GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Caspase-2 (CASP-2) (EC 3.4.22.55) (Neural precursor cell expressed developmentally down-regulated protein 2) (NEDD-2) (Protease ICH-1) [Cleaved into: Caspase-2 subunit p18; Caspase-2 subunit p13; Caspase-2 subunit p12]

 CASP2_HUMAN             Reviewed;         452 AA.
P42575; A8K5F9; D3DXD6; E9PDN0; P42576; Q59F21; Q7KZL6; Q86UJ3;
Q9BUP7; Q9BZK9; Q9BZL0;
01-NOV-1995, integrated into UniProtKB/Swiss-Prot.
06-DEC-2005, sequence version 2.
13-FEB-2019, entry version 196.
RecName: Full=Caspase-2;
Short=CASP-2;
EC=3.4.22.55;
AltName: Full=Neural precursor cell expressed developmentally down-regulated protein 2;
Short=NEDD-2;
AltName: Full=Protease ICH-1;
Contains:
RecName: Full=Caspase-2 subunit p18;
Contains:
RecName: Full=Caspase-2 subunit p13;
Contains:
RecName: Full=Caspase-2 subunit p12;
Flags: Precursor;
Name=CASP2; Synonyms=ICH1, NEDD2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND NUCLEOTIDE SEQUENCE [MRNA]
OF 14-452 (ISOFORM 1).
TISSUE=Fetal brain;
PubMed=8087842; DOI=10.1016/S0092-8674(94)90422-7;
Wang L., Miura M., Bergeron L., Zhu H., Yuan J.;
"Ich-1, an Ice/ced-3-related gene, encodes both positive and negative
regulators of programmed cell death.";
Cell 78:739-750(1994).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [MRNA] OF
32-108 (ISOFORMS 1/2), AND ALTERNATIVE SPLICING.
PubMed=11156409;
Droin N., Beauchemin M., Solary E., Bertrand R.;
"Identification of a caspase-2 isoform that behaves as an endogenous
inhibitor of the caspase cascade.";
Cancer Res. 60:7039-7047(2000).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Halleck A., Ebert L., Mkoundinya M., Schick M., Eisenstein S.,
Neubert P., Kstrang K., Schatten R., Shen B., Henze S., Mar W.,
Korn B., Zuo D., Hu Y., LaBaer J.;
"Cloning of human full open reading frames in Gateway(TM) system entry
vector (pDONR201).";
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS LEU-172; ALA-178 AND
GLY-441.
NIEHS SNPs program;
Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12853948; DOI=10.1038/nature01782;
Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H.,
Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R.,
Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E.,
Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Cordes M., Du H.,
Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A.,
Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J.,
Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A.,
Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S.,
Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M.,
Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C.,
Latreille P., Miller N., Johnson D., Murray J., Woessner J.P.,
Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J.,
Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L.,
Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R.,
Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E.,
Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K.,
Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S.,
Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M.,
Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R.,
Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D.,
Waterston R.H., Wilson R.K.;
"The DNA sequence of human chromosome 7.";
Nature 424:157-164(2003).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
LEU-172.
TISSUE=Skin;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 18-452 (ISOFORM 1), AND
VARIANT LEU-172.
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 194-452.
TISSUE=Spleen;
Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.,
Ohara O., Nagase T., Kikuno R.F.;
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases.
[11]
CLEAVAGE SITES.
PubMed=8654923; DOI=10.1101/gad.10.9.1073;
Xue D., Shaham S., Horvitz H.R.;
"The Caenorhabditis elegans cell-death protein CED-3 is a cysteine
protease with substrate specificities similar to those of the human
CPP32 protease.";
Genes Dev. 10:1073-1083(1996).
[12]
INTERACTION WITH CRADD.
PubMed=9044836;
Ahmad M., Srinivasula S.M., Wang L., Talanian R.V., Litwack G.,
Fernandes-Alnemri T., Alnemri E.S.;
"CRADD, a novel human apoptotic adaptor molecule for caspase-2, and
FasL/tumor necrosis factor receptor-interacting protein RIP.";
Cancer Res. 57:615-619(1997).
[13]
INTERACTION WITH CRADD, DOMAIN, AND MUTAGENESIS OF LEU-57; GLY-95;
PHE-99; ASP-100; PHE-102; GLU-104 AND LEU-106.
PubMed=8985253; DOI=10.1038/385086a0;
Duan H., Dixit V.M.;
"RAIDD is a new 'death' adaptor molecule.";
Nature 385:86-89(1997).
[14]
INTERACTION WITH NOL3.
PubMed=9560245; DOI=10.1073/pnas.95.9.5156;
Koseki T., Inohara N., Chen S., Nunez G.;
"ARC, an inhibitor of apoptosis expressed in skeletal muscle and heart
that interacts selectively with caspases.";
Proc. Natl. Acad. Sci. U.S.A. 95:5156-5160(1998).
[15]
FUNCTION, AND IDENTIFICATION IN PIDDOSOME COMPLEX.
PubMed=15073321; DOI=10.1126/science.1095432;
Tinel A., Tschopp J.;
"The PIDDosome, a protein complex implicated in activation of caspase-
2 in response to genotoxic stress.";
Science 304:843-846(2004).
[16]
INTERACTION WITH PIDD1.
PubMed=16652156; DOI=10.1038/sj.onc.1209569;
Vakifahmetoglu H., Olsson M., Orrenius S., Zhivotovsky B.;
"Functional connection between p53 and caspase-2 is essential for
apoptosis induced by DNA damage.";
Oncogene 25:5683-5692(2006).
[17]
ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, CLEAVAGE OF INITIATOR
METHIONINE [LARGE SCALE ANALYSIS], AND IDENTIFICATION BY MASS
SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19413330; DOI=10.1021/ac9004309;
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,
Mohammed S.;
"Lys-N and trypsin cover complementary parts of the phosphoproteome in
a refined SCX-based approach.";
Anal. Chem. 81:4493-4501(2009).
[18]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[19]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-340, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21406692; DOI=10.1126/scisignal.2001570;
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J.,
Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V.,
Blagoev B.;
"System-wide temporal characterization of the proteome and
phosphoproteome of human embryonic stem cell differentiation.";
Sci. Signal. 4:RS3-RS3(2011).
[20]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-157, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[21]
X-RAY CRYSTALLOGRAPHY (1.65 ANGSTROMS) OF 167-452 IN COMPLEX WITH
INHIBITOR, SUBUNIT, AND DISULFIDE BOND.
PubMed=12920126; DOI=10.1074/jbc.M304895200;
Schweizer A., Briand C., Grutter M.G.;
"Crystal structure of caspase-2, apical initiator of the intrinsic
apoptotic pathway.";
J. Biol. Chem. 278:42441-42447(2003).
-!- FUNCTION: Involved in the activation cascade of caspases
responsible for apoptosis execution. Might function by either
activating some proteins required for cell death or inactivating
proteins necessary for cell survival (PubMed:15073321). Associates
with PIDD1 and CRADD to form the PIDDosome, a complex that
activates CASP2 and triggers apoptosis in response to genotoxic
stress (PubMed:15073321). {ECO:0000269|PubMed:15073321}.
-!- CATALYTIC ACTIVITY:
Reaction=Strict requirement for an Asp residue at P1, with 316-asp
being essential for proteolytic activity and has a preferred
cleavage sequence of Val-Asp-Val-Ala-Asp-|-.; EC=3.4.22.55;
-!- SUBUNIT: Heterotetramer that consists of two anti-parallel
arranged heterodimers, each one formed by a p18 subunit and a p12
subunit (PubMed:12920126). Forms a complex named the PIDDosome
with PIDD1 and CRADD (PubMed:9044836, PubMed:8985253,
PubMed:15073321, PubMed:16652156). Interacts with NOL3 (via CARD
domain); inhibits CASP2 activity in a phosphorylation-dependent
manner (PubMed:9560245). {ECO:0000269|PubMed:12920126,
ECO:0000269|PubMed:15073321, ECO:0000269|PubMed:16652156,
ECO:0000269|PubMed:8985253, ECO:0000269|PubMed:9044836,
ECO:0000269|PubMed:9560245}.
-!- INTERACTION:
Self; NbExp=7; IntAct=EBI-520342, EBI-520342;
P42575-1:CASP2; NbExp=2; IntAct=EBI-520342, EBI-520357;
P78560:CRADD; NbExp=16; IntAct=EBI-520342, EBI-520375;
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Comment=Isoforms differ in the N- and C-termini.;
Name=1; Synonyms=ICH-1L;
IsoId=P42575-1; Sequence=Displayed;
Note=Acts as a positive regulator of apoptosis.;
Name=2; Synonyms=ICH-1S;
IsoId=P42575-2; Sequence=VSP_000801, VSP_000802;
Note=Acts as a negative regulator of apoptosis.;
Name=3; Synonyms=Casp-2L-Pro;
IsoId=P42575-3; Sequence=VSP_046280, VSP_046281, VSP_046282;
Note=May function as an endogenous apoptosis inhibitor that
antagonizes caspase activation and cell death.;
-!- TISSUE SPECIFICITY: Expressed at higher levels in the embryonic
lung, liver and kidney than in the heart and brain. In adults,
higher level expression is seen in the placenta, lung, kidney, and
pancreas than in the heart, brain, liver and skeletal muscle.
-!- DOMAIN: The CARD domain mediates a direct interaction with CRADD.
{ECO:0000269|PubMed:8985253}.
-!- PTM: The mature protease can process its own propeptide, but not
that of other caspases. {ECO:0000269|PubMed:8654923}.
-!- SIMILARITY: Belongs to the peptidase C14A family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAA58959.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=AAO25653.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=AAP22346.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=AAP22349.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=BAD92877.1; Type=Erroneous initiation; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=NIEHS-SNPs;
URL="http://egp.gs.washington.edu/data/casp2/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; U13021; AAA58959.1; ALT_INIT; mRNA.
EMBL; U13022; AAA58960.1; -; mRNA.
EMBL; AF314174; AAK00299.1; -; mRNA.
EMBL; AF314175; AAK00300.1; -; mRNA.
EMBL; CR541748; CAG46548.1; -; mRNA.
EMBL; AK291274; BAF83963.1; -; mRNA.
EMBL; AY219042; AAO25653.1; ALT_INIT; Genomic_DNA.
EMBL; AC073342; AAP22346.1; ALT_INIT; Genomic_DNA.
EMBL; AC073342; AAP22347.1; -; Genomic_DNA.
EMBL; AC073342; AAP22348.1; -; Genomic_DNA.
EMBL; AC073342; AAP22349.1; ALT_INIT; Genomic_DNA.
EMBL; CH471198; EAW51863.1; -; Genomic_DNA.
EMBL; CH471198; EAW51867.1; -; Genomic_DNA.
EMBL; CH471198; EAW51870.1; -; Genomic_DNA.
EMBL; BC002427; AAH02427.2; -; mRNA.
EMBL; BT007240; AAP35904.1; -; mRNA.
EMBL; AB209640; BAD92877.1; ALT_INIT; mRNA.
CCDS; CCDS5879.1; -. [P42575-1]
PIR; A54821; A54821.
RefSeq; NP_001215.1; NM_001224.4.
RefSeq; NP_116764.2; NM_032982.3. [P42575-1]
RefSeq; NP_116765.2; NM_032983.3.
UniGene; Hs.368982; -.
PDB; 1PYO; X-ray; 1.65 A; A/C=167-333, B/D=348-452.
PDB; 2P2C; X-ray; 3.24 A; A/C/E/G/I/K=167-333, B/D/F/H/J/L=348-452.
PDB; 3R5J; X-ray; 1.77 A; A/C=175-333, B/D=349-452.
PDB; 3R6G; X-ray; 2.07 A; A/C=175-333, B/D=349-452.
PDB; 3R6L; X-ray; 1.90 A; A/C=175-333, B/D=349-452.
PDB; 3R7B; X-ray; 1.80 A; A/C=175-333, B/D=349-452.
PDB; 3R7N; X-ray; 2.33 A; A/C=175-333, B/D=349-452.
PDB; 3R7S; X-ray; 2.25 A; A/C=175-333, B/D=349-452.
PDB; 3RJM; X-ray; 2.55 A; A/C=167-333, B/D=348-452.
PDBsum; 1PYO; -.
PDBsum; 2P2C; -.
PDBsum; 3R5J; -.
PDBsum; 3R6G; -.
PDBsum; 3R6L; -.
PDBsum; 3R7B; -.
PDBsum; 3R7N; -.
PDBsum; 3R7S; -.
PDBsum; 3RJM; -.
ProteinModelPortal; P42575; -.
SMR; P42575; -.
BioGrid; 107285; 33.
ComplexPortal; CPX-3905; Caspase-2 PIDDosome.
ComplexPortal; CPX-969; Caspase-2 complex.
CORUM; P42575; -.
IntAct; P42575; 11.
MINT; P42575; -.
STRING; 9606.ENSP00000312664; -.
BindingDB; P42575; -.
ChEMBL; CHEMBL4884; -.
GuidetoPHARMACOLOGY; 1618; -.
MEROPS; C14.006; -.
iPTMnet; P42575; -.
PhosphoSitePlus; P42575; -.
BioMuta; CASP2; -.
DMDM; 83300977; -.
EPD; P42575; -.
jPOST; P42575; -.
MaxQB; P42575; -.
PaxDb; P42575; -.
PeptideAtlas; P42575; -.
PRIDE; P42575; -.
ProteomicsDB; 55519; -.
ProteomicsDB; 55520; -. [P42575-2]
DNASU; 835; -.
Ensembl; ENST00000310447; ENSP00000312664; ENSG00000106144. [P42575-1]
GeneID; 835; -.
KEGG; hsa:835; -.
UCSC; uc003wco.3; human. [P42575-1]
CTD; 835; -.
DisGeNET; 835; -.
EuPathDB; HostDB:ENSG00000106144.19; -.
GeneCards; CASP2; -.
HGNC; HGNC:1503; CASP2.
HPA; CAB012175; -.
HPA; HPA050678; -.
MIM; 600639; gene.
neXtProt; NX_P42575; -.
OpenTargets; ENSG00000106144; -.
PharmGKB; PA26086; -.
eggNOG; KOG3573; Eukaryota.
eggNOG; ENOG410ZQIE; LUCA.
GeneTree; ENSGT00940000156657; -.
HOVERGEN; HBG103962; -.
InParanoid; P42575; -.
KO; K02186; -.
OMA; VMVLMTH; -.
OrthoDB; 1092723at2759; -.
PhylomeDB; P42575; -.
TreeFam; TF102023; -.
BRENDA; 3.4.22.55; 2681.
Reactome; R-HSA-168638; NOD1/2 Signaling Pathway.
Reactome; R-HSA-205025; NADE modulates death signalling.
Reactome; R-HSA-6803207; TP53 Regulates Transcription of Caspase Activators and Caspases.
SIGNOR; P42575; -.
ChiTaRS; CASP2; human.
EvolutionaryTrace; P42575; -.
GeneWiki; Caspase_2; -.
GenomeRNAi; 835; -.
PMAP-CutDB; P42575; -.
PRO; PR:P42575; -.
Proteomes; UP000005640; Chromosome 7.
Bgee; ENSG00000106144; Expressed in 204 organ(s), highest expression level in amniotic fluid.
ExpressionAtlas; P42575; baseline and differential.
Genevisible; P42575; HS.
GO; GO:0005737; C:cytoplasm; IBA:GO_Central.
GO; GO:0005829; C:cytosol; TAS:Reactome.
GO; GO:0016020; C:membrane; IEA:Ensembl.
GO; GO:0005739; C:mitochondrion; IEA:Ensembl.
GO; GO:0005634; C:nucleus; TAS:UniProtKB.
GO; GO:0004197; F:cysteine-type endopeptidase activity; IDA:UniProtKB.
GO; GO:0097153; F:cysteine-type endopeptidase activity involved in apoptotic process; IBA:GO_Central.
GO; GO:0097200; F:cysteine-type endopeptidase activity involved in execution phase of apoptosis; IEA:InterPro.
GO; GO:0019899; F:enzyme binding; ISS:UniProtKB.
GO; GO:0042802; F:identical protein binding; IPI:IntAct.
GO; GO:0019904; F:protein domain specific binding; IPI:BHF-UCL.
GO; GO:0007568; P:aging; IEA:Ensembl.
GO; GO:0006915; P:apoptotic process; IBA:GO_Central.
GO; GO:0097190; P:apoptotic signaling pathway; TAS:UniProtKB.
GO; GO:0007420; P:brain development; IEA:Ensembl.
GO; GO:0071260; P:cellular response to mechanical stimulus; IEP:UniProtKB.
GO; GO:0006977; P:DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; IMP:UniProtKB.
GO; GO:0035234; P:ectopic germ cell programmed cell death; IEA:Ensembl.
GO; GO:0097194; P:execution phase of apoptosis; TAS:UniProtKB.
GO; GO:0097192; P:extrinsic apoptotic signaling pathway in absence of ligand; IBA:GO_Central.
GO; GO:0008630; P:intrinsic apoptotic signaling pathway in response to DNA damage; TAS:UniProtKB.
GO; GO:0001554; P:luteolysis; IEA:Ensembl.
GO; GO:0043066; P:negative regulation of apoptotic process; NAS:UniProtKB.
GO; GO:0003407; P:neural retina development; IEA:Ensembl.
GO; GO:0043065; P:positive regulation of apoptotic process; IDA:UniProtKB.
GO; GO:2001235; P:positive regulation of apoptotic signaling pathway; IEA:Ensembl.
GO; GO:0043525; P:positive regulation of neuron apoptotic process; IEA:Ensembl.
GO; GO:0016485; P:protein processing; IDA:BHF-UCL.
GO; GO:0042981; P:regulation of apoptotic process; TAS:Reactome.
CDD; cd00032; CASc; 1.
InterPro; IPR001315; CARD.
InterPro; IPR029030; Caspase-like_dom_sf.
InterPro; IPR035702; Caspase_2.
InterPro; IPR033139; Caspase_cys_AS.
InterPro; IPR016129; Caspase_his_AS.
InterPro; IPR011029; DEATH-like_dom_sf.
InterPro; IPR002398; Pept_C14.
InterPro; IPR002138; Pept_C14_p10.
InterPro; IPR001309; Pept_C14_p20.
InterPro; IPR015917; Pept_C14A.
PANTHER; PTHR10454; PTHR10454; 1.
PANTHER; PTHR10454:SF151; PTHR10454:SF151; 1.
Pfam; PF00619; CARD; 1.
PRINTS; PR00376; IL1BCENZYME.
SMART; SM00114; CARD; 1.
SMART; SM00115; CASc; 1.
SUPFAM; SSF47986; SSF47986; 1.
SUPFAM; SSF52129; SSF52129; 1.
PROSITE; PS50209; CARD; 1.
PROSITE; PS01122; CASPASE_CYS; 1.
PROSITE; PS01121; CASPASE_HIS; 1.
PROSITE; PS50207; CASPASE_P10; 1.
PROSITE; PS50208; CASPASE_P20; 1.
1: Evidence at protein level;
3D-structure; Acetylation; Alternative splicing; Apoptosis;
Complete proteome; Hydrolase; Phosphoprotein; Polymorphism; Protease;
Reference proteome; Thiol protease; Zymogen.
INIT_MET 1 1 Removed. {ECO:0000244|PubMed:19413330}.
PROPEP 2 169
/FTId=PRO_0000004541.
CHAIN 170 325 Caspase-2 subunit p18.
/FTId=PRO_0000004542.
PROPEP 326 333
/FTId=PRO_0000004543.
CHAIN 334 452 Caspase-2 subunit p13.
/FTId=PRO_0000004544.
CHAIN 348 452 Caspase-2 subunit p12.
/FTId=PRO_0000004545.
DOMAIN 32 121 CARD. {ECO:0000255|PROSITE-
ProRule:PRU00046}.
ACT_SITE 277 277 {ECO:0000250}.
ACT_SITE 320 320 {ECO:0000250}.
MOD_RES 2 2 N-acetylalanine.
{ECO:0000244|PubMed:19413330}.
MOD_RES 157 157 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 340 340 Phosphoserine.
{ECO:0000244|PubMed:21406692}.
VAR_SEQ 1 31 Missing (in isoform 2).
{ECO:0000303|PubMed:8087842,
ECO:0000303|Ref.3}.
/FTId=VSP_000801.
VAR_SEQ 1 17 Missing (in isoform 3).
{ECO:0000303|PubMed:11156409}.
/FTId=VSP_046280.
VAR_SEQ 107 108 RE -> HS (in isoform 3).
{ECO:0000303|PubMed:11156409}.
/FTId=VSP_046281.
VAR_SEQ 109 452 Missing (in isoform 3).
{ECO:0000303|PubMed:11156409}.
/FTId=VSP_046282.
VAR_SEQ 323 452 DETDRGVDQQDGKNHAGSPGCEESDAGKEKLPKMRLPTRSD
MICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVA
DMLVKVNALIKDREGYAPGTEFHRCKEMSEYCSTLCRHLYL
FPGHPPT -> GGAIGSLGHLLLFTAATASLAL (in
isoform 2). {ECO:0000303|PubMed:8087842,
ECO:0000303|Ref.3}.
/FTId=VSP_000802.
VARIANT 105 105 A -> G (in dbSNP:rs4647298).
/FTId=VAR_055621.
VARIANT 172 172 V -> L (in dbSNP:rs4647297).
{ECO:0000269|PubMed:15489334,
ECO:0000269|Ref.5, ECO:0000269|Ref.9}.
/FTId=VAR_016334.
VARIANT 178 178 P -> A (in dbSNP:rs4647298).
{ECO:0000269|Ref.5}.
/FTId=VAR_016335.
VARIANT 441 441 R -> G (in dbSNP:rs4647338).
{ECO:0000269|Ref.5}.
/FTId=VAR_016336.
MUTAGEN 57 57 L->F: Loss of interaction with CRADD.
{ECO:0000269|PubMed:8985253}.
MUTAGEN 95 95 G->R: Loss of interaction with CRADD.
{ECO:0000269|PubMed:8985253}.
MUTAGEN 99 99 F->A: Loss of interaction with CRADD.
{ECO:0000269|PubMed:8985253}.
MUTAGEN 100 100 D->A: No effect on interaction with
CRADD. Loss of interaction with CRADD;
when associated A-104.
{ECO:0000269|PubMed:8985253}.
MUTAGEN 102 102 F->A: Loss of interaction with CRADD.
{ECO:0000269|PubMed:8985253}.
MUTAGEN 104 104 E->A: No effect on interaction with
CRADD. Loss of interaction with CRADD;
when associated A-100.
{ECO:0000269|PubMed:8985253}.
MUTAGEN 106 106 L->A: Loss of interaction with CRADD.
{ECO:0000269|PubMed:8985253}.
MUTAGEN 320 320 C->S: Loss of function.
MUTAGEN 369 369 A->T: Loss of function.
CONFLICT 309 322 QNKPKMFFIQACRG -> EEVTSLSILSAFVT (in Ref.
10; BAD92877). {ECO:0000305}.
HELIX 181 187 {ECO:0000244|PDB:1PYO}.
HELIX 188 190 {ECO:0000244|PDB:1PYO}.
STRAND 197 206 {ECO:0000244|PDB:1PYO}.
STRAND 212 214 {ECO:0000244|PDB:1PYO}.
HELIX 222 235 {ECO:0000244|PDB:1PYO}.
STRAND 238 245 {ECO:0000244|PDB:1PYO}.
HELIX 248 259 {ECO:0000244|PDB:1PYO}.
HELIX 262 265 {ECO:0000244|PDB:1PYO}.
STRAND 267 276 {ECO:0000244|PDB:1PYO}.
STRAND 282 284 {ECO:0000244|PDB:1PYO}.
STRAND 290 292 {ECO:0000244|PDB:1PYO}.
HELIX 293 299 {ECO:0000244|PDB:1PYO}.
TURN 302 304 {ECO:0000244|PDB:1PYO}.
HELIX 306 308 {ECO:0000244|PDB:1PYO}.
STRAND 313 319 {ECO:0000244|PDB:1PYO}.
STRAND 321 324 {ECO:0000244|PDB:1PYO}.
STRAND 363 370 {ECO:0000244|PDB:1PYO}.
STRAND 377 379 {ECO:0000244|PDB:3R5J}.
TURN 380 382 {ECO:0000244|PDB:1PYO}.
HELIX 385 397 {ECO:0000244|PDB:1PYO}.
TURN 398 400 {ECO:0000244|PDB:1PYO}.
HELIX 403 415 {ECO:0000244|PDB:1PYO}.
TURN 425 428 {ECO:0000244|PDB:1PYO}.
STRAND 434 437 {ECO:0000244|PDB:1PYO}.
STRAND 440 442 {ECO:0000244|PDB:3R7S}.
SEQUENCE 452 AA; 50685 MW; 6EF0ED05EF808385 CRC64;
MAAPSAGSWS TFQHKELMAA DRGRRILGVC GMHPHHQETL KKNRVVLAKQ LLLSELLEHL
LEKDIITLEM RELIQAKVGS FSQNVELLNL LPKRGPQAFD AFCEALRETK QGHLEDMLLT
TLSGLQHVLP PLSCDYDLSL PFPVCESCPL YKKLRLSTDT VEHSLDNKDG PVCLQVKPCT
PEFYQTHFQL AYRLQSRPRG LALVLSNVHF TGEKELEFRS GGDVDHSTLV TLFKLLGYDV
HVLCDQTAQE MQEKLQNFAQ LPAHRVTDSC IVALLSHGVE GAIYGVDGKL LQLQEVFQLF
DNANCPSLQN KPKMFFIQAC RGDETDRGVD QQDGKNHAGS PGCEESDAGK EKLPKMRLPT
RSDMICGYAC LKGTAAMRNT KRGSWYIEAL AQVFSERACD MHVADMLVKV NALIKDREGY
APGTEFHRCK EMSEYCSTLC RHLYLFPGHP PT


Related products :

Catalog number Product name Quantity
20-272-191628 Caspase 2 - Mouse monoclonal [3G63] to Caspase 2; EC 3.4.22.55; CASP-2; ICH-1 protease; NEDD2 protein; Neural precursor cell expressed developmentally down-regulated protein 2; NEDD-2 Monoclonal 0.1 mg
20-272-190961 Caspase 2 - Mouse monoclonal [18E809] to Caspase 2; EC 3.4.22.55; CASP-2; ICH-1 protease; NEDD2 protein; Neural precursor cell expressed developmentally down-regulated protein 2; NEDD-2 Monoclonal 0.2 ml
20-272-191595 Caspase 2 - Mouse monoclonal [4i13] to Caspase 2; EC 3.4.22.55; CASP-2; ICH-1 protease; NEDD2 protein; Neural precursor cell expressed developmentally down-regulated protein 2; NEDD-2 Monoclonal 0.05 ml
EIAAB05382 Casp2,CASP-2,Caspase-2,Ich1,Mouse,Mus musculus,Nedd2,NEDD-2,Nedd-2,Neural precursor cell expressed developmentally down-regulated protein 2,Protease ICH-1
EIAAB05383 CASP2,CASP-2,Caspase-2,Homo sapiens,Human,ICH1,NEDD2,NEDD-2,Neural precursor cell expressed developmentally down-regulated protein 2,Protease ICH-1
EIAAB11922 Developmentally-regulated GTP-binding protein 1,Drg,Drg1,DRG-1,Mouse,Mus musculus,Nedd3,NEDD-3,Nedd-3,Neural precursor cell expressed developmentally down-regulated protein 3
EIAAB11921 Developmentally-regulated GTP-binding protein 1,DRG1,DRG-1,Homo sapiens,Human,NEDD3,NEDD-3,Neural precursor cell expressed developmentally down-regulated protein 3
EIAAB34914 60S ribosomal protein L10a,CSA-19,Mouse,Mus musculus,Nedd6,NEDD-6,Nedd-6,Neural precursor cell expressed developmentally down-regulated protein 6,Rpl10a
EIAAB26860 Mouse,Mus musculus,Nedd1,NEDD-1,Nedd-1,Neural precursor cell expressed developmentally down-regulated protein 1,Protein NEDD1
U1058h CLIA CAD,CAD,Caspase-activated deoxyribonuclease,Caspase-activated DNase,Caspase-activated nuclease,CPAN,DFF2,DFF40,DFF-40,DFFB,DNA fragmentation factor 40 kDa subunit,DNA fragmentation factor subunit 96T
U1735m CLIA Casp11,CASP-11,Casp4,CASP-4,Caspase-11,Caspase-4,Caspl,Ich3,Mouse,Mus musculus,Protease ICH-3 96T
E1735m ELISA kit Casp11,CASP-11,Casp4,CASP-4,Caspase-11,Caspase-4,Caspl,Ich3,Mouse,Mus musculus,Protease ICH-3 96T
E1735m ELISA Casp11,CASP-11,Casp4,CASP-4,Caspase-11,Caspase-4,Caspl,Ich3,Mouse,Mus musculus,Protease ICH-3 96T
EIAAB26870 Mouse,Mus musculus,NEDD8,Nedd8,NEDD-8,Nedd-8,Neddylin,Neural precursor cell expressed developmentally down-regulated protein 8,Ubiquitin-like protein Nedd8
EIAAB26864 E3 ubiquitin-protein ligase NEDD4,Kiaa0093,Mouse,Mus musculus,Nedd4,NEDD-4,Nedd-4,Nedd4-1,Nedd4a,Neural precursor cell expressed developmentally down-regulated protein 4
bs-0087P Peptides: active Caspase 3(caspase-3 p12 subunit) Protein Length:12-25 amino acids. 200ug lyophilized
18-661-15069 DNA fragmentation factor subunit beta - EC 3.-.-.-; DNA fragmentation factor 40 kDa subunit; DFF-40; Caspase-activated deoxyribonuclease; Caspase-activated DNase; CAD; Caspase-activated nuclease; CPAN 0.1 mg
18-661-15031 DNA fragmentation factor subunit beta - EC 3.-.-.-; DNA fragmentation factor 40 kDa subunit; DFF-40; Caspase-activated deoxyribonuclease; Caspase-activated DNase; CAD; Caspase-activated nuclease; CPAN 0.1 mg
18-661-15054 DNA fragmentation factor subunit beta - EC 3.-.-.-; DNA fragmentation factor 40 kDa subunit; DFF-40; Caspase-activated deoxyribonuclease; Caspase-activated DNase; CAD; Caspase-activated nuclease; CPAN 0.1 mg
18-661-15032 DNA fragmentation factor subunit beta - EC 3.-.-.-; DNA fragmentation factor 40 kDa subunit; DFF-40; Caspase-activated deoxyribonuclease; Caspase-activated DNase; CAD; Caspase-activated nuclease; CPAN 0.1 mg
18-661-15033 DNA fragmentation factor subunit beta - EC 3.-.-.-; DNA fragmentation factor 40 kDa subunit; DFF-40; Caspase-activated deoxyribonuclease; Caspase-activated DNase; CAD; Caspase-activated nuclease; CPAN 0.1 mg
18-661-15034 DNA fragmentation factor subunit beta - EC 3.-.-.-; DNA fragmentation factor 40 kDa subunit; DFF-40; Caspase-activated deoxyribonuclease; Caspase-activated DNase; CAD; Caspase-activated nuclease; CPAN 0.1 mg
EIAAB34913 60S ribosomal protein L10a,CSA-19,Homo sapiens,Human,NEDD6,NEDD-6,Neural precursor cell expressed developmentally down-regulated protein 6,RPL10A
18-272-197016 Caspase 10 - Rabbit polyclonal to Caspase 10; EC 3.4.22.63; CASP-10; ICE-like apoptotic protease 4; Apoptotic protease Mch-4; FAS-associated death domain protein interleukin-1B-converting enzyme 2; FL 0.1 mg
18-272-195092 Caspase 10 - Rabbit polyclonal to Caspase 10; EC 3.4.22.63; CASP-10; ICE-like apoptotic protease 4; Apoptotic protease Mch-4; FAS-associated death domain protein interleukin-1B-converting enzyme 2; FL 0.1 ml

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1566: Citrate cycle (TCA cycle)
WP1644: DNA replication
WP1663: Homologous recombination
WP1672: Mismatch repair
WP1693: Purine metabolism
WP1694: Pyrimidine metabolism
WP1965: VEGF-receptor Signal Transduction
WP2272: Pathogenic Escherichia coli infection
WP2292: Chemokine signaling pathway
WP2359: Parkin-Ubiquitin Proteasomal System pathway
WP88: Toll Like Receptor signaling
WP1614: 1- and 2-Methylnaphthalene degradation
WP1626: Benzoate degradation via CoA ligation
WP1634: Butanoate metabolism
WP1655: Geraniol degradation
WP1671: Methane metabolism
WP1680: Oxidative phosphorylation
WP1711: Trinitrotoluene degradation
WP1718: Vitamin B6 metabolism
WP2199: Seed Development
WP1011: T Cell Receptor Signaling Pathway
WP1025: B Cell Receptor Signaling Pathway
WP1043: Calcium Regulation in the Cardiac Cell
WP1049: G Protein Signaling Pathways
WP1059: Diurnally regulated genes with circadian orthologs

Related Genes :
[Casp2 Ich1 Nedd-2 Nedd2] Caspase-2 (CASP-2) (EC 3.4.22.55) (Neural precursor cell expressed developmentally down-regulated protein 2) (NEDD-2) (Protease ICH-1) [Cleaved into: Caspase-2 subunit p18; Caspase-2 subunit p13; Caspase-2 subunit p12]
[CASP2 ICH1 NEDD2] Caspase-2 (CASP-2) (EC 3.4.22.55) (Neural precursor cell expressed developmentally down-regulated protein 2) (NEDD-2) (Protease ICH-1) [Cleaved into: Caspase-2 subunit p18; Caspase-2 subunit p13; Caspase-2 subunit p12]
[Casp2 Ich1] Caspase-2 (CASP-2) (EC 3.4.22.55) (Protease ICH-1) [Cleaved into: Caspase-2 subunit p18; Caspase-2 subunit p13; Caspase-2 subunit p12]
[CASP10 MCH4] Caspase-10 (CASP-10) (EC 3.4.22.63) (Apoptotic protease Mch-4) (FAS-associated death domain protein interleukin-1B-converting enzyme 2) (FLICE2) (ICE-like apoptotic protease 4) [Cleaved into: Caspase-10 subunit p23/17; Caspase-10 subunit p12]
[CASP4 ICH2] Caspase-4 (CASP-4) (EC 3.4.22.57) (ICE and Ced-3 homolog 2) (ICH-2) (ICE(rel)-II) (Mih1) (Protease TX) [Cleaved into: Caspase-4 subunit 1; Caspase-4 subunit 2]
[CASP6 MCH2] Caspase-6 (CASP-6) (EC 3.4.22.59) (Apoptotic protease Mch-2) [Cleaved into: Caspase-6 subunit p18; Caspase-6 subunit p11]
[ced-3 C48D1.2] Cell death protein 3 (EC 3.4.22.60) (Caspase ced-3) [Cleaved into: Cell death protein 3 subunit p17; Cell death protein 3 subunit p15; Cell death protein 3 subunit p13]
[CASP2 ICH1] Caspase-2 (CASP-2) (EC 3.4.22.55) (ICH-1L/1S) (Protease ICH-1) [Cleaved into: Caspase-2 subunit p18; Caspase-2 subunit p13; Caspase-2 subunit p12]
[CASP8 MCH5] Caspase-8 (CASP-8) (EC 3.4.22.61) (Apoptotic cysteine protease) (Apoptotic protease Mch-5) (CAP4) (FADD-homologous ICE/ced-3-like protease) (FADD-like ICE) (FLICE) (ICE-like apoptotic protease 5) (MORT1-associated ced-3 homolog) (MACH) [Cleaved into: Caspase-8 subunit p18; Caspase-8 subunit p10]
[Casp6] Caspase-6 (CASP-6) (EC 3.4.22.59) (Apoptotic protease Mch-2) [Cleaved into: Caspase-6 subunit p18; Caspase-6 subunit p11]
[Casp4 Casp11 Caspl Ich3] Caspase-4 (CASP-4) (EC 3.4.22.64) (Caspase-11) (CASP-11) (Protease ICH-3) [Cleaved into: Caspase-4 subunit p10; Caspase-4 subunit p20]
[CASP3 CPP32] Caspase-3 (CASP-3) (EC 3.4.22.56) (Apopain) (Cysteine protease CPP32) (CPP-32) (Protein Yama) (SREBP cleavage activity 1) (SCA-1) [Cleaved into: Caspase-3 subunit p17; Caspase-3 subunit p12]
[Casp3 Cpp32] Caspase-3 (CASP-3) (EC 3.4.22.56) (Apopain) (Cysteine protease CPP32) (CPP-32) (LICE) (Protein Yama) (SREBP cleavage activity 1) (SCA-1) [Cleaved into: Caspase-3 subunit p17; Caspase-3 subunit p12]
[Casp6 Mch2] Caspase-6 (CASP-6) (EC 3.4.22.59) (Apoptotic protease Mch-2) [Cleaved into: Caspase-6 subunit p18; Caspase-6 subunit p11]
[Casp3 Cpp32] Caspase-3 (CASP-3) (EC 3.4.22.56) (Apopain) (Cysteine protease CPP32) (CPP-32) (IRP) (LICE) (Protein Yama) (SREBP cleavage activity 1) (SCA-1) [Cleaved into: Caspase-3 subunit p17; Caspase-3 subunit p12]
[CFLAR CASH CASP8AP1 CLARP MRIT] CASP8 and FADD-like apoptosis regulator (Caspase homolog) (CASH) (Caspase-eight-related protein) (Casper) (Caspase-like apoptosis regulatory protein) (CLARP) (Cellular FLICE-like inhibitory protein) (c-FLIP) (FADD-like antiapoptotic molecule 1) (FLAME-1) (Inhibitor of FLICE) (I-FLICE) (MACH-related inducer of toxicity) (MRIT) (Usurpin) [Cleaved into: CASP8 and FADD-like apoptosis regulator subunit p43; CASP8 and FADD-like apoptosis regulator subunit p12]
[CASP3] Caspase-3 (CASP-3) (EC 3.4.22.56) [Cleaved into: Caspase-3 subunit p17; Caspase-3 subunit p12]
[Casp7 Lice2 Mch3] Caspase-7 (CASP-7) (EC 3.4.22.60) (Apoptotic protease Mch-3) (Cysteine protease LICE2) [Cleaved into: Caspase-7 subunit p20; Caspase-7 subunit p11]
[CASP3] Caspase-3 (CASP-3) (EC 3.4.22.56) [Cleaved into: Caspase-3 subunit p17; Caspase-3 subunit p12]
[Cflar Cash] CASP8 and FADD-like apoptosis regulator (Caspase homolog) (CASH) (Caspase-eight-related protein) (Casper) (Caspase-like apoptosis regulatory protein) (CLARP) (Cellular FLICE-like inhibitory protein) (c-FLIP) (FADD-like antiapoptotic molecule 1) (FLAME-1) (Inhibitor of FLICE) (I-FLICE) (MACH-related inducer of toxicity) (MRIT) (Usurpin) [Cleaved into: CASP8 and FADD-like apoptosis regulator subunit p43; CASP8 and FADD-like apoptosis regulator subunit p12]
[csp-2 Y73B6BL.7] Putative inactive caspase B [Cleaved into: Putative inactive caspase B subunit p31; Putative inactive caspase B subunit p17; Putative inactive caspase subunit p14]
[Drice ICE CG7788] Caspase (EC 3.4.22.-) (drICE) [Cleaved into: Caspase subunit p21; Caspase subunit p12]
[CASP7 MCH3] Caspase-7 (CASP-7) (EC 3.4.22.60) (Apoptotic protease Mch-3) (CMH-1) (ICE-like apoptotic protease 3) (ICE-LAP3) [Cleaved into: Caspase-7 subunit p20; Caspase-7 subunit p11]
[Dredd DCP2 CG7486] Caspase-8 (EC 3.4.22.61) (Death-related ced-3/NEDD2-like protein) [Cleaved into: Caspase-8 subunit p15; Caspase-8 subunit p10]
[CASP14] Caspase-14 (CASP-14) (EC 3.4.22.-) [Cleaved into: Caspase-14 subunit p17, mature form; Caspase-14 subunit p10, mature form; Caspase-14 subunit p20, intermediate form; Caspase-14 subunit p8, intermediate form]
[ORF1] Genome polyprotein (p254) [Cleaved into: Protein p16; Protein p23; NTPase (EC 3.6.1.15) (2C-like protein) (P2C) (p37); Precursor p41; Protein p29; Protein p23/2; Protein p18; Viral genome-linked protein (VPg) (p13); 3C-like protease (3CLpro) (EC 3.4.22.66) (Calicivirin) (Thiol protease P3C) (p15); RNA-directed RNA polymerase (EC 2.7.7.48) (3Dpol) (p58); Capsid protein VP60]
[csp-1 Y48E1B.13] Caspase A (EC 3.4.22.36) [Cleaved into: Caspase A subunit p16; Caspase A subunit p14]
[ORF1] Genome polyprotein (p254) [Cleaved into: Protein p16; Protein p23; NTPase (EC 3.6.1.15) (2C-like protein) (P2C) (p37); Precursor p41; Protein p29; Protein p23/2; Protein p18; Viral genome-linked protein (VPg) (p13); 3C-like protease (3CLpro) (EC 3.4.22.66) (Calicivirin) (Thiol protease P3C) (p15); RNA-directed RNA polymerase (EC 2.7.7.48) (3Dpol) (p58); Capsid protein VP60]
[ORF1] Genome polyprotein (p254) [Cleaved into: Protein p16; Protein p23; NTPase (EC 3.6.1.15) (2C-like protein) (P2C) (p37); Precursor p41; Protein p29; Protein p23/2; Protein p18; Viral genome-linked protein (VPg) (p13); 3C-like protease (3CLpro) (EC 3.4.22.66) (Calicivirin) (Thiol protease P3C) (p15); RNA-directed RNA polymerase (EC 2.7.7.48) (3Dpol) (p58); Capsid protein VP60]
[ORF1] Genome polyprotein (p254) [Cleaved into: Protein p16; Protein p23; NTPase (EC 3.6.1.15) (2C-like protein) (P2C) (p37); Precursor p41; Protein p29; Protein p23/2; Protein p18; Viral genome-linked protein (VPg) (p13); 3C-like protease (3CLpro) (EC 3.4.22.66) (Calicivirin) (Thiol protease P3C) (p15); RNA-directed RNA polymerase (EC 2.7.7.48) (3Dpol) (p58); Capsid protein VP60]

Bibliography :