GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Cell cycle progression protein 1 (Cell cycle progression restoration protein 8)

 CCPG1_HUMAN             Reviewed;         757 AA.
Q9ULG6; A0PJH3; A8K9T0; O14712; Q05DG4; Q5U5S7; Q8IYV8; Q9BY53; Q9HA17;
13-NOV-2007, integrated into UniProtKB/Swiss-Prot.
13-NOV-2007, sequence version 3.
12-AUG-2020, entry version 136.
RecName: Full=Cell cycle progression protein 1;
AltName: Full=Cell cycle progression restoration protein 8;
Name=CCPG1; Synonyms=CCP8, CPR8, KIAA1254;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=10574462; DOI=10.1093/dnares/6.5.337;
Nagase T., Ishikawa K., Kikuno R., Hirosawa M., Nomura N., Ohara O.;
"Prediction of the coding sequences of unidentified human genes. XV. The
complete sequences of 100 new cDNA clones from brain which code for large
proteins in vitro.";
DNA Res. 6:337-345(1999).
[2]
SEQUENCE REVISION.
PubMed=12168954; DOI=10.1093/dnares/9.3.99;
Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.;
"Construction of expression-ready cDNA clones for KIAA genes: manual
curation of 330 KIAA cDNA clones.";
DNA Res. 9:99-106(2002).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
TISSUE=Liver;
Li Y., Wu T., Xu S., Ren S., Chen Z., Han Z.;
"A novel gene expressed in human liver non-tumor tissues.";
Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5).
TISSUE=Mammary gland, and Trachea;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16572171; DOI=10.1038/nature04601;
Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K.,
Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K.,
FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N.,
Abouelleil A., Arachchi H.M., Baradarani L., Birditt B., Bloom S.,
Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K.,
DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J.,
Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E.,
Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B.,
Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R.,
O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B.,
Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S.,
Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.;
"Analysis of the DNA sequence and duplication history of human chromosome
15.";
Nature 440:671-675(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
Hunkapiller M.W., Myers E.W., Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), AND VARIANTS
VAL-161; LEU-436; GLU-627 AND ILE-646.
TISSUE=Brain, Lymph, Placenta, and Skin;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
NUCLEOTIDE SEQUENCE [MRNA] OF 379-757 (ISOFORM 4), FUNCTION, AND VARIANTS
VAL-477 AND ASP-517.
PubMed=9383053;
Edwards M.C., Liegeois N., Horecka J., DePinho R.A., Sprague G.F. Jr.,
Tyers M., Elledge S.J.;
"Human CPR (cell cycle progression restoration) genes impart a Far-
phenotype on yeast cells.";
Genetics 147:1063-1076(1997).
[9]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[10]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-186, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L.,
Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human liver
phosphoproteome.";
J. Proteomics 96:253-262(2014).
[11]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25944712; DOI=10.1002/pmic.201400617;
Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M., Ayoub D.,
Lane L., Bairoch A., Van Dorsselaer A., Carapito C.;
"N-terminome analysis of the human mitochondrial proteome.";
Proteomics 15:2519-2524(2015).
-!- FUNCTION: Acts as an assembly platform for Rho protein signaling
complexes. Limits guanine nucleotide exchange activity of MCF2L toward
RHOA, which results in an inhibition of both its transcriptional
activation ability and its transforming activity. Does not inhibit
activity of MCF2L toward CDC42, or activity of MCF2 toward either RHOA
or CDC42 (By similarity). May be involved in cell cycle regulation.
{ECO:0000250, ECO:0000269|PubMed:9383053}.
-!- SUBUNIT: Interacts with MCF2L. May interact with MCF2, ARHGEF1, BCR,
VAV1 and FGD1, but not with TIAM1. Interacts with GTP-bound CDC42 and
SRC (By similarity). {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Cytoplasmic granule membrane {ECO:0000250};
Single-pass type II membrane protein {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=5;
Name=1;
IsoId=Q9ULG6-1; Sequence=Displayed;
Name=2;
IsoId=Q9ULG6-2; Sequence=VSP_029311, VSP_029312;
Name=3;
IsoId=Q9ULG6-3; Sequence=VSP_029313, VSP_029316;
Name=4;
IsoId=Q9ULG6-4; Sequence=VSP_029314, VSP_029315;
Name=5;
IsoId=Q9ULG6-5; Sequence=VSP_029316;
-!- SIMILARITY: Belongs to the CCPG1 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAB69314.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};
Sequence=AAH15203.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence.; Evidence={ECO:0000305};
Sequence=AAH29398.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence.; Evidence={ECO:0000305};
Sequence=BAA86568.2; Type=Erroneous initiation; Evidence={ECO:0000305};
-!- SEQUENCE CAUTION: [Isoform 4]:
Sequence=AAB69314.1; Type=Frameshift; Evidence={ECO:0000305};
Sequence=AAK14914.1; Type=Frameshift; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AB033080; BAA86568.2; ALT_INIT; mRNA.
EMBL; AF212228; AAK14914.1; ALT_FRAME; mRNA.
EMBL; AK022459; BAB14042.1; -; mRNA.
EMBL; AK292795; BAF85484.1; -; mRNA.
EMBL; AC013355; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC018926; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471082; EAW77481.1; -; Genomic_DNA.
EMBL; BC015203; AAH15203.1; ALT_SEQ; mRNA.
EMBL; BC029398; AAH29398.1; ALT_SEQ; mRNA.
EMBL; BC034914; AAH34914.1; -; mRNA.
EMBL; BC039871; AAH39871.1; -; mRNA.
EMBL; AF011794; AAB69314.1; ALT_SEQ; mRNA.
CCDS; CCDS42039.1; -. [Q9ULG6-1]
CCDS; CCDS55966.1; -. [Q9ULG6-5]
CCDS; CCDS55967.1; -. [Q9ULG6-3]
RefSeq; NP_001191379.1; NM_001204450.1. [Q9ULG6-5]
RefSeq; NP_001191380.1; NM_001204451.1. [Q9ULG6-3]
RefSeq; NP_004739.3; NM_004748.4. [Q9ULG6-1]
RefSeq; NP_065790.2; NM_020739.3. [Q9ULG6-1]
SMR; Q9ULG6; -.
BioGRID; 114665; 40.
IntAct; Q9ULG6; 30.
MINT; Q9ULG6; -.
STRING; 9606.ENSP00000403400; -.
GlyGen; Q9ULG6; 1 site.
iPTMnet; Q9ULG6; -.
PhosphoSitePlus; Q9ULG6; -.
BioMuta; CCPG1; -.
DMDM; 160380597; -.
EPD; Q9ULG6; -.
jPOST; Q9ULG6; -.
MassIVE; Q9ULG6; -.
PaxDb; Q9ULG6; -.
PeptideAtlas; Q9ULG6; -.
PRIDE; Q9ULG6; -.
ProteomicsDB; 1897; -.
ProteomicsDB; 85016; -. [Q9ULG6-1]
ProteomicsDB; 85017; -. [Q9ULG6-2]
ProteomicsDB; 85018; -. [Q9ULG6-3]
ProteomicsDB; 85019; -. [Q9ULG6-4]
Antibodypedia; 57643; 64 antibodies.
DNASU; 9236; -.
Ensembl; ENST00000310958; ENSP00000311656; ENSG00000260916. [Q9ULG6-1]
Ensembl; ENST00000425574; ENSP00000415128; ENSG00000260916. [Q9ULG6-3]
Ensembl; ENST00000442196; ENSP00000403400; ENSG00000260916. [Q9ULG6-5]
Ensembl; ENST00000569205; ENSP00000454456; ENSG00000260916. [Q9ULG6-1]
GeneID; 9236; -.
KEGG; hsa:9236; -.
UCSC; uc002acv.3; human. [Q9ULG6-1]
CTD; 9236; -.
DisGeNET; 9236; -.
EuPathDB; HostDB:ENSG00000260916.5; -.
GeneCards; CCPG1; -.
HGNC; HGNC:24227; CCPG1.
HPA; ENSG00000260916; Low tissue specificity.
MIM; 611326; gene.
neXtProt; NX_Q9ULG6; -.
OpenTargets; ENSG00000260916; -.
PharmGKB; PA134967250; -.
eggNOG; ENOG502QWDZ; Eukaryota.
GeneTree; ENSGT00940000160497; -.
HOGENOM; CLU_018722_0_0_1; -.
InParanoid; Q9ULG6; -.
OMA; LDAFHHW; -.
OrthoDB; 667993at2759; -.
PhylomeDB; Q9ULG6; -.
TreeFam; TF333202; -.
PathwayCommons; Q9ULG6; -.
BioGRID-ORCS; 9236; 2 hits in 875 CRISPR screens.
GenomeRNAi; 9236; -.
Pharos; Q9ULG6; Tbio.
PRO; PR:Q9ULG6; -.
Proteomes; UP000005640; Chromosome 15.
RNAct; Q9ULG6; protein.
Bgee; ENSG00000260916; Expressed in calcaneal tendon and 197 other tissues.
ExpressionAtlas; Q9ULG6; baseline and differential.
Genevisible; Q9ULG6; HS.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0016020; C:membrane; IBA:GO_Central.
GO; GO:0007049; P:cell cycle; IEA:UniProtKB-KW.
GO; GO:0045787; P:positive regulation of cell cycle; IMP:UniProtKB.
GO; GO:0008284; P:positive regulation of cell population proliferation; IMP:UniProtKB.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IEA:Ensembl.
GO; GO:2001106; P:regulation of Rho guanyl-nucleotide exchange factor activity; IBA:GO_Central.
InterPro; IPR033588; CCPG1.
PANTHER; PTHR28638:SF2; PTHR28638:SF2; 1.
1: Evidence at protein level;
Alternative splicing; Cell cycle; Coiled coil; Membrane; Phosphoprotein;
Polymorphism; Reference proteome; Signal-anchor; Transmembrane;
Transmembrane helix.
CHAIN 1..757
/note="Cell cycle progression protein 1"
/id="PRO_0000310538"
TOPO_DOM 1..217
/note="Cytoplasmic"
/evidence="ECO:0000255"
TRANSMEM 218..238
/note="Helical; Signal-anchor for type II membrane protein"
/evidence="ECO:0000255"
TOPO_DOM 239..757
/note="Lumenal"
/evidence="ECO:0000255"
REGION 1..308
/note="Interaction with MCF2L and SRC"
/evidence="ECO:0000250"
COILED 248..272
/evidence="ECO:0000255"
COILED 306..450
/evidence="ECO:0000255"
COILED 504..530
/evidence="ECO:0000255"
COMPBIAS 176..181
/note="Poly-Arg"
MOD_RES 186
/note="Phosphoserine"
/evidence="ECO:0000244|PubMed:23186163,
ECO:0000244|PubMed:24275569"
VAR_SEQ 1..144
/note="Missing (in isoform 2)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_029311"
VAR_SEQ 145..151
/note="TFCQPET -> MSTFFLI (in isoform 2)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_029312"
VAR_SEQ 312..694
/note="Missing (in isoform 3)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_029313"
VAR_SEQ 582..598
/note="HNRGPTMQNDGRKEKPV -> SRPYYAKRWKERKASSL (in isoform
4)"
/evidence="ECO:0000303|PubMed:9383053, ECO:0000303|Ref.3"
/id="VSP_029314"
VAR_SEQ 599..757
/note="Missing (in isoform 4)"
/evidence="ECO:0000303|PubMed:9383053, ECO:0000303|Ref.3"
/id="VSP_029315"
VAR_SEQ 745..757
/note="RSVYIKPCHYSSL -> SRPDKKQRMVNIENSRHRKQEQKHLQPQPYKREGK
WHKYGRTNGRQMANLEIELGQLPFDPQY (in isoform 3 and isoform 5)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_029316"
VARIANT 44
/note="S -> P (in dbSNP:rs11555304)"
/id="VAR_037063"
VARIANT 161
/note="E -> V (in dbSNP:rs17853336)"
/evidence="ECO:0000269|PubMed:15489334"
/id="VAR_037064"
VARIANT 418
/note="Y -> H (in dbSNP:rs34958422)"
/id="VAR_037065"
VARIANT 436
/note="R -> L (in dbSNP:rs17857026)"
/evidence="ECO:0000269|PubMed:15489334"
/id="VAR_037066"
VARIANT 477
/note="A -> V (in dbSNP:rs1063562)"
/evidence="ECO:0000269|PubMed:9383053"
/id="VAR_037067"
VARIANT 517
/note="A -> D (in dbSNP:rs1063563)"
/evidence="ECO:0000269|PubMed:9383053"
/id="VAR_037068"
VARIANT 553
/note="G -> D (in dbSNP:rs1063565)"
/id="VAR_037069"
VARIANT 553
/note="G -> S (in dbSNP:rs1063564)"
/id="VAR_037070"
VARIANT 590
/note="N -> K (in dbSNP:rs1063566)"
/id="VAR_037071"
VARIANT 627
/note="K -> E (in dbSNP:rs17853335)"
/evidence="ECO:0000269|PubMed:15489334"
/id="VAR_037072"
VARIANT 646
/note="T -> I (in dbSNP:rs17857027)"
/evidence="ECO:0000269|PubMed:15489334"
/id="VAR_037073"
VARIANT 673
/note="H -> R (in dbSNP:rs1063567)"
/id="VAR_037074"
CONFLICT 196
/note="A -> G (in Ref. 1; BAA86568)"
/evidence="ECO:0000305"
CONFLICT 270
/note="E -> G (in Ref. 4; BAB14042)"
/evidence="ECO:0000305"
CONFLICT 483
/note="E -> G (in Ref. 7; AAH29398 and 8; AAB69314)"
/evidence="ECO:0000305"
CONFLICT 553
/note="G -> N (in Ref. 8; AAB69314)"
/evidence="ECO:0000305"
SEQUENCE 757 AA; 87340 MW; DDF496D4431A7976 CRC64;
MSENSSDSDS SCGWTVISHE GSDIEMLNSV TPTDSCEPAP ECSSLEQEEL QALQIEQGES
SQNGTVLMEE TAYPALEETS STIEAEEQKI PEDSIYIGTA SDDSDIVTLE PPKLEEIGNQ
EVVIVEEAQS SEDFNMGSSS SSQYTFCQPE TVFSSQPSDD ESSSDETSNQ PSPAFRRRRA
RKKTVSASES EDRLVAEQET EPSKELSKRQ FSSGLNKCVI LALVIAISMG FGHFYGTIQI
QKRQQLVRKI HEDELNDMKD YLSQCQQEQE SFIDYKSLKE NLARCWTLTE AEKMSFETQK
TNLATENQYL RVSLEKEEKA LSSLQEELNK LREQIRILED KGTSTELVKE NQKLKQHLEE
EKQKKHSFLS QRETLLTEAK MLKRELERER LVTTALRGEL QQLSGSQLHG KSDSPNVYTE
KKEIAILRER LTELERKLTF EQQRSDLWER LYVEAKDQNG KQGTDGKKKG GRGSHRAKNK
SKETFLGSVK ETFDAMKNST KEFVRHHKEK IKQAKEAVKE NLKKFSDSVK STFRHFKDTT
KNIFDEKGNK RFGATKEAAE KPRTVFSDYL HPQYKAPTEN HHNRGPTMQN DGRKEKPVHF
KEFRKNTNSK KCSPGHDCRE NSHSFRKACS GVFDCAQQES MSLFNTVVNP IRMDEFRQII
QRYMLKELDT FCHWNELDQF INKFFLNGVF IHDQKLFTDF VNDVKDYLRN MKEYEVDNDG
VFEKLDEYIY RHFFGHTFSP PYGPRSVYIK PCHYSSL


Related products :

Catalog number Product name Quantity
EIAAB06190 CCP8,CCPG1,Cell cycle progression protein 1,Cell cycle progression restoration protein 8,CPR8,Homo sapiens,Human,KIAA1254
EIAAB41607 Cell cycle progression protein 2,Cell cycle progression restoration protein 2,CPR2,FAST kinase domain-containing protein 4,FASTKD4,Homo sapiens,Human,KIAA0948,Protein TBRG4,TBRG4,Transforming growth f
27-305 In response to DNA damage and replication blocks, cell cycle progression is halted through the control of critical cell cycle regulators. CHEK2 is a cell cycle checkpoint regulator and putative tumor 0.05 mg
EIAAB11533 Cell cycle progression restoration gene 3 protein,CPR3,Dj3,DnaJ homolog subfamily A member 2,DNAJA2,Dnj3,HIRA-interacting protein 4,HIRIP4,Homo sapiens,Human,Renal carcinoma antigen NY-REN-14
26-635 ANP32B is a multifunctional protein working as a cell cycle progression factor as well as a cell survival factor. ANP32B is required for the progression from the G1 to the S phase. ANP32B is an anti-a 0.05 mg
CCPG1_MOUSE Mouse ELISA Kit FOR Cell cycle progression protein 1 96T
CSB-EL004838HU Human Cell cycle progression protein 1(CCPG1) ELISA kit 96T
EIAAB06191 Ccpg1,Cell cycle progression protein 1,Mouse,Mus musculus
CSB-EL004838CH Chicken Cell cycle progression protein 1(CCPG1) ELISA kit 96T
CSB-EL004838MO Mouse Cell cycle progression protein 1(CCPG1) ELISA kit 96T
CSB-EL004838HU Human Cell cycle progression protein 1(CCPG1) ELISA kit SpeciesHuman 96T
CSB-EL004838MO Mouse Cell cycle progression protein 1(CCPG1) ELISA kit SpeciesMouse 96T
CSB-EL004838CH Chicken Cell cycle progression protein 1(CCPG1) ELISA kit SpeciesChicken 96T
CCPG1_MOUSE ELISA Kit FOR Cell cycle progression protein 1; organism: Mouse; gene name: Ccpg1 96T
CCPG1_HUMAN ELISA Kit FOR Cell cycle progression protein 1; organism: Human; gene name: CCPG1 96T
27-427 GFI1 may be a transcription factor involved in regulating the expression of genes active in the S phase during cell cycle progression in T-cells. GFI1 may be involved in tumor progression. Defects in 0.05 mg
27-632 GFI1 may be a transcription factor involved in regulating the expression of genes active in the S phase during cell cycle progression in T-cells. GFI1 may be involved in tumor progression. Defects in 0.05 mg
31-169 Myb-Related Protein B (MYBL2), a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A_cycl 0.05 mg
22248 cell cycle progression 2 protein isoform 2 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF 100ul
25-120 BBX is a transcription factor that is necessary for cell cycle progression from G1 to S phase. 0.05 mg
E4329h Human Cell Cycle Progression 1 ELISA Kit 96T
201-20-0898 CCPG1{cell cycle progression 1}rabbit.pAb 0.1ml
CCR1 CCPG1 Gene cell cycle progression 1
EIAAB06189 CCPG1,Cell cycle progression protein 1,Chicken,Gallus gallus,RCJMB04_3a3
EIAAB41609 Cell cycle progression protein 2,CPR2,Pig,Protein TBRG4,Sus scrofa,TBRG4,Transforming growth factor beta regulator 4
Pathways :
WP45: G1 to S cell cycle control
WP964: Cell cycle
WP1083: Cell cycle
WP1782: APC/C-mediated degradation of cell cycle proteins
WP1900: Regulation of mitotic cell cycle
WP1566: Citrate cycle (TCA cycle)
WP31: Cell cycle
WP445: G1 to S cell cycle control
WP959: G1 to S cell cycle control
WP1078: G1 to S cell cycle control
WP1393: Cell cycle
WP348: G1 to S cell cycle control
WP1775: Cell Cycle Checkpoints
WP844: Cell cycle
WP190: Cell cycle
WP1792: Cell Cycle, Mitotic
WP414: Cell Cycle and Cell Division
WP1200: Cell cycle
WP840: G1 to S cell cycle control
WP179: Cell cycle
WP413: G1 to S cell cycle control
WP429: Cell cycle
WP1195: G1 to S cell cycle control
WP1689: Porphyrin and chlorophyll metabolism
WP2012: miRs in Muscle Cell Differentiation

Related Genes :
[CCPG1 CCP8 CPR8 KIAA1254] Cell cycle progression protein 1 (Cell cycle progression restoration protein 8)
[TBRG4 CPR2 FASTKD4 KIAA0948] FAST kinase domain-containing protein 4 (Cell cycle progression restoration protein 2) (Cell cycle progression protein 2) (Protein TBRG4) (Transforming growth factor beta regulator 4)
[Ccpg1] Cell cycle progression protein 1
[Asun IntS13 Mat89Bb ovary2 CG6814] Protein asunder (Cell cycle regulator Mat89Bb) (Integrator complex subunit 13) (Maternal transcript 89Bb) (Set apart in position or space protein)
[mat-3 apc-8 cdc-23 pod-4 vex-2 F10C5.1] Cell division cycle protein 23 homolog (Anaphase-promoting complex subunit 8) (APC8) (Metaphase-to-anaphase transition defect protein 3)
[CCAR1 CARP1 DIS] Cell division cycle and apoptosis regulator protein 1 (Cell cycle and apoptosis regulatory protein 1) (CARP-1) (Death inducer with SAP domain)
[cdc-48.2 C41C4.8] Transitional endoplasmic reticulum ATPase homolog 2 (EC 3.6.4.6) (Cell division cycle-related protein 48.2) (p97/CDC48 homolog 2)
[CDK11B CDC2L1 CDK11 PITSLREA PK58] Cyclin-dependent kinase 11B (EC 2.7.11.22) (Cell division cycle 2-like protein kinase 1) (CLK-1) (Cell division protein kinase 11B) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L1) (p58 CLK-1)
[Cdk11b Cdc2l1 Cdk11] Cyclin-dependent kinase 11B (Cell division cycle 2-like protein kinase 1) (Cell division protein kinase 11) (Cyclin-dependent kinase 11) (EC 2.7.11.22) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L1)
[CHEK1 CHK1] Serine/threonine-protein kinase Chk1 (EC 2.7.11.1) (CHK1 checkpoint homolog) (Cell cycle checkpoint kinase) (Checkpoint kinase-1)
[cdc-48.1 C06A1.1] Transitional endoplasmic reticulum ATPase homolog 1 (EC 3.6.4.6) (Cell division cycle-related protein 48.1) (p97/CDC48 homolog 1)
[Taf1 Ccg1] Transcription initiation factor TFIID subunit 1 (EC 2.3.1.48) (EC 2.7.11.1) (Cell cycle gene 1 protein) (TBP-associated factor 250 kDa) (p250) (Transcription initiation factor TFIID 250 kDa subunit) (TAF(II)250) (TAFII-250) (TAFII250)
[TAF1 BA2R CCG1 CCGS TAF2A] Transcription initiation factor TFIID subunit 1 (EC 2.3.1.48) (EC 2.7.11.1) (Cell cycle gene 1 protein) (TBP-associated factor 250 kDa) (p250) (Transcription initiation factor TFIID 250 kDa subunit) (TAF(II)250) (TAFII-250) (TAFII250)
[Ccar1 Carp1] Cell division cycle and apoptosis regulator protein 1 (Cell cycle and apoptosis regulatory protein 1) (CARP-1)
[CDK11A CDC2L2 CDC2L3 PITSLREB] Cyclin-dependent kinase 11A (EC 2.7.11.22) (Cell division cycle 2-like protein kinase 2) (Cell division protein kinase 11A) (Galactosyltransferase-associated protein kinase p58/GTA) (PITSLRE serine/threonine-protein kinase CDC2L2)
[RAD1 REC1] Cell cycle checkpoint protein RAD1 (hRAD1) (EC 3.1.11.2) (DNA repair exonuclease rad1 homolog) (Rad1-like DNA damage checkpoint protein)
[CDC7 CDC7L1] Cell division cycle 7-related protein kinase (CDC7-related kinase) (HsCdc7) (huCdc7) (EC 2.7.11.1)
[TAF1 CCG1] Transcription initiation factor TFIID subunit 1 (EC 2.3.1.48) (EC 2.7.11.1) (Cell cycle gene 1 protein) (TBP-associated factor 250 kDa) (p250) (Transcription initiation factor TFIID 250 kDa subunit) (TAF(II)250) (TAFII-250) (TAFII250)
[CDC73 C1orf28 HRPT2] Parafibromin (Cell division cycle protein 73 homolog) (Hyperparathyroidism 2 protein)
[RAD17 R24L] Cell cycle checkpoint protein RAD17 (hRad17) (RF-C/activator 1 homolog)
[RAD9A] Cell cycle checkpoint control protein RAD9A (hRAD9) (EC 3.1.11.2) (DNA repair exonuclease rad9 homolog A)
[cdc-14 C17G10.4] Tyrosine-protein phosphatase cdc-14 (EC 3.1.3.48) (Cell division cycle-related protein 14)
[Cdc73] Parafibromin (Cell division cycle protein 73 homolog) (Hyperparathyroidism 2 protein homolog)
[Rad17] Cell cycle checkpoint protein RAD17
[CDC43 CAL1 YGL155W G1864] Geranylgeranyl transferase type-1 subunit beta (GGTase-I-beta) (EC 2.5.1.59) (Cell division cycle protein 43) (Geranylgeranyl transferase type I subunit beta) (RAS proteins geranylgeranyltransferase subunit beta) (Type I protein geranyl-geranyltransferase subunit beta) (PGGTase I beta)
[CDCA8 PESCRG3] Borealin (Cell division cycle-associated protein 8) (Dasra-B) (hDasra-B) (Pluripotent embryonic stem cell-related gene 3 protein)
[Cdc73 Hrpt2] Parafibromin (Cell division cycle protein 73 homolog) (Hyperparathyroidism 2 protein homolog)
[ASNS TS11] Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4) (Cell cycle control protein TS11) (Glutamine-dependent asparagine synthetase)
[cdc-48.3 K04G2.3] ATPase family protein 2 homolog (EC 3.6.4.10) (Cell division cycle-related protein 48.3)
[INTS13 ASUN C12orf11 GCT1] Integrator complex subunit 13 (Cell cycle regulator Mat89Bb homolog) (Germ cell tumor 1) (Protein asunder homolog) (Sarcoma antigen NY-SAR-95)

Bibliography :
[32508267] MiRNA-12129 Suppresses Cell Proliferation and Block Cell Cycle Progression by Targeting SIRT1 in GASTRIC Cancer.
[31933751] miR-216a-5p promotes mesangial cell proliferation by targeting FoxO1 in diabetic nephropathy.
[31176784] Lycorine inhibited the cell growth of non-small cell lung cancer by modulating the miR-186/CDK1 axis.
[30782188] A novel lncRNA MCM3AP-AS1 promotes the growth of hepatocellular carcinoma by targeting miR-194-5p/FOXA1 axis.
[30774377] microRNA-628 inhibits the proliferation of acute myeloid leukemia cells by directly targeting IGF-1R.
[30416861] Downregulated miR-621 promotes cell proliferation via targeting CAPRIN1 in hepatocellular carcinoma.
[30209326] Gene expression analysis of Atlantic salmon gills reveals mucin 5 and interleukin 4/13 as key molecules during amoebic gill disease.
[30187949] Restoration of GATA4 expression impedes breast cancer progression by transcriptional repression of ReLA and inhibition of NF-κB signaling.
[30156909] MicroRNA-570 is a novel regulator of cellular senescence and inflammaging.
[30068241] miR-29b inhibits the progression of multiple myeloma through downregulating FOXP1.