GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Chromatin assembly factor 1 subunit A (CAF-1 subunit A) (Chromatin assembly factor I p150 subunit) (CAF-I 150 kDa subunit) (CAF-I p150) (hp150)

 CAF1A_HUMAN             Reviewed;         956 AA.
Q13111; Q6NXG5; Q7Z7K3; Q9UJY8;
18-OCT-2001, integrated into UniProtKB/Swiss-Prot.
28-MAR-2018, sequence version 3.
13-FEB-2019, entry version 179.
RecName: Full=Chromatin assembly factor 1 subunit A;
Short=CAF-1 subunit A;
AltName: Full=Chromatin assembly factor I p150 subunit;
Short=CAF-I 150 kDa subunit;
Short=CAF-I p150;
Short=hp150;
Name=CHAF1A; Synonyms=CAF, CAF1P150;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1; 2
AND 3), AND VARIANT VAL-923.
PubMed=11250073; DOI=10.1016/S0378-1119(01)00335-3;
Dong H., Lin W., Zhang C.-K., Xiong H., Fu G., Jin W.-R., Chen R.,
Chen Z., Qi Z.-T., Huang G.M.;
"Genomic sequence and expression analyses of human chromatin assembly
factor 1 p150 gene.";
Gene 264:187-196(2001).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057824; DOI=10.1038/nature02399;
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J.,
Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M.,
Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E.,
Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M.,
Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C.,
Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M.,
Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T.,
Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H.,
Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S.,
Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J.,
Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M.,
Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J.,
Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D.,
Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A.,
Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I.,
Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
Rubin E.M., Lucas S.M.;
"The DNA sequence and biology of human chromosome 19.";
Nature 428:529-535(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain, and Ovary;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[4]
NUCLEOTIDE SEQUENCE [MRNA] OF 6-956 (ISOFORM 1), AND VARIANT VAL-923.
TISSUE=Cervix adenocarcinoma;
PubMed=7600578; DOI=10.1016/S0092-8674(05)80015-7;
Kaufman P.D., Kobayashi R., Kessler N., Stillman B.;
"The p150 and p60 subunits of chromatin assembly factor I: a molecular
link between newly synthesized histones and DNA replication.";
Cell 81:1105-1114(1995).
[5]
INTERACTION WITH PCNA, AND SUBCELLULAR LOCATION.
PubMed=10052459; DOI=10.1016/S0092-8674(00)80661-3;
Shibahara K., Stillman B.;
"Replication-dependent marking of DNA by PCNA facilitates CAF-1-
coupled inheritance of chromatin.";
Cell 96:575-585(1999).
[6]
INTERACTION WITH PCNA.
PubMed=10648606; DOI=10.1128/MCB.20.4.1206-1218.2000;
Moggs J.G., Grandi P., Quivy J.P., Jonsson Z.O., Hubscher U.,
Becker P.B., Almouzni G.;
"A CAF-1-PCNA-mediated chromatin assembly pathway triggered by sensing
DNA damage.";
Mol. Cell. Biol. 20:1206-1218(2000).
[7]
REVIEW.
PubMed=10893180;
Ridgway P., Almouzni G.;
"CAF-1 and the inheritance of chromatin states: at the crossroads of
DNA replication and repair.";
J. Cell Sci. 113:2647-2658(2000).
[8]
HOMODIMERIZATION.
PubMed=11296234; DOI=10.1093/emboj/20.8.2015;
Quivy J.-P., Grandi P., Almouzni G.;
"Dimerization of the largest subunit of chromatin assembly factor 1:
importance in vitro and during Xenopus early development.";
EMBO J. 20:2015-2027(2001).
[9]
INTERACTION WITH MBD1.
PubMed=12697822; DOI=10.1128/MCB.23.9.3226-3236.2003;
Reese B.E., Bachman K.E., Baylin S.B., Rountree M.R.;
"The methyl-CpG binding protein MBD1 interacts with the p150 subunit
of chromatin assembly factor 1.";
Mol. Cell. Biol. 23:3226-3236(2003).
[10]
FUNCTION, AND INTERACTION WITH MBD1 AND SETDB1.
PubMed=15327775; DOI=10.1016/j.molcel.2004.06.043;
Sarraf S.A., Stancheva I.;
"Methyl-CpG binding protein MBD1 couples histone H3 methylation at
lysine 9 by SETDB1 to DNA replication and chromatin assembly.";
Mol. Cell 15:595-605(2004).
[11]
INTERACTION WITH CBX5.
PubMed=15882967; DOI=10.1016/j.bbrc.2005.04.016;
Lechner M.S., Schultz D.C., Negorev D., Maul G.G., Rauscher F.J. III;
"The mammalian heterochromatin protein 1 binds diverse nuclear
proteins through a common motif that targets the chromoshadow
domain.";
Biochem. Biophys. Res. Commun. 331:929-937(2005).
[12]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=17081983; DOI=10.1016/j.cell.2006.09.026;
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,
Mann M.;
"Global, in vivo, and site-specific phosphorylation dynamics in
signaling networks.";
Cell 127:635-648(2006).
[13]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65, AND IDENTIFICATION
BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18220336; DOI=10.1021/pr0705441;
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D.,
Yates J.R. III;
"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for
efficient phosphoproteomic analysis.";
J. Proteome Res. 7:1346-1351(2008).
[14]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-224; THR-722; SER-772;
SER-775; SER-873 AND SER-951, AND IDENTIFICATION BY MASS SPECTROMETRY
[LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[15]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=19413330; DOI=10.1021/ac9004309;
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,
Mohammed S.;
"Lys-N and trypsin cover complementary parts of the phosphoproteome in
a refined SCX-based approach.";
Anal. Chem. 81:4493-4501(2009).
[16]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=19690332; DOI=10.1126/scisignal.2000007;
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
Rodionov V., Han D.K.;
"Quantitative phosphoproteomic analysis of T cell receptor signaling
reveals system-wide modulation of protein-protein interactions.";
Sci. Signal. 2:RA46-RA46(2009).
[17]
INTERACTION WITH CBX5, AND MUTAGENESIS OF VAL-240 AND LEU-242.
PubMed=20562864; DOI=10.1038/ncb2075;
Nozawa R.S., Nagao K., Masuda H.T., Iwasaki O., Hirota T., Nozaki N.,
Kimura H., Obuse C.;
"Human POGZ modulates dissociation of HP1alpha from mitotic chromosome
arms through Aurora B activation.";
Nat. Cell Biol. 12:719-727(2010).
[18]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-123; SER-138; SER-141;
SER-143; SER-224; THR-722; SER-772; THR-865; SER-873 AND SER-951, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S.,
Mann M.;
"Quantitative phosphoproteomics reveals widespread full
phosphorylation site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[19]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65; SER-141; SER-143;
SER-206; THR-722; SER-772; SER-775 AND SER-951, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21406692; DOI=10.1126/scisignal.2001570;
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J.,
Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V.,
Blagoev B.;
"System-wide temporal characterization of the proteome and
phosphoproteome of human embryonic stem cell differentiation.";
Sci. Signal. 4:RS3-RS3(2011).
[20]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-141; SER-206; SER-310;
SER-772; SER-803; SER-868 AND SER-873, AND IDENTIFICATION BY MASS
SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[21]
SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-182, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25218447; DOI=10.1038/nsmb.2890;
Hendriks I.A., D'Souza R.C., Yang B., Verlaan-de Vries M., Mann M.,
Vertegaal A.C.;
"Uncovering global SUMOylation signaling networks in a site-specific
manner.";
Nat. Struct. Mol. Biol. 21:927-936(2014).
[22]
SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-182, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25114211; DOI=10.1073/pnas.1413825111;
Impens F., Radoshevich L., Cossart P., Ribet D.;
"Mapping of SUMO sites and analysis of SUMOylation changes induced by
external stimuli.";
Proc. Natl. Acad. Sci. U.S.A. 111:12432-12437(2014).
[23]
SUMOYLATION [LARGE SCALE ANALYSIS] AT LYS-182, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=28112733; DOI=10.1038/nsmb.3366;
Hendriks I.A., Lyon D., Young C., Jensen L.J., Vertegaal A.C.,
Nielsen M.L.;
"Site-specific mapping of the human SUMO proteome reveals co-
modification with phosphorylation.";
Nat. Struct. Mol. Biol. 24:325-336(2017).
-!- FUNCTION: Core component of the CAF-1 complex, a complex thought
to mediate chromatin assembly in DNA replication and DNA repair.
Assembles histone octamers onto replicating DNA in vitro. CAF-1
performs the first step of the nucleosome assembly process,
bringing newly synthesized histones H3 and H4 to replicating DNA;
histones H2A/H2B can bind to this chromatin precursor subsequent
to DNA replication to complete the histone octamer. CHAF1A binds
to histones H3 and H4. It may play a role in heterochromatin
maintenance in proliferating cells by bringing newly synthesized
cbx proteins to heterochromatic DNA replication foci (By
similarity). {ECO:0000250, ECO:0000269|PubMed:15327775}.
-!- SUBUNIT: Homodimer. Part of the CAF-1 complex that contains RBBP4,
CHAF1B and CHAF1A. CHAF1A binds directly to CHAF1B. Only minor
amounts of RBBP4 are complexed with CHAF1A and CHAF1B in G1 phase.
CHAF1A binds directly to PCNA and to CBX1. Binds MBD1. Interacts
directly with CBX5 via the PxVxL motif. During DNA replication, it
forms a S phase-specific complex that facilitates DNA methylation
and histone H3 'Lys-9' methylation during replication-coupled
chromatin assembly and is at least composed of the CHAF1A, MBD1
and SETDB1. Interacts with CBX5. {ECO:0000269|PubMed:10052459,
ECO:0000269|PubMed:10648606, ECO:0000269|PubMed:12697822,
ECO:0000269|PubMed:15327775, ECO:0000269|PubMed:15882967,
ECO:0000269|PubMed:20562864}.
-!- INTERACTION:
Self; NbExp=3; IntAct=EBI-1020839, EBI-1020839;
P45973:CBX5; NbExp=7; IntAct=EBI-1020839, EBI-78219;
Q99684:GFI1; NbExp=4; IntAct=EBI-1020839, EBI-949368;
P84243:H3F3B; NbExp=2; IntAct=EBI-1020839, EBI-120658;
Q71DI3:HIST2H3A; NbExp=2; IntAct=EBI-1020839, EBI-750650;
Q9UIS9:MBD1; NbExp=3; IntAct=EBI-1020839, EBI-867196;
P16333:NCK1; NbExp=2; IntAct=EBI-1020839, EBI-389883;
P12004:PCNA; NbExp=4; IntAct=EBI-1020839, EBI-358311;
P27986:PIK3R1; NbExp=2; IntAct=EBI-1020839, EBI-79464;
Q04864:REL; NbExp=3; IntAct=EBI-1020839, EBI-307352;
P15884:TCF4; NbExp=3; IntAct=EBI-1020839, EBI-533224;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:10052459}.
Note=DNA replication foci.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Comment=Experimental confirmation may be lacking for some
isoforms.;
Name=1;
IsoId=Q13111-1; Sequence=Displayed;
Name=2;
IsoId=Q13111-2; Sequence=VSP_004149, VSP_004150;
Name=3;
IsoId=Q13111-3; Sequence=VSP_004151;
-!- DEVELOPMENTAL STAGE: Active complex is found in G1, S and G2
phases.
-!- DOMAIN: Contains one Pro-Xaa-Val-Xaa-Leu (PxVxL) motif, which is
required for interaction with chromoshadow domains. This motif
requires additional residues -7, -6, +4 and +5 of the central Val
which contact the chromoshadow domain.
-!- SIMILARITY: Belongs to the CHAF1A family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAA76736.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=AAF04291.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Sequence=AAH52620.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=AAH52620.1; Type=Miscellaneous discrepancy; Note=Contaminating sequence. Potential poly-A sequence starting in position 426.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF190465; AAF04291.1; ALT_INIT; Genomic_DNA.
EMBL; AC011498; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; KF459577; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC052620; AAH52620.1; ALT_SEQ; mRNA.
EMBL; BC067093; AAH67093.1; -; mRNA.
EMBL; U20979; AAA76736.1; ALT_INIT; mRNA.
CCDS; CCDS32875.1; -. [Q13111-1]
PIR; A56731; A56731.
RefSeq; NP_005474.2; NM_005483.2. [Q13111-1]
UniGene; Hs.79018; -.
ProteinModelPortal; Q13111; -.
SMR; Q13111; -.
BioGrid; 115349; 82.
ComplexPortal; CPX-569; Chromatin assembly factor 1 complex.
CORUM; Q13111; -.
DIP; DIP-31135N; -.
ELM; Q13111; -.
IntAct; Q13111; 54.
MINT; Q13111; -.
STRING; 9606.ENSP00000301280; -.
iPTMnet; Q13111; -.
PhosphoSitePlus; Q13111; -.
BioMuta; CHAF1A; -.
DMDM; 229462842; -.
EPD; Q13111; -.
jPOST; Q13111; -.
PaxDb; Q13111; -.
PeptideAtlas; Q13111; -.
PRIDE; Q13111; -.
ProteomicsDB; 59160; -.
ProteomicsDB; 59161; -. [Q13111-2]
ProteomicsDB; 59162; -. [Q13111-3]
Ensembl; ENST00000301280; ENSP00000301280; ENSG00000167670. [Q13111-1]
GeneID; 10036; -.
KEGG; hsa:10036; -.
UCSC; uc002mal.4; human. [Q13111-1]
CTD; 10036; -.
DisGeNET; 10036; -.
EuPathDB; HostDB:ENSG00000167670.15; -.
GeneCards; CHAF1A; -.
HGNC; HGNC:1910; CHAF1A.
HPA; CAB015186; -.
MIM; 601246; gene.
neXtProt; NX_Q13111; -.
OpenTargets; ENSG00000167670; -.
PharmGKB; PA26446; -.
eggNOG; KOG4364; Eukaryota.
eggNOG; ENOG4111K9K; LUCA.
GeneTree; ENSGT00440000034888; -.
HOGENOM; HOG000111290; -.
HOVERGEN; HBG050779; -.
InParanoid; Q13111; -.
KO; K10750; -.
OMA; QQFTACL; -.
OrthoDB; 1362011at2759; -.
PhylomeDB; Q13111; -.
TreeFam; TF350377; -.
SIGNOR; Q13111; -.
ChiTaRS; CHAF1A; human.
GeneWiki; CHAF1A; -.
GenomeRNAi; 10036; -.
PMAP-CutDB; Q13111; -.
PRO; PR:Q13111; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000167670; Expressed in 219 organ(s), highest expression level in secondary oocyte.
ExpressionAtlas; Q13111; baseline and differential.
Genevisible; Q13111; HS.
GO; GO:0033186; C:CAF-1 complex; IDA:UniProtKB.
GO; GO:0000790; C:nuclear chromatin; IDA:UniProtKB.
GO; GO:0005634; C:nucleus; IBA:GO_Central.
GO; GO:0032991; C:protein-containing complex; IDA:UniProtKB.
GO; GO:0003682; F:chromatin binding; TAS:ProtInc.
GO; GO:0070087; F:chromo shadow domain binding; IPI:BHF-UCL.
GO; GO:0042802; F:identical protein binding; IPI:IntAct.
GO; GO:0051082; F:unfolded protein binding; TAS:ProtInc.
GO; GO:0007049; P:cell cycle; IEA:UniProtKB-KW.
GO; GO:0031497; P:chromatin assembly; IDA:UniProtKB.
GO; GO:0006281; P:DNA repair; IEA:UniProtKB-KW.
GO; GO:0006260; P:DNA replication; IEA:UniProtKB-KW.
GO; GO:0006335; P:DNA replication-dependent nucleosome assembly; IDA:UniProtKB.
GO; GO:0006334; P:nucleosome assembly; IBA:GO_Central.
InterPro; IPR029105; CAF1-p150_C2.
InterPro; IPR029091; CAF1_asu_N.
InterPro; IPR022043; CAF1A.
Pfam; PF15539; CAF1-p150_C2; 1.
Pfam; PF15557; CAF1-p150_N; 1.
Pfam; PF12253; CAF1A; 1.
1: Evidence at protein level;
Alternative splicing; Cell cycle; Chaperone; Complete proteome;
DNA damage; DNA repair; DNA replication; Isopeptide bond; Nucleus;
Phosphoprotein; Polymorphism; Reference proteome; Ubl conjugation.
CHAIN 1 956 Chromatin assembly factor 1 subunit A.
/FTId=PRO_0000089276.
REGION 1 314 Binds to CBX1 chromo shadow domain.
REGION 1 49 Binds to PCNA.
REGION 642 678 Necessary for homodimerization and
competence for chromatin assembly.
REGION 660 956 Binds to p60.
MOTIF 233 246 PxVxL motif.
COMPBIAS 323 453 Arg/Glu/Lys-rich.
COMPBIAS 602 608 Poly-Glu.
COMPBIAS 619 623 Poly-Asp.
COMPBIAS 905 911 Poly-Glu.
MOD_RES 65 65 Phosphoserine.
{ECO:0000244|PubMed:18220336,
ECO:0000244|PubMed:21406692}.
MOD_RES 123 123 Phosphoserine.
{ECO:0000244|PubMed:20068231}.
MOD_RES 138 138 Phosphoserine.
{ECO:0000244|PubMed:20068231}.
MOD_RES 141 141 Phosphoserine.
{ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:21406692,
ECO:0000244|PubMed:23186163}.
MOD_RES 143 143 Phosphoserine.
{ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:21406692}.
MOD_RES 206 206 Phosphoserine.
{ECO:0000244|PubMed:21406692,
ECO:0000244|PubMed:23186163}.
MOD_RES 224 224 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231}.
MOD_RES 310 310 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 722 722 Phosphothreonine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:21406692}.
MOD_RES 772 772 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:21406692,
ECO:0000244|PubMed:23186163}.
MOD_RES 775 775 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:21406692}.
MOD_RES 803 803 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 865 865 Phosphothreonine.
{ECO:0000244|PubMed:20068231}.
MOD_RES 868 868 Phosphoserine.
{ECO:0000244|PubMed:23186163}.
MOD_RES 873 873 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:23186163}.
MOD_RES 951 951 Phosphoserine.
{ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:21406692}.
CROSSLNK 182 182 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO1);
alternate. {ECO:0000244|PubMed:25114211}.
CROSSLNK 182 182 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in SUMO2);
alternate. {ECO:0000244|PubMed:25218447,
ECO:0000244|PubMed:28112733}.
VAR_SEQ 710 749 CFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNG
-> HWVHPESRGDVCRTLRVSSPQSRYLNRLNSCVKSTLSC
FT (in isoform 2). {ECO:0000305}.
/FTId=VSP_004149.
VAR_SEQ 750 956 Missing (in isoform 2). {ECO:0000305}.
/FTId=VSP_004150.
VAR_SEQ 772 944 Missing (in isoform 3). {ECO:0000305}.
/FTId=VSP_004151.
VARIANT 167 167 D -> V (in dbSNP:rs35651457).
/FTId=VAR_055329.
VARIANT 239 239 M -> V (in dbSNP:rs2230635).
/FTId=VAR_055330.
VARIANT 850 850 K -> R (in dbSNP:rs8100525).
/FTId=VAR_055331.
VARIANT 923 923 A -> V (in dbSNP:rs9352).
{ECO:0000269|PubMed:11250073,
ECO:0000269|PubMed:7600578}.
/FTId=VAR_055332.
VARIANT 950 950 A -> S (in dbSNP:rs243383).
/FTId=VAR_055333.
MUTAGEN 240 240 V->E: Abolishes interaction with CBX5;
when associated with E-242.
{ECO:0000269|PubMed:20562864}.
MUTAGEN 242 242 L->E: Abolishes interaction with CBX5;
when associated with E-240.
{ECO:0000269|PubMed:20562864}.
CONFLICT 775 775 S -> T (in Ref. 4; AAA76736).
{ECO:0000305}.
SEQUENCE 956 AA; 106910 MW; 90617F8FE8DB7FD0 CRC64;
MLEELECGAP GARGAATAMD CKDRPAFPVK KLIQARLPFK RLNLVPKGKA DDMSDDQGTS
VQSKSPDLEA SLDTLENNCH VGSDIDFRPK LVNGKGPLDN FLRNRIETSI GQSTVIIDLT
EDSNEQPDSL VDHNKLNSEA SPSREAINGQ REDTGDQQGL LKAIQNDKLA FPGETLSDIP
CKTEEEGVGC GGAGRRGDSQ ECSPRSCPEL TSGPRMCPRK EQDSWSEAGG ILFKGKVPMV
VLQDILAVRP PQIKSLPATP QGKNMTPESE VLESFPEEDS VLSHSSLSSP SSTSSPEGPP
APPKQHSSTS PFPTSTPLRR ITKKFVKGST EKNKLRLQRD QERLGKQLKL RAEREEKEKL
KEEAKRAKEE AKKKKEEEKE LKEKERREKR EKDEKEKAEK QRLKEERRKE RQEALEAKLE
EKRKKEEEKR LREEEKRIKA EKAEITRFFQ KPKTPQAPKT LAGSCGKFAP FEIKEHMVLA
PRRRTAFHPD LCSQLDQLLQ QQSGEFSFLK DLKGRQPLRS GPTHVSTRNA DIFNSDVVIV
ERGKGDGVPE RRKFGRMKLL QFCENHRPAY WGTWNKKTAL IRARDPWAQD TKLLDYEVDS
DEEWEEEEPG ESLSHSEGDD DDDMGEDEDE DDGFFVPHGY LSEDEGVTEE CADPENHKVR
QKLKAKEWDE FLAKGKRFRV LQPVKIGCVW AADRDCAGDD LKVLQQFAAC FLETLPAQEE
QTPKASKRER RDEQILAQLL PLLHGNVNGS KVIIREFQEH CRRGLLSNHT GSPRSPSTTY
LHTPTPSEDA AIPSKSRLKR LISENSVYEK RPDFRMCWYV HPQVLQSFQQ EHLPVPCQWS
YVTSVPSAPK EDSGSVPSTG PSQGTPISLK RKSAGSMCIT QFMKKRRHDG QIGAEDMDGF
QADTEEEEEE EGDCMIVDVP DAAEVQAPCG AASGAGGGVG VDTGKATLTA SPLGAS


Related products :

Catalog number Product name Quantity
EIAAB05135 CAF,CAF-1 subunit A,CAF1P150,CAF-I 150 kDa subunit,CAF-I p150,CHAF1A,Chromatin assembly factor 1 subunit A,Chromatin assembly factor I p150 subunit,Homo sapiens,hp150,Human
EIAAB05136 Bos taurus,Bovine,CAF,CAF-1 subunit A,CAF1P150,CAF-I 150 kDa subunit,CAF-I p150,CHAF1A,Chromatin assembly factor 1 subunit A,Chromatin assembly factor I p150 subunit
EIAAB05133 CAF-1 subunit A,CAF-I 150 kDa subunit,CAF-I p150,Caip150,Chaf1a,Chromatin assembly factor 1 subunit A,Chromatin assembly factor I p150 subunit,Mouse,Mus musculus
EIAAB05134 CAF-1 subunit A,CAF-I 150 kDa subunit,CAF-I p150,CAIP150,CHAF1A,Chicken,Chromatin assembly factor 1 subunit A,Chromatin assembly factor I p150 subunit,Gallus gallus,RCJMB04_12f19
EIAAB33908 CAF-1 subunit C,CAF-I 48 kDa subunit,CAF-I p48,Chromatin assembly factor 1 subunit C,Chromatin assembly factor I p48 subunit,Histone-binding protein RBBP4,Homo sapiens,Human,Nucleosome-remodeling fact
EIAAB05139 CAF-1 subunit B,CAF1A,CAF1P60,CAF-I 60 kDa subunit,CAF-I p60,CHAF1B,Chromatin assembly factor 1 subunit B,Chromatin assembly factor I p60 subunit,Homo sapiens,Human,M-phase phosphoprotein 7,MPHOSPH7,M
EIAAB33905 CAF-1 subunit C,CAF-I 48 kDa subunit,CAF-I p48,Chromatin assembly factor 1 subunit C,Chromatin assembly factor I p48 subunit,Histone-binding protein RBBP4,Mouse,Mus musculus,Nucleosome-remodeling fact
EIAAB33906 CAF-1 subunit C,CAF-I 48 kDa subunit,CAF-I p48,chCAF-1 p48,Chicken,Chromatin assembly factor 1 subunit C,Chromatin assembly factor I p48 subunit,Gallus gallus,Histone-binding protein RBBP4,RBAP48,RBBP
CHAT CHAF1A Gene chromatin assembly factor 1, subunit A (p150)
201-20-1048 CHAF1A{chromatin assembly factor 1, subunit A (p150)}rabbit.pAb 0.1ml
EIAAB05138 CAF-1 subunit B,CAF-I 60 kDa subunit,CAF-I p60,Chaf1b,Chromatin assembly factor 1 subunit B,Chromatin assembly factor I p60 subunit,Mouse,Mus musculus
EIAAB05137 CAF-1 subunit B,CAF1P60,CAF-I 60 kDa subunit,CAF-I p60,CHAF1B,Chicken,Chromatin assembly factor 1 subunit B,Chromatin assembly factor I p60 subunit,Gallus gallus,RCJMB04_5h12
GS-0388a chromatin assembly factor 1, subunit A (p150) primary antibody, Host: Rabbit 200ul
CSB-EL005312BO Bovine chromatin assembly factor 1, subunit A (p150) (CHAF1A) ELISA kit, Species Bovine, Sample Type serum, plasma 96T
CSB-EL005312CH Chicken chromatin assembly factor 1, subunit A (p150) (CHAF1A) ELISA kit, Species Chicken, Sample Type serum, plasma 96T
CSB-EL005312HU Human chromatin assembly factor 1, subunit A (p150) (CHAF1A) ELISA kit, Species Human, Sample Type serum, plasma 96T
CSB-EL005312MO Mouse chromatin assembly factor 1, subunit A (p150) (CHAF1A) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-PA005312GA01HU Rabbit anti-human chromatin assembly factor 1, subunit A (p150) polyclonal Antibody Primary antibody Host:Rabbit IgG 150ul
CSB-PA005312GA01HU Rabbit anti-human chromatin assembly factor 1, subunit A (p150) polyclonal Antibody Primary antibody Host:Rabbit IgG 50ul
30-122 Chromatin assembly factor I (CAF-I) is required for the assembly of histone octamers onto newly-replicated DNA. CAF-I is composed of three protein subunits, p50, p60, and p150. CHAF1B corresponds to t 0.1 mg
EIAAB40078 Chromatin-specific transcription elongation factor 80 kDa subunit,Facilitates chromatin transcription complex 80 kDa subunit,Facilitates chromatin transcription complex subunit SSRP1,FACT 80 kDa subun
E1058b Bovine ELISA Kit FOR Chromatin assembly factor 1 subunit A 96T
E98447Mu ELISA Kit for Chromatin Assembly Factor 1, Subunit B (CHAF1B) 96T/Kit
CHCHD1 CHAF1B Gene chromatin assembly factor 1, subunit B (p60)
CAF1B_CHICK Chicken ELISA Kit FOR Chromatin assembly factor 1 subunit B 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP2272: Pathogenic Escherichia coli infection
WP1566: Citrate cycle (TCA cycle)
WP1614: 1- and 2-Methylnaphthalene degradation
WP1626: Benzoate degradation via CoA ligation
WP1634: Butanoate metabolism
WP1644: DNA replication
WP1655: Geraniol degradation
WP1663: Homologous recombination
WP1671: Methane metabolism
WP1672: Mismatch repair
WP1680: Oxidative phosphorylation
WP1693: Purine metabolism
WP1694: Pyrimidine metabolism
WP1711: Trinitrotoluene degradation
WP1718: Vitamin B6 metabolism
WP2292: Chemokine signaling pathway
WP1046: Signaling of Hepatocyte Growth Factor Receptor
WP1162: Signaling of Hepatocyte Growth Factor Receptor
WP1206: Signaling of Hepatocyte Growth Factor Receptor
WP1235: Signaling of Hepatocyte Growth Factor Receptor
WP1789: Binding of RNA by Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs)
WP1874: Nucleosome assembly
WP1899: Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs)
WP193: Signaling of Hepatocyte Growth Factor Receptor
WP1983: Splicing factor NOVA regulated synpatic proteins

Related Genes :
[TIF4631 YGR162W] Eukaryotic initiation factor 4F subunit p150 (eIF-4F p150) (eIF4F p150) (eIF4G1) (mRNA cap-binding protein complex subunit p150)
[] Non-structural polyprotein p200 (p200) [Cleaved into: Protease/methyltransferase p150 (p150) (EC 3.4.22.-); RNA-directed RNA polymerase p90 (p90) (EC 2.7.7.48) (EC 3.6.1.15) (EC 3.6.4.13)]
[] Non-structural polyprotein p200 (p200) [Cleaved into: Protease/methyltransferase p150 (p150) (EC 3.4.22.-); RNA-directed RNA polymerase p90 (p90) (EC 2.7.7.48) (EC 3.6.1.15) (EC 3.6.4.13)]
[] Non-structural polyprotein p200 (p200) [Cleaved into: Protease/methyltransferase p150 (p150) (EC 3.4.22.-); RNA-directed RNA polymerase p90 (p90) (EC 2.7.7.48) (EC 3.6.1.15) (EC 3.6.4.13)]
[] Non-structural polyprotein p200 (p200) [Cleaved into: Protease/methyltransferase p150 (p150) (EC 3.4.22.-); RNA-directed RNA polymerase p90 (p90) (EC 2.7.7.48) (EC 3.6.1.15) (EC 3.6.4.13)]
[] Non-structural polyprotein p200 (p200) [Cleaved into: Protease/methyltransferase p150 (p150) (EC 3.4.22.-); RNA-directed RNA polymerase p90 (p90) (EC 2.7.7.48) (EC 3.6.1.15) (EC 3.6.4.13)]
[] Non-structural polyprotein p200 (p200) [Cleaved into: Protease/methyltransferase p150 (p150) (EC 3.4.22.-); RNA-directed RNA polymerase p90 (p90) (EC 2.7.7.48) (EC 3.6.1.15) (EC 3.6.4.13)]
[] Non-structural polyprotein p200 (p200) [Cleaved into: Protease/methyltransferase p150 (p150) (EC 3.4.22.-); RNA-directed RNA polymerase p90 (p90) (EC 2.7.7.48) (EC 3.6.1.15) (EC 3.6.4.13)]
[] Non-structural polyprotein p200 (p200) [Cleaved into: Protease/methyltransferase p150 (p150) (EC 3.4.22.-); RNA-directed RNA polymerase p90 (p90) (EC 2.7.7.48) (EC 3.6.1.15) (EC 3.6.4.13)]
[] Non-structural polyprotein p200 (p200) [Cleaved into: Protease/methyltransferase p150 (p150) (EC 3.4.22.-); RNA-directed RNA polymerase p90 (p90) (EC 2.7.7.48) (EC 3.6.1.15) (EC 3.6.4.13)]
[CHAF1B CAF1A CAF1P60 MPHOSPH7 MPP7] Chromatin assembly factor 1 subunit B (CAF-1 subunit B) (Chromatin assembly factor I p60 subunit) (CAF-I 60 kDa subunit) (CAF-I p60) (M-phase phosphoprotein 7)
[DCTN1] Dynactin subunit 1 (150 kDa dynein-associated polypeptide) (DAP-150) (DP-150) (p135) (p150-glued)
[Akap5 Akap150] A-kinase anchor protein 5 (AKAP-5) (A-kinase anchor protein 150 kDa) (AKAP 150) (P150) (cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein)
[Dctn1] Dynactin subunit 1 (150 kDa dynein-associated polypeptide) (DAP-150) (DP-150) (p150-glued)
[ITGB2 CD18 MFI7] Integrin beta-2 (Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta) (Complement receptor C3 subunit beta) (CD antigen CD18)
[Dctn1] Dynactin subunit 1 (150 kDa dynein-associated polypeptide) (DAP-150) (DP-150) (p150-glued)
[env] Envelope glycoprotein gp160 (Env polyprotein) [Cleaved into: Surface protein gp120 (SU) (Glycoprotein 120) (gp120); Transmembrane protein gp41 (TM) (Glycoprotein 41) (gp41)]
[Inpp5d 7a33 Ship Ship1] Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 (EC 3.1.3.86) (Inositol polyphosphate-5-phosphatase of 145 kDa) (SIP-145) (SH2 domain-containing inositol 5'-phosphatase 1) (SH2 domain-containing inositol phosphatase 1) (SHIP-1) (p150Ship)
[Ctr9 Kiaa0155 Sh2bp1] RNA polymerase-associated protein CTR9 homolog (SH2 domain-binding protein 1) (Tetratricopeptide repeat-containing, SH2-binding phosphoprotein of 150 kDa) (TPR-containing, SH2-binding phosphoprotein of 150 kDa) (p150TSP)
[Akap5 Akap150] A-kinase anchor protein 5 (AKAP-5) (A-kinase anchor protein 150 kDa) (AKAP 150) (P150) (cAMP-dependent protein kinase regulatory subunit II high affinity-binding protein)
[Itgb2] Integrin beta-2 (Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta) (Complement receptor C3 subunit beta) (CD antigen CD18)
[ELP1 IKAP IKBKAP] Elongator complex protein 1 (ELP1) (IkappaB kinase complex-associated protein) (IKK complex-associated protein) (p150)
[ITGB2 CD18] Integrin beta-2 (Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta) (Complement receptor C3 subunit beta) (CD antigen CD18)
[ITGB2 CD18] Integrin beta-2 (Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta) (Complement receptor C3 subunit beta) (CD antigen CD18)
[ABL1 ABL JTK7] Tyrosine-protein kinase ABL1 (EC 2.7.10.2) (Abelson murine leukemia viral oncogene homolog 1) (Abelson tyrosine-protein kinase 1) (Proto-oncogene c-Abl) (p150)
[POM152 YMR129W YM9553.05] Nucleoporin POM152 (Nuclear pore protein POM152) (P150) (Pore membrane protein POM152)
[Abl1 Abl] Tyrosine-protein kinase ABL1 (EC 2.7.10.2) (Abelson murine leukemia viral oncogene homolog 1) (Abelson tyrosine-protein kinase 1) (Proto-oncogene c-Abl) (p150)
[Caf1 CG4236] Probable histone-binding protein Caf1 (Chromatin assembly factor 1 p55 subunit) (CAF-1 p55 subunit) (Nucleosome-remodeling factor 55 kDa subunit) (NURF-55) (dCAF-1)
[RPTOR KIAA1303 RAPTOR] Regulatory-associated protein of mTOR (Raptor) (p150 target of rapamycin (TOR)-scaffold protein)
[Rptor Raptor] Regulatory-associated protein of mTOR (Raptor) (p150 target of rapamycin (TOR)-scaffold protein)

Bibliography :