GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

DDB1- and CUL4-associated factor 6 (Androgen receptor complex-associated protein) (ARCAP) (IQ motif and WD repeat-containing protein 1) (Nuclear receptor interaction protein) (NRIP)

 DCAF6_HUMAN             Reviewed;         860 AA.
Q58WW2; A2A295; B4DNB8; Q7L8I0; Q8IXH3; Q8TB19;
11-SEP-2007, integrated into UniProtKB/Swiss-Prot.
26-APR-2005, sequence version 1.
17-JUN-2020, entry version 153.
RecName: Full=DDB1- and CUL4-associated factor 6;
AltName: Full=Androgen receptor complex-associated protein;
Short=ARCAP;
AltName: Full=IQ motif and WD repeat-containing protein 1;
AltName: Full=Nuclear receptor interaction protein;
Short=NRIP;
Name=DCAF6; Synonyms=IQWD1; ORFNames=MSTP055;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH NR3C1
AND AR, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=15784617; DOI=10.1074/jbc.m412169200;
Tsai T.C., Lee Y.L., Hsiao W.C., Tsao Y.P., Chen S.L.;
"NRIP, a novel nuclear receptor interaction protein, enhances the
transcriptional activity of nuclear receptors.";
J. Biol. Chem. 280:20000-20009(2005).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Chang T.-J., Lui W.-Y., Hsia C.-Y., Huang K.-T., Huang M.-H., Lai C.,
King K.-L., Chau G.-Y., Chi C.-W., Li A.F.-Y.;
"ARCAP, a novel androgen receptor coactivator, modulates the proliferation
of hepatoma cells.";
Submitted (JUN-2006) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Heart;
Zhao B., Xu Y.Y., Liu Y.Q., Wang X.Y., Liu B., Ye J., Song L., Zhao Y.,
Cao H.Q., Zhao X.W., Gao Y., Liu L.S., Ding J.F., Gao R.L., Wu Q.Y.,
Qiang B.Q., Yuan J.G., Liew C.C., Zhao M.S., Hui R.T.;
Submitted (DEC-1998) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
TISSUE=Heart;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A.,
Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C.,
Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.,
Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C.,
Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W.,
Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J.,
Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J.,
Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y.,
Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J.,
Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S.,
Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K.,
Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R.,
Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M.,
Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S.,
Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J.,
Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W.,
McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S.,
Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M.,
White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H.,
Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E.,
Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G.,
Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
Hunkapiller M.W., Myers E.W., Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 329-860 (ISOFORM 1), AND VARIANT
ALA-547.
TISSUE=B-cell;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 355-860 (ISOFORM 2).
TISSUE=Testis;
PubMed=11230166; DOI=10.1101/gr.gr1547r;
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S.,
Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J.,
Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W.,
Ottenwaelder B., Obermaier B., Tampe J., Heubner D., Wambutt R., Korn B.,
Klein M., Poustka A.;
"Towards a catalog of human genes and proteins: sequencing and analysis of
500 novel complete protein coding human cDNAs.";
Genome Res. 11:422-435(2001).
[9]
FUNCTION, INTERACTION WITH DDB1; CUL4A AND CUL4B, AND IDENTIFICATION BY
MASS SPECTROMETRY.
PubMed=16949367; DOI=10.1016/j.molcel.2006.08.010;
Jin J., Arias E.E., Chen J., Harper J.W., Walter J.C.;
"A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is
required for S phase destruction of the replication factor Cdt1.";
Mol. Cell 23:709-721(2006).
[10]
FUNCTION.
PubMed=16964240; DOI=10.1038/nature05175;
Angers S., Li T., Yi X., MacCoss M.J., Moon R.T., Zheng N.;
"Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase
machinery.";
Nature 443:590-593(2006).
[11]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-336 AND SER-657, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[12]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-336 AND SER-657, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Leukemic T-cell;
PubMed=19690332; DOI=10.1126/scisignal.2000007;
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,
Rodionov V., Han D.K.;
"Quantitative phosphoproteomic analysis of T cell receptor signaling
reveals system-wide modulation of protein-protein interactions.";
Sci. Signal. 2:RA46-RA46(2009).
[13]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-336; SER-649; THR-654 AND
SER-657, AND IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=20068231; DOI=10.1126/scisignal.2000475;
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L.,
Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.;
"Quantitative phosphoproteomics reveals widespread full phosphorylation
site occupancy during mitosis.";
Sci. Signal. 3:RA3-RA3(2010).
[14]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-336 AND SER-657, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma, and Erythroleukemia;
PubMed=23186163; DOI=10.1021/pr300630k;
Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J.,
Mohammed S.;
"Toward a comprehensive characterization of a human cancer cell
phosphoproteome.";
J. Proteome Res. 12:260-271(2013).
[15]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-336; THR-654 AND SER-657, AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L.,
Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human liver
phosphoproteome.";
J. Proteomics 96:253-262(2014).
-!- FUNCTION: Ligand-dependent coactivator of nuclear receptors. Enhance
transcriptional activity of the nuclear receptors NR3C1 and AR. May
function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein
ligase complex. {ECO:0000269|PubMed:15784617,
ECO:0000269|PubMed:16949367, ECO:0000269|PubMed:16964240}.
-!- PATHWAY: Protein modification; protein ubiquitination.
-!- SUBUNIT: Interacts with the nuclear receptors NR3C1 and AR in the
presence of ligand. Interacts with DDB1, CUL4A and CUL4B.
{ECO:0000269|PubMed:15784617, ECO:0000269|PubMed:16949367}.
-!- INTERACTION:
Q58WW2; Q9UHL9: GTF2IRD1; NbExp=2; IntAct=EBI-2559044, EBI-372530;
Q58WW2; Q99750: MDFI; NbExp=3; IntAct=EBI-2559044, EBI-724076;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000269|PubMed:15784617}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q58WW2-1; Sequence=Displayed;
Name=2;
IsoId=Q58WW2-2; Sequence=VSP_028019;
Name=3;
IsoId=Q58WW2-3; Sequence=VSP_028020, VSP_028021;
Name=4;
IsoId=Q58WW2-4; Sequence=VSP_043312, VSP_028020, VSP_028021;
-!- TISSUE SPECIFICITY: Highly expressed in skeletal muscle and testis.
Expressed to a lesser degree in heart, prostate, and adrenal gland.
{ECO:0000269|PubMed:15784617}.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AY766164; AAX09330.1; -; mRNA.
EMBL; DQ768089; ABG76793.1; -; mRNA.
EMBL; AF116725; AAO15301.1; -; mRNA.
EMBL; AK297847; BAG60180.1; -; mRNA.
EMBL; Z97876; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL033531; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL031287; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AL033532; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471067; EAW90809.1; -; Genomic_DNA.
EMBL; BC025262; AAH25262.2; -; mRNA.
EMBL; AL136738; CAB66672.2; -; mRNA.
CCDS; CCDS1267.2; -. [Q58WW2-2]
CCDS; CCDS30933.1; -. [Q58WW2-1]
CCDS; CCDS55657.1; -. [Q58WW2-3]
CCDS; CCDS55658.1; -. [Q58WW2-4]
RefSeq; NP_001017977.1; NM_001017977.2. [Q58WW2-1]
RefSeq; NP_001185885.1; NM_001198956.1. [Q58WW2-3]
RefSeq; NP_001185886.1; NM_001198957.1. [Q58WW2-4]
RefSeq; NP_060912.2; NM_018442.3. [Q58WW2-2]
PDB; 3I7O; X-ray; 2.80 A; B=9-21.
PDBsum; 3I7O; -.
SMR; Q58WW2; -.
BioGRID; 120933; 54.
DIP; DIP-44678N; -.
IntAct; Q58WW2; 36.
MINT; Q58WW2; -.
STRING; 9606.ENSP00000356814; -.
iPTMnet; Q58WW2; -.
PhosphoSitePlus; Q58WW2; -.
BioMuta; DCAF6; -.
DMDM; 74755134; -.
EPD; Q58WW2; -.
jPOST; Q58WW2; -.
MassIVE; Q58WW2; -.
MaxQB; Q58WW2; -.
PaxDb; Q58WW2; -.
PeptideAtlas; Q58WW2; -.
PRIDE; Q58WW2; -.
ProteomicsDB; 62628; -. [Q58WW2-1]
ProteomicsDB; 62629; -. [Q58WW2-2]
ProteomicsDB; 62630; -. [Q58WW2-3]
ProteomicsDB; 62631; -. [Q58WW2-4]
Antibodypedia; 34346; 139 antibodies.
DNASU; 55827; -.
Ensembl; ENST00000312263; ENSP00000311949; ENSG00000143164. [Q58WW2-1]
Ensembl; ENST00000367840; ENSP00000356814; ENSG00000143164. [Q58WW2-3]
Ensembl; ENST00000367843; ENSP00000356817; ENSG00000143164. [Q58WW2-2]
Ensembl; ENST00000432587; ENSP00000396238; ENSG00000143164. [Q58WW2-4]
GeneID; 55827; -.
KEGG; hsa:55827; -.
UCSC; uc001gev.5; human. [Q58WW2-1]
CTD; 55827; -.
DisGeNET; 55827; -.
EuPathDB; HostDB:ENSG00000143164.15; -.
GeneCards; DCAF6; -.
HGNC; HGNC:30002; DCAF6.
HPA; ENSG00000143164; Tissue enhanced (skeletal).
MIM; 610494; gene.
neXtProt; NX_Q58WW2; -.
OpenTargets; ENSG00000143164; -.
PharmGKB; PA165751150; -.
eggNOG; KOG1310; Eukaryota.
eggNOG; KOG1334; Eukaryota.
eggNOG; ENOG410XQZP; LUCA.
GeneTree; ENSGT00950000182900; -.
InParanoid; Q58WW2; -.
KO; K11795; -.
OMA; RDNGHIT; -.
OrthoDB; 1270484at2759; -.
PhylomeDB; Q58WW2; -.
TreeFam; TF326071; -.
Reactome; R-HSA-8951664; Neddylation.
SignaLink; Q58WW2; -.
UniPathway; UPA00143; -.
BioGRID-ORCS; 55827; 30 hits in 790 CRISPR screens.
ChiTaRS; DCAF6; human.
EvolutionaryTrace; Q58WW2; -.
GenomeRNAi; 55827; -.
Pharos; Q58WW2; Tbio.
PRO; PR:Q58WW2; -.
Proteomes; UP000005640; Chromosome 1.
RNAct; Q58WW2; protein.
Bgee; ENSG00000143164; Expressed in skeletal muscle tissue of rectus abdominis and 225 other tissues.
ExpressionAtlas; Q58WW2; baseline and differential.
Genevisible; Q58WW2; HS.
GO; GO:0080008; C:Cul4-RING E3 ubiquitin ligase complex; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; IBA:GO_Central.
GO; GO:0005829; C:cytosol; IDA:HPA.
GO; GO:0005925; C:focal adhesion; IDA:HPA.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0005634; C:nucleus; IDA:MGI.
GO; GO:0030374; F:nuclear receptor transcription coactivator activity; IDA:MGI.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; IGI:MGI.
GO; GO:0043687; P:post-translational protein modification; TAS:Reactome.
GO; GO:0016567; P:protein ubiquitination; IEA:UniProtKB-UniPathway.
Gene3D; 2.130.10.10; -; 2.
InterPro; IPR000048; IQ_motif_EF-hand-BS.
InterPro; IPR015943; WD40/YVTN_repeat-like_dom_sf.
InterPro; IPR001680; WD40_repeat.
InterPro; IPR017986; WD40_repeat_dom.
InterPro; IPR036322; WD40_repeat_dom_sf.
Pfam; PF00400; WD40; 2.
SMART; SM00320; WD40; 7.
SUPFAM; SSF50978; SSF50978; 1.
PROSITE; PS50096; IQ; 1.
PROSITE; PS50294; WD_REPEATS_REGION; 2.
1: Evidence at protein level;
3D-structure; Alternative splicing; Nucleus; Phosphoprotein; Polymorphism;
Reference proteome; Repeat; Ubl conjugation pathway; WD repeat.
CHAIN 1..860
/note="DDB1- and CUL4-associated factor 6"
/id="PRO_0000304401"
REPEAT 49..88
/note="WD 1"
REPEAT 92..133
/note="WD 2"
REPEAT 139..179
/note="WD 3"
REPEAT 189..229
/note="WD 4"
REPEAT 251..290
/note="WD 5"
DOMAIN 676..705
/note="IQ"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00116"
REPEAT 718..756
/note="WD 6"
REPEAT 759..798
/note="WD 7"
MOD_RES 336
/note="Phosphoserine"
/evidence="ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:19690332, ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:23186163, ECO:0000244|PubMed:24275569"
MOD_RES 649
/note="Phosphoserine"
/evidence="ECO:0000244|PubMed:20068231"
MOD_RES 654
/note="Phosphothreonine"
/evidence="ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:24275569"
MOD_RES 657
/note="Phosphoserine"
/evidence="ECO:0000244|PubMed:18669648,
ECO:0000244|PubMed:19690332, ECO:0000244|PubMed:20068231,
ECO:0000244|PubMed:23186163, ECO:0000244|PubMed:24275569"
MOD_RES 847
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q9DC22"
MOD_RES 850
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q9DC22"
VAR_SEQ 54..84
/note="Missing (in isoform 4)"
/evidence="ECO:0000303|PubMed:14702039"
/id="VSP_043312"
VAR_SEQ 459
/note="S -> SDSPSSVVNKQLGSMSLDEQQ (in isoform 2)"
/evidence="ECO:0000303|PubMed:11230166"
/id="VSP_028019"
VAR_SEQ 459
/note="S -> SEFLRGPEIALLRKRLQQLRLKKAEQQRQQELAAHTQQQPSTSDQSS
HEGSSQDPHASDSPSSVVNKQLGSMSLDEQQ (in isoform 3 and isoform
4)"
/evidence="ECO:0000303|PubMed:14702039, ECO:0000303|Ref.3"
/id="VSP_028020"
VAR_SEQ 675
/note="D -> DRFNIRGTTIGDRIM (in isoform 3 and isoform 4)"
/evidence="ECO:0000303|PubMed:14702039, ECO:0000303|Ref.3"
/id="VSP_028021"
VARIANT 547
/note="V -> A (in dbSNP:rs11558511)"
/evidence="ECO:0000269|PubMed:15489334"
/id="VAR_035020"
HELIX 10..18
/evidence="ECO:0000244|PDB:3I7O"
SEQUENCE 860 AA; 96292 MW; 8C7602D635DAF124 CRC64;
MSRGGSYPHL LWDVRKRSLG LEDPSRLRSR YLGRREFIQR LKLEATLNVH DGCVNTICWN
DTGEYILSGS DDTKLVISNP YSRKVLTTIR SGHRANIFSA KFLPCTNDKQ IVSCSGDGVI
FYTNVEQDAE TNRQCQFTCH YGTTYEIMTV PNDPYTFLSC GEDGTVRWFD TRIKTSCTKE
DCKDDILINC RRAATSVAIC PPIPYYLAVG CSDSSVRIYD RRMLGTRATG NYAGRGTTGM
VARFIPSHLN NKSCRVTSLC YSEDGQEILV SYSSDYIYLF DPKDDTAREL KTPSAEERRE
ELRQPPVKRL RLRGDWSDTG PRARPESERE RDGEQSPNVS LMQRMSDMLS RWFEEASEVA
QSNRGRGRSR PRGGTSQSDI STLPTVPSSP DLEVSETAME VDTPAEQFLQ PSTSSTMSAQ
AHSTSSPTES PHSTPLLSSP DSEQRQSVEA SGHHTHHQSD NNNEKLSPKP GTGEPVLSLH
YSTEGTTTST IKLNFTDEWS SIASSSRGIG SHCKSEGQEE SFVPQSSVQP PEGDSETKAP
EESSEDVTKY QEGVSAENPV ENHINITQSD KFTAKPLDSN SGERNDLNLD RSCGVPEESA
SSEKAKEPET SDQTSTESAT NENNTNPEPQ FQTEATGPSA HEETSTRDSA LQDTDDSDDD
PVLIPGARYR AGPGDRRSAV ARIQEFFRRR KERKEMEELD TLNIRRPLVK MVYKGHRNSR
TMIKEANFWG ANFVMSGSDC GHIFIWDRHT AEHLMLLEAD NHVVNCLQPH PFDPILASSG
IDYDIKIWSP LEESRIFNRK LADEVITRNE LMLEETRNTI TVPASFMLRM LASLNHIRAD
RLEGDRSEGS GQENENEDEE


Related products :

Catalog number Product name Quantity
EIAAB10557 Androgen receptor complex-associated protein,ARCAP,DCAF6,DDB1- and CUL4-associated factor 6,Homo sapiens,Human,IQ motif and WD repeat-containing protein 1,IQWD1,MSTP055,NRIP,Nuclear receptor interacti
EIAAB10558 Dcaf6,DDB1- and CUL4-associated factor 6,IQ motif and WD repeat-containing protein 1,Iqwd1,Mouse,Mus musculus,NRIP,Nuclear receptor interaction protein
EIAAB10559 Dcaf7,DDB1- and CUL4-associated factor 7,Han11,Mouse,Mus musculus,WD repeat-containing protein 68,WD repeat-containing protein An11 homolog,Wdr68
EIAAB10560 DCAF7,DDB1- and CUL4-associated factor 7,HAN11,Homo sapiens,Human,WD repeat-containing protein 68,WD repeat-containing protein An11 homolog,WDR68
Y050624 Anti-NRIP(nuclear receptor interaction protein)-(N-terminal) Antibody 100ug
Y050623 Anti-NRIP(nuclear receptor interaction protein)-(C-terminal) Antibody 100ug
EIAAB45307 BRCA1-A complex subunit RAP80,Homo sapiens,Human,RAP80,Receptor-associated protein 80,Retinoid X receptor-interacting protein 110,RXRIP110,Ubiquitin interaction motif-containing protein 1,UIMC1
EIAAB10505 Dcaf12l1,DDB1- and CUL4-associated factor 12-like protein 1,Mouse,Mus musculus,WD repeat-containing protein 40B,Wdr40b
EIAAB10507 Dcaf12l2,DDB1- and CUL4-associated factor 12-like protein 2,Mouse,Mus musculus,WD repeat-containing protein 40C,Wdr40c
EIAAB10531 DCAF8L2,DDB1- and CUL4-associated factor 8-like protein 2,Homo sapiens,Human,WD repeat-containing protein 42C,WDR42C
EIAAB10530 DCAF8L1,DDB1- and CUL4-associated factor 8-like protein 1,Homo sapiens,Human,WD repeat-containing protein 42B,WDR42B
EIAAB10529 DCAF4L2,DDB1- and CUL4-associated factor 4-like protein 2,Homo sapiens,Human,WD repeat-containing protein 21C,WDR21C
EIAAB10508 DCAF12L2,DDB1- and CUL4-associated factor 12-like protein 2,Homo sapiens,Human,WD repeat-containing protein 40C,WDR40C
EIAAB10528 DCAF4L1,DDB1- and CUL4-associated factor 4-like protein 1,Homo sapiens,Human,WD repeat-containing protein 21B,WDR21B
EIAAB10506 DCAF12L1,DDB1- and CUL4-associated factor 12-like protein 1,Homo sapiens,Human,WD repeat-containing protein 40B,WDR40B
EIAAB26566 70 kDa androgen receptor coactivator,70 kDa AR-activator,Androgen receptor coactivator 70 kDa protein,Androgen receptor-associated protein of 70 kDa,ARA70,ELE1,Homo sapiens,Human,NCOA4,NCoA-4,Nuclear
EIAAB10556 BCRG2,BCRP2,Breakpoint cluster region protein 2,DCAF5,DDB1- and CUL4-associated factor 5,Homo sapiens,Human,KIAA1824,WD repeat-containing protein 22,WDR22
EIAAB10533 Dcaf10,DDB1- and CUL4-associated factor 10,Mouse,Mus musculus,WD repeat-containing protein 32,Wdr32
EIAAB10534 Bos taurus,Bovine,DCAF11,DDB1- and CUL4-associated factor 11,WD repeat-containing protein 23,WDR23
EIAAB10535 Dcaf11,DDB1- and CUL4-associated factor 11,Rat,Rattus norvegicus,WD repeat-containing protein 23,Wdr23
EIAAB10540 Bos taurus,Bovine,DCAF12,DDB1- and CUL4-associated factor 12,WD repeat-containing protein 40A,WDR40A
EIAAB10561 Dcaf8,DDB1- and CUL4-associated factor 8,Rat,Rattus norvegicus,WD repeat-containing protein 42A,Wdr42a
EIAAB10553 Bos taurus,Bovine,DCAF4,DDB1- and CUL4-associated factor 4,WD repeat-containing protein 21A,WDR21A
EIAAB10538 Dcaf12,DDB1- and CUL4-associated factor 12,Kiaa1892,Mouse,Mus musculus,WD repeat-containing protein 40A,Wdr40a
EIAAB10555 Dcaf5,DDB1- and CUL4-associated factor 5,Kiaa1824,Mouse,Mus musculus,WD repeat-containing protein 22,Wdr22
Pathways :
WP2292: Chemokine signaling pathway
WP2272: Pathogenic Escherichia coli infection
WP1502: Mitochondrial biogenesis
WP1493: Carbon assimilation C4 pathway
WP1714: Tyrosine metabolism
WP232: G Protein Signaling Pathways
WP1663: Homologous recombination
WP2032: TSH signaling pathway
WP783: Androgen Receptor Signaling Pathway
WP1673: Naphthalene and anthracene degradation
WP210: Cytoplasmic Ribosomal Proteins
WP346: Protein Modifications
WP810: Signaling of Hepatocyte Growth Factor Receptor
WP1165: G Protein Signaling Pathways
WP1566: Citrate cycle (TCA cycle)
WP68: Androgen Receptor Signaling Pathway
WP94: Signaling of Hepatocyte Growth Factor Receptor
WP1613: 1,4-Dichlorobenzene degradation
WP1892: Protein folding
WP1049: G Protein Signaling Pathways
WP1678: Nucleotide excision repair
WP1206: Signaling of Hepatocyte Growth Factor Receptor
WP1690: Propanoate metabolism
WP444: Signaling of Hepatocyte Growth Factor Receptor
WP1235: Signaling of Hepatocyte Growth Factor Receptor

Related Genes :
[DCAF7 HAN11 WDR68] DDB1- and CUL4-associated factor 7 (WD repeat-containing protein 68) (WD repeat-containing protein An11 homolog)
[DTL CDT2 CDW1 DCAF2 L2DTL RAMP] Denticleless protein homolog (DDB1- and CUL4-associated factor 2) (Lethal(2) denticleless protein homolog) (Retinoic acid-regulated nuclear matrix-associated protein)
[WDR26 CDW2 MIP2 PRO0852] WD repeat-containing protein 26 (CUL4- and DDB1-associated WDR protein 2) (Myocardial ischemic preconditioning up-regulated protein 2)
[DCAF15 C19orf72] DDB1- and CUL4-associated factor 15
[DDB1 XAP1] DNA damage-binding protein 1 (DDB p127 subunit) (DNA damage-binding protein a) (DDBa) (Damage-specific DNA-binding protein 1) (HBV X-associated protein 1) (XAP-1) (UV-damaged DNA-binding factor) (UV-damaged DNA-binding protein 1) (UV-DDB 1) (XPE-binding factor) (XPE-BF) (Xeroderma pigmentosum group E-complementing protein) (XPCe)
[Ddb1] DNA damage-binding protein 1 (DDB p127 subunit) (Damage-specific DNA-binding protein 1) (UV-damaged DNA-binding factor)
[CUL4B KIAA0695] Cullin-4B (CUL-4B)
[BTRC BTRCP FBW1A FBXW1A] F-box/WD repeat-containing protein 1A (E3RSIkappaB) (Epididymis tissue protein Li 2a) (F-box and WD repeats protein beta-TrCP) (pIkappaBalpha-E3 receptor subunit)
[Rora Nr1f1 Rzra] Nuclear receptor ROR-alpha (Nuclear receptor RZR-alpha) (Nuclear receptor subfamily 1 group F member 1) (RAR-related orphan receptor A) (Retinoid-related orphan receptor-alpha)
[RORA NR1F1 RZRA] Nuclear receptor ROR-alpha (Nuclear receptor RZR-alpha) (Nuclear receptor subfamily 1 group F member 1) (RAR-related orphan receptor A) (Retinoid-related orphan receptor-alpha)
[Cul4b mKIAA0695] Cullin-4B (CUL-4B)
[NRIP1] Nuclear receptor-interacting protein 1 (Nuclear factor RIP140) (Receptor-interacting protein 140)
[CUL4A] Cullin-4A (CUL-4A)
[mahj CG10080] Protein mahjong (DDB1- and CUL4-associated factor-like 1) (VPRBP-like protein)
[Ddb1] DNA damage-binding protein 1 (Damage-specific DNA-binding protein 1)
[Cul4a] Cullin-4A (CUL-4A)
[LRWD1 CENP-33 ORCA] Leucine-rich repeat and WD repeat-containing protein 1 (Centromere protein 33) (CENP-33) (Origin recognition complex-associated protein) (ORC-associated protein) (ORCA)
[Dcaf7 Han11 Wdr68] DDB1- and CUL4-associated factor 7 (WD repeat-containing protein 68) (WD repeat-containing protein An11 homolog)
[Cop1 Rfwd2 RNF200] E3 ubiquitin-protein ligase COP1 (EC 2.3.2.27) (Constitutive photomorphogenesis protein 1 homolog) (mCOP1) (RING finger and WD repeat domain protein 2) (RING-type E3 ubiquitin transferase RFWD2)
[Fbxw5 Fbw5] F-box/WD repeat-containing protein 5 (F-box and WD-40 domain-containing protein 5)
[WDR77 MEP50 WD45 HKMT1069 Nbla10071] Methylosome protein 50 (MEP-50) (Androgen receptor cofactor p44) (WD repeat-containing protein 77) (p44/Mep50)
[Nr2c1 Tr2 Tr2-11] Nuclear receptor subfamily 2 group C member 1 (Orphan nuclear receptor TR2) (Testicular receptor 2) (mTR2)
[DDB1] DNA damage-binding protein 1 (Damage-specific DNA-binding protein 1)
[LRWD1 Orca] Leucine-rich repeat and WD repeat-containing protein 1 (ORC-associated protein) (ORCA) (Origin recognition complex-associated protein)
[COP1 RFWD2 RNF200] E3 ubiquitin-protein ligase COP1 (EC 2.3.2.27) (Constitutive photomorphogenesis protein 1 homolog) (hCOP1) (RING finger and WD repeat domain protein 2) (RING finger protein 200) (RING-type E3 ubiquitin transferase RFWD2)
[DDB1 RCJMB04_6h2] DNA damage-binding protein 1 (DDB p127 subunit) (Damage-specific DNA-binding protein 1) (UV-damaged DNA-binding factor)
[Dtl Cdt2 L2dtl Ramp] Denticleless protein homolog (Lethal(2) denticleless protein homolog) (Meth A retinoic acid-regulated nuclear matrix-associated protein) (Meth A RAMP) (Retinoic acid-regulated nuclear matrix-associated protein)
[FBXW5 FBW5 PP3971] F-box/WD repeat-containing protein 5 (F-box and WD-40 domain-containing protein 5)
[ERCC8 CKN1 CSA] DNA excision repair protein ERCC-8 (Cockayne syndrome WD repeat protein CSA)
[Uimc1 Rap80 Rip110 Rxrip110] BRCA1-A complex subunit RAP80 (Receptor-associated protein 80) (Ubiquitin interaction motif-containing protein 1)

Bibliography :