellular inhibitor of apoptosis 1) (C-IAP1) (IAP homolog B) (Inhibitor of apoptosis protein 2) (hIAP-2) (hIAP2) (RING finger protein 48) (RING-type E3 ubiquitin transferase BIRC2) (TNFR2-TRAF-signaling complex protein 2)
[Ikbkb Ikkb] Inhibitor of nuclear factor kappa-B kinase subunit beta (I-kappa-B-kinase beta) (IKK-B) (IKK-beta) (IkBKB) (EC 2.7.11.10) (I-kappa-B kinase 2) (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB)
[BIRC3 API2 MIHC RNF49] Baculoviral IAP repeat-containing protein 3 (EC 2.3.2.27) (Apoptosis inhibitor 2) (API2) (Cellular inhibitor of apoptosis 2) (C-IAP2) (IAP homolog C) (Inhibitor of apoptosis protein 1) (hIAP-1) (hIAP1) (RING finger protein 49) (RING-type E3 ubiquitin transferase BIRC3) (TNFR2-TRAF-signaling complex protein 1)
[Pycard Asc] Apoptosis-associated speck-like protein containing a CARD (mASC) (PYD and CARD domain-containing protein)
[CARD10 CARMA3] Caspase recruitment domain-containing protein 10 (CARD-containing MAGUK protein 3) (Carma 3)
[Birc2] Baculoviral IAP repeat-containing protein 2 (EC 2.3.2.27) (Cellular inhibitor of apoptosis 1) (C-IAP1) (Inhibitor of apoptosis protein 2) (mIAP2) (RING-type E3 ubiquitin transferase BIRC2)
[TICAM1 PRVTIRB TRIF] TIR domain-containing adapter molecule 1 (TICAM-1) (Proline-rich, vinculin and TIR domain-containing protein B) (Putative NF-kappa-B-activating protein 502H) (Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta) (MyD88-3) (TIR domain-containing adapter protein inducing IFN-beta)
[CHUK IKKA TCF16] Inhibitor of nuclear factor kappa-B kinase subunit alpha (I-kappa-B kinase alpha) (IKK-A) (IKK-alpha) (IkBKA) (IkappaB kinase) (EC 2.7.11.10) (Conserved helix-loop-helix ubiquitous kinase) (I-kappa-B kinase 1) (IKK1) (Nuclear factor NF-kappa-B inhibitor kinase alpha) (NFKBIKA) (Transcription factor 16) (TCF-16)
[RIPK2 CARDIAK RICK RIP2 UNQ277/PRO314/PRO34092] Receptor-interacting serine/threonine-protein kinase 2 (EC 2.7.11.1) (CARD-containing interleukin-1 beta-converting enzyme-associated kinase) (CARD-containing IL-1 beta ICE-kinase) (RIP-like-interacting CLARP kinase) (Receptor-interacting protein 2) (RIP-2) (Tyrosine-protein kinase RIPK2) (EC 2.7.10.2)
[Ikbkb Ikkb] Inhibitor of nuclear factor kappa-B kinase subunit beta (I-kappa-B-kinase beta) (IKK-B) (IKK-beta) (IkBKB) (EC 2.7.11.10) (I-kappa-B kinase 2) (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB)
[TNIP2 ABIN2 FLIP1] TNFAIP3-interacting protein 2 (A20-binding inhibitor of NF-kappa-B activation 2) (ABIN-2) (Fetal liver LKB1-interacting protein)
[Ikbkg Nemo] NF-kappa-B essential modulator (NEMO) (IkB kinase-associated protein 1) (IKKAP1) (mFIP-3) (Inhibitor of nuclear factor kappa-B kinase subunit gamma) (I-kappa-B kinase subunit gamma) (IKK-gamma) (IKKG) (IkB kinase subunit gamma) (NF-kappa-B essential modifier)
[NFKBIA IKBA MAD3 NFKBI] NF-kappa-B inhibitor alpha (I-kappa-B-alpha) (IkB-alpha) (IkappaBalpha) (Major histocompatibility complex enhancer-binding protein MAD3)
[IKBKB] Inhibitor of nuclear factor kappa-B kinase subunit beta (I-kappa-B-kinase beta) (IKK-B) (IKK-beta) (IkBKB) (EC 2.7.11.10) (I-kappa-B kinase 2) (IKK2) (Nuclear factor NF-kappa-B inhibitor kinase beta) (NFKBIKB)
[NOL3 ARC NOP] Nucleolar protein 3 (Apoptosis repressor with CARD) (Muscle-enriched cytoplasmic protein) (Myp) (Nucleolar protein of 30 kDa) (Nop30)

Bibliography :