GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Dehydrogenase/reductase SDR family member 4 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase) (CR) (PHCR) (NADPH-dependent retinol dehydrogenase/reductase) (NRDR) (humNRDR) (Peroxisomal short-chain alcohol dehydrogenase) (PSCD) (SCAD-SRL) (Short chain dehydrogenase/reductase family 25C member 2) (Short-chain dehydrogenase/reductase family member 4)

 DHRS4_HUMAN             Reviewed;         278 AA.
Q9BTZ2; B2RB10; B7WNS9; D3YTB8; E2QRL8; O95162; Q20CR0; Q2LC19;
Q2LE81; Q58IU4; Q6E0Y1; Q6UWU3; Q71UQ6; Q8TD03; Q9H3N5; Q9NV08;
10-OCT-2003, integrated into UniProtKB/Swiss-Prot.
05-OCT-2010, sequence version 3.
16-JAN-2019, entry version 164.
RecName: Full=Dehydrogenase/reductase SDR family member 4;
EC=1.1.1.184;
AltName: Full=NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase;
Short=CR;
Short=PHCR;
AltName: Full=NADPH-dependent retinol dehydrogenase/reductase;
Short=NRDR;
Short=humNRDR;
AltName: Full=Peroxisomal short-chain alcohol dehydrogenase;
Short=PSCD;
AltName: Full=SCAD-SRL;
AltName: Full=Short chain dehydrogenase/reductase family 25C member 2;
AltName: Full=Short-chain dehydrogenase/reductase family member 4;
Name=DHRS4; Synonyms=SDR25C2; ORFNames=UNQ851/PRO1800;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), AND SUBCELLULAR
LOCATION.
PubMed=10333503; DOI=10.1042/bj3400561;
Fransen M., Van Veldhoven P.P., Subramani S.;
"Identification of peroxisomal proteins by using M13 phage protein VI
phage display: molecular evidence that mammalian peroxisomes contain a
2,4-dienoyl-CoA reductase.";
Biochem. J. 340:561-568(1999).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Liver;
Furukawa A., Ohnishi T., Huang D., Araki N., Ichikawa Y.;
"cDNA cloning and characterization of peroxisomal short-chain
dehydrogenase / reductase that reduces all-trans retinal to retinol.";
Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
TISSUE=Liver;
PubMed=15473316;
Du J., Huang D.-Y., Liu G.-F., Wang G.-L., Xu X.-L., Wang B., Zhu L.;
"cDNA cloning of a short isoform of human liver NADP (H) -dependent
retinol dehydrogenase/reductase and analysis of its characteristics.";
Yi Chuan Xue Bao 31:661-667(2004).
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tu Q., Yu L., Bi A., Li N., He W., Zhao S.;
"Molecular cloning and expression analysis of a novel human cDNA
encoding a protein homologous to human Hep27 protein.";
Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 7).
Li Y.F., Liu G.-F., Song X.-H., Yang Y.M., Zhong J.C., Du K., Zhu W.,
Huang D.-Y.;
"A minor misassignment error inside segmental duplication (MMEISD) of
DHRS4 gene in human genome sequence.";
Submitted (APR-2004) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Li Y.F., Liu G.-F., Song X.-H., Du K., Huang D.-Y.;
"cDNA cloning of a short isoform of human neuroblastoma NADP(H)-
dependent retinol dehydrogenase/reductase and analysis of its
characteristics.";
Ai Bian Ji Bian Tu Bian 17:321-326(2005).
[7]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), NUCLEOTIDE SEQUENCE [MRNA]
(ISOFORM 6), NUCLEOTIDE SEQUENCE [MRNA] OF 40-278 (ISOFORM 5),
SUBCELLULAR LOCATION (ISOFORM 4), AND TISSUE SPECIFICITY (ISOFORM 4).
TISSUE=Cervix carcinoma, and Neuroblastoma;
PubMed=17230527; DOI=10.1002/ijc.22306;
Song X.-H., Liang B., Liu G.-F., Li R., Xie J.-P., Du K., Huang D.-Y.;
"Expression of a novel alternatively spliced variant of NADP(H)-
dependent retinol dehydrogenase/reductase with deletion of exon 3 in
cervical squamous carcinoma.";
Int. J. Cancer 120:1618-1626(2007).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Placenta, and Skeletal muscle;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S.,
Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J.,
Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J.,
Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A.,
Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H.,
Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D.,
Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale
effort to identify novel human secreted and transmembrane proteins: a
bioinformatics assessment.";
Genome Res. 13:2265-2270(2003).
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=12508121; DOI=10.1038/nature01348;
Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C.,
Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A.,
Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S.,
Sun H., Du H., Pepin K., Artiguenave F., Robert C., Cruaud C.,
Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P.,
Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N.,
Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C.,
Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S.,
Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B.,
Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M.,
Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S.,
Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D.,
Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A.,
Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M.,
Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V.,
Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L.,
Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J.,
Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W.,
Quetier F., Waterston R., Hood L., Weissenbach J.;
"The DNA sequence and analysis of human chromosome 14.";
Nature 421:601-607(2003).
[11]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Lung;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[12]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-140 (ISOFORM 5), AND
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[13]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[14]
ALTERNATIVE SPLICING (ISOFORM 8).
PubMed=23128527; DOI=10.1159/000343326;
Yan Y., Song X., Liu G., Su Z., Du Y., Sui X., Chang X., Huang D.;
"Human NRDRB1, an alternatively spliced isoform of NADP(H)-dependent
retinol dehydrogenase/reductase enhanced enzymatic activity of
Benzil.";
Cell. Physiol. Biochem. 30:1371-1382(2012).
[15]
SUBCELLULAR LOCATION (ISOFORM 7).
PubMed=22227495; DOI=10.1016/j.gene.2011.12.033;
Su Z., Li R., Song X., Liu G., Li Y., Chang X., Li C., Huang D.;
"Identification of a novel isoform of DHRS4 protein with a nuclear
localization signal.";
Gene 494:161-167(2012).
[16]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D.,
Wang L., Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human
liver phosphoproteome.";
J. Proteomics 96:253-262(2014).
[17]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25944712; DOI=10.1002/pmic.201400617;
Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M.,
Ayoub D., Lane L., Bairoch A., Van Dorsselaer A., Carapito C.;
"N-terminome analysis of the human mitochondrial proteome.";
Proteomics 15:2519-2524(2015).
-!- FUNCTION: Reduces all-trans-retinal and 9-cis retinal. Can also
catalyze the oxidation of all-trans-retinol with NADP as co-
factor, but with much lower efficiency. Reduces alkyl phenyl
ketones and alpha-dicarbonyl compounds with aromatic rings, such
as pyrimidine-4-aldehyde, 3-benzoylpyridine, 4-benzoylpyridine,
menadione and 4-hexanoylpyridine. Has no activity towards
aliphatic aldehydes and ketones (By similarity). {ECO:0000250}.
-!- CATALYTIC ACTIVITY:
Reaction=a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH;
Xref=Rhea:RHEA:19257, ChEBI:CHEBI:15378, ChEBI:CHEBI:17087,
ChEBI:CHEBI:35681, ChEBI:CHEBI:57783, ChEBI:CHEBI:58349;
EC=1.1.1.184;
-!- SUBUNIT: Homotetramer. {ECO:0000250}.
-!- SUBCELLULAR LOCATION: Peroxisome {ECO:0000269|PubMed:10333503}.
Note=Isoform 1 is peroxisomal, while isoform 4 is not.
-!- SUBCELLULAR LOCATION: Isoform 7: Nucleus
{ECO:0000269|PubMed:22227495}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=8;
Name=1; Synonyms=SDR-SRL3;
IsoId=Q9BTZ2-1; Sequence=Displayed;
Name=2; Synonyms=SDR-SRL1;
IsoId=Q9BTZ2-2; Sequence=VSP_008586;
Name=3; Synonyms=SDR-SRL2;
IsoId=Q9BTZ2-3; Sequence=VSP_008585;
Name=4; Synonyms=NRDRB1;
IsoId=Q9BTZ2-4; Sequence=VSP_031436;
Name=5; Synonyms=NRDRB2;
IsoId=Q9BTZ2-5; Sequence=VSP_031436, VSP_031438;
Note=Contains a phosphoserine at position 140.
{ECO:0000244|PubMed:18669648};
Name=6; Synonyms=DHRS4L2, NRDRA1;
IsoId=Q9BTZ2-6; Sequence=VSP_031435;
Name=7; Synonyms=NRDRA2;
IsoId=Q9BTZ2-7; Sequence=VSP_031437, VSP_031439;
Note=Mainly localized in the nucleus.;
Name=8; Synonyms=NRDRB1;
IsoId=Q9BTZ2-8; Sequence=VSP_044947, VSP_031436;
Note=Enhanced dicarbonyl reductase activity. high expression in
liver.;
-!- TISSUE SPECIFICITY: Isoform 1 is predominantly expressed in normal
cervix (at protein level). Isoform 4 is expressed in some
neoplastic cervical tissues, but not in normal cervix (at protein
level). Isoform 5 and isoform 6 are expressed in a few neoplastic
cervical tissues.
-!- MISCELLANEOUS: Inhibited by kaempferol, quercetin, genistein and
myristic acid. {ECO:0000250}.
-!- SIMILARITY: Belongs to the short-chain dehydrogenases/reductases
(SDR) family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAD02292.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=AAL61824.2; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=BAB18775.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
Sequence=BAG37057.1; Type=Erroneous initiation; Note=Translation N-terminally extended.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF044127; AAD02292.1; ALT_INIT; mRNA.
EMBL; AB045131; BAB18775.1; ALT_INIT; mRNA.
EMBL; AY071856; AAL61824.2; ALT_INIT; mRNA.
EMBL; AF064256; AAQ13444.1; -; mRNA.
EMBL; AY616182; AAT70757.1; -; mRNA.
EMBL; DQ344810; ABD75823.1; -; mRNA.
EMBL; AY943857; AAX49568.1; -; mRNA.
EMBL; DQ325464; ABC61320.1; -; mRNA.
EMBL; DQ338571; ABC61321.1; -; mRNA.
EMBL; AK001870; BAA91953.1; -; mRNA.
EMBL; AK314448; BAG37057.1; ALT_INIT; mRNA.
EMBL; AY358638; AAQ89001.1; -; mRNA.
EMBL; AL136419; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC003019; AAH03019.1; -; mRNA.
CCDS; CCDS61408.1; -. [Q9BTZ2-7]
CCDS; CCDS61409.1; -. [Q9BTZ2-2]
CCDS; CCDS61410.1; -. [Q9BTZ2-4]
CCDS; CCDS61411.1; -. [Q9BTZ2-5]
CCDS; CCDS61412.1; -. [Q9BTZ2-3]
CCDS; CCDS9605.1; -. [Q9BTZ2-1]
RefSeq; NP_001269916.1; NM_001282987.1. [Q9BTZ2-7]
RefSeq; NP_001269917.1; NM_001282988.1. [Q9BTZ2-4]
RefSeq; NP_001269918.1; NM_001282989.1. [Q9BTZ2-2]
RefSeq; NP_001269919.1; NM_001282990.1. [Q9BTZ2-5]
RefSeq; NP_001269920.1; NM_001282991.1. [Q9BTZ2-3]
RefSeq; NP_066284.2; NM_021004.3. [Q9BTZ2-1]
UniGene; Hs.528385; -.
UniGene; Hs.647569; -.
UniGene; Hs.743442; -.
PDB; 3O4R; X-ray; 1.70 A; A/B/C/D=19-278.
PDBsum; 3O4R; -.
ProteinModelPortal; Q9BTZ2; -.
SMR; Q9BTZ2; -.
BioGrid; 116107; 59.
IntAct; Q9BTZ2; 27.
STRING; 9606.ENSP00000326219; -.
DrugBank; DB00162; Vitamin A.
iPTMnet; Q9BTZ2; -.
PhosphoSitePlus; Q9BTZ2; -.
BioMuta; DHRS4; -.
DMDM; 308153604; -.
EPD; Q9BTZ2; -.
jPOST; Q9BTZ2; -.
MaxQB; Q9BTZ2; -.
PaxDb; Q9BTZ2; -.
PeptideAtlas; Q9BTZ2; -.
PRIDE; Q9BTZ2; -.
ProteomicsDB; 79032; -.
ProteomicsDB; 79033; -. [Q9BTZ2-2]
ProteomicsDB; 79034; -. [Q9BTZ2-3]
ProteomicsDB; 79035; -. [Q9BTZ2-4]
ProteomicsDB; 79036; -. [Q9BTZ2-5]
ProteomicsDB; 79037; -. [Q9BTZ2-6]
ProteomicsDB; 79038; -. [Q9BTZ2-7]
Ensembl; ENST00000313250; ENSP00000326219; ENSG00000157326. [Q9BTZ2-1]
Ensembl; ENST00000397074; ENSP00000380264; ENSG00000157326. [Q9BTZ2-3]
Ensembl; ENST00000397075; ENSP00000380265; ENSG00000157326. [Q9BTZ2-2]
Ensembl; ENST00000558263; ENSP00000453367; ENSG00000157326. [Q9BTZ2-7]
Ensembl; ENST00000558581; ENSP00000452645; ENSG00000157326. [Q9BTZ2-4]
Ensembl; ENST00000559632; ENSP00000453983; ENSG00000157326. [Q9BTZ2-5]
Ensembl; ENST00000643978; ENSP00000493736; ENSG00000284807. [Q9BTZ2-7]
Ensembl; ENST00000645602; ENSP00000496349; ENSG00000284807. [Q9BTZ2-2]
Ensembl; ENST00000645612; ENSP00000494364; ENSG00000284807. [Q9BTZ2-1]
Ensembl; ENST00000646997; ENSP00000495877; ENSG00000284807. [Q9BTZ2-5]
Ensembl; ENST00000647030; ENSP00000496426; ENSG00000284807. [Q9BTZ2-4]
Ensembl; ENST00000647154; ENSP00000495868; ENSG00000284807. [Q9BTZ2-3]
GeneID; 10901; -.
KEGG; hsa:10901; -.
UCSC; uc001wla.5; human. [Q9BTZ2-1]
CTD; 10901; -.
DisGeNET; 10901; -.
EuPathDB; HostDB:ENSG00000157326.18; -.
GeneCards; DHRS4; -.
HGNC; HGNC:16985; DHRS4.
HPA; HPA023972; -.
MIM; 611596; gene.
neXtProt; NX_Q9BTZ2; -.
OpenTargets; ENSG00000157326; -.
PharmGKB; PA128395792; -.
eggNOG; KOG0725; Eukaryota.
eggNOG; COG1028; LUCA.
GeneTree; ENSGT00940000158919; -.
HOVERGEN; HBG105779; -.
InParanoid; Q9BTZ2; -.
KO; K11147; -.
OMA; FELLGAY; -.
OrthoDB; 1194344at2759; -.
PhylomeDB; Q9BTZ2; -.
TreeFam; TF315405; -.
BRENDA; 1.1.1.300; 2681.
Reactome; R-HSA-5365859; RA biosynthesis pathway.
Reactome; R-HSA-9033241; Peroxisomal protein import.
EvolutionaryTrace; Q9BTZ2; -.
GeneWiki; DHRS4; -.
GenomeRNAi; 10901; -.
PRO; PR:Q9BTZ2; -.
Proteomes; UP000005640; Chromosome 14.
Bgee; ENSG00000157326; Expressed in 92 organ(s), highest expression level in liver.
ExpressionAtlas; Q9BTZ2; baseline and differential.
Genevisible; Q9BTZ2; HS.
GO; GO:0005829; C:cytosol; TAS:Reactome.
GO; GO:0005789; C:endoplasmic reticulum membrane; TAS:Reactome.
GO; GO:0005739; C:mitochondrion; ISS:UniProtKB.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0005782; C:peroxisomal matrix; TAS:Reactome.
GO; GO:0005778; C:peroxisomal membrane; HDA:UniProtKB.
GO; GO:0005777; C:peroxisome; IDA:UniProtKB.
GO; GO:0000253; F:3-keto sterol reductase activity; IDA:UniProtKB.
GO; GO:0018455; F:alcohol dehydrogenase [NAD(P)+] activity; IDA:UniProtKB.
GO; GO:0004090; F:carbonyl reductase (NADPH) activity; IDA:UniProtKB.
GO; GO:0052650; F:NADP-retinol dehydrogenase activity; TAS:Reactome.
GO; GO:0016655; F:oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor; IDA:UniProtKB.
GO; GO:0005102; F:signaling receptor binding; IPI:UniProtKB.
GO; GO:0006066; P:alcohol metabolic process; IDA:UniProtKB.
GO; GO:0042180; P:cellular ketone metabolic process; IDA:UniProtKB.
GO; GO:0055114; P:oxidation-reduction process; IDA:UniProtKB.
GO; GO:0006625; P:protein targeting to peroxisome; TAS:Reactome.
GO; GO:0051262; P:protein tetramerization; IDA:UniProtKB.
GO; GO:0008202; P:steroid metabolic process; IDA:UniProtKB.
InterPro; IPR029511; DHRS4-like.
InterPro; IPR036291; NAD(P)-bd_dom_sf.
InterPro; IPR020904; Sc_DH/Rdtase_CS.
InterPro; IPR002347; SDR_fam.
PANTHER; PTHR43943:SF8; PTHR43943:SF8; 1.
PRINTS; PR00081; GDHRDH.
PRINTS; PR00080; SDRFAMILY.
SUPFAM; SSF51735; SSF51735; 1.
PROSITE; PS00061; ADH_SHORT; 1.
1: Evidence at protein level;
3D-structure; Acetylation; Alternative splicing; Complete proteome;
NADP; Nucleus; Oxidoreductase; Peroxisome; Phosphoprotein;
Polymorphism; Reference proteome.
CHAIN 1 278 Dehydrogenase/reductase SDR family member
4.
/FTId=PRO_0000054647.
NP_BIND 36 60 NADP. {ECO:0000250}.
MOTIF 276 278 Microbody targeting signal.
ACT_SITE 182 182 Proton acceptor. {ECO:0000255|PROSITE-
ProRule:PRU10001}.
BINDING 169 169 Substrate. {ECO:0000250}.
MOD_RES 92 92 N6-acetyllysine; alternate.
{ECO:0000250|UniProtKB:Q99LB2}.
MOD_RES 92 92 N6-succinyllysine; alternate.
{ECO:0000250|UniProtKB:Q99LB2}.
MOD_RES 105 105 N6-acetyllysine.
{ECO:0000250|UniProtKB:Q99LB2}.
MOD_RES 216 216 N6-acetyllysine; alternate.
{ECO:0000250|UniProtKB:Q99LB2}.
MOD_RES 216 216 N6-succinyllysine; alternate.
{ECO:0000250|UniProtKB:Q99LB2}.
MOD_RES 220 220 Phosphoserine.
{ECO:0000250|UniProtKB:Q99LB2}.
MOD_RES 227 227 N6-succinyllysine.
{ECO:0000250|UniProtKB:Q99LB2}.
MOD_RES 234 234 N6-succinyllysine.
{ECO:0000250|UniProtKB:Q99LB2}.
VAR_SEQ 1 18 Missing (in isoform 8). {ECO:0000305}.
/FTId=VSP_044947.
VAR_SEQ 19 221 Missing (in isoform 6).
{ECO:0000303|PubMed:17230527}.
/FTId=VSP_031435.
VAR_SEQ 103 222 Missing (in isoform 3).
{ECO:0000303|PubMed:10333503}.
/FTId=VSP_008585.
VAR_SEQ 103 136 Missing (in isoform 4, isoform 5 and
isoform 8).
{ECO:0000303|PubMed:17230527}.
/FTId=VSP_031436.
VAR_SEQ 137 222 Missing (in isoform 2).
{ECO:0000303|PubMed:10333503,
ECO:0000303|PubMed:15473316}.
/FTId=VSP_008586.
VAR_SEQ 137 188 TLDINVKAPALMTKAVVPEMEKRGGGSVVIVSSIAAFSPSP
GFSPYNVSKTA -> RRLSGDRVFHSSLQSISSLDGQGKRG
KHERNPADKKVRRARGLCWHRVFPVL (in isoform
7). {ECO:0000303|Ref.5}.
/FTId=VSP_031437.
VAR_SEQ 178 222 Missing (in isoform 5).
{ECO:0000303|PubMed:17230527}.
/FTId=VSP_031438.
VAR_SEQ 189 278 Missing (in isoform 7).
{ECO:0000303|Ref.5}.
/FTId=VSP_031439.
VARIANT 31 31 A -> T (in dbSNP:rs1043442).
/FTId=VAR_057272.
VARIANT 202 202 P -> S (in dbSNP:rs1043650).
/FTId=VAR_061846.
CONFLICT 37 37 V -> A (in Ref. 8; BAA91953).
{ECO:0000305}.
CONFLICT 50 50 R -> W (in Ref. 7; ABC61321).
{ECO:0000305}.
CONFLICT 89 89 H -> M (in Ref. 4; AAQ13444).
{ECO:0000305}.
CONFLICT 102 102 T -> M (in Ref. 1; AAD02292).
{ECO:0000305}.
CONFLICT 126 126 I -> L (in Ref. 1; AAD02292).
{ECO:0000305}.
TURN 29 32 {ECO:0000244|PDB:3O4R}.
STRAND 34 39 {ECO:0000244|PDB:3O4R}.
HELIX 43 54 {ECO:0000244|PDB:3O4R}.
STRAND 58 64 {ECO:0000244|PDB:3O4R}.
HELIX 66 78 {ECO:0000244|PDB:3O4R}.
STRAND 83 87 {ECO:0000244|PDB:3O4R}.
HELIX 93 107 {ECO:0000244|PDB:3O4R}.
STRAND 112 115 {ECO:0000244|PDB:3O4R}.
TURN 126 128 {ECO:0000244|PDB:3O4R}.
HELIX 131 141 {ECO:0000244|PDB:3O4R}.
HELIX 143 158 {ECO:0000244|PDB:3O4R}.
STRAND 162 167 {ECO:0000244|PDB:3O4R}.
HELIX 170 172 {ECO:0000244|PDB:3O4R}.
HELIX 180 200 {ECO:0000244|PDB:3O4R}.
HELIX 201 203 {ECO:0000244|PDB:3O4R}.
STRAND 205 212 {ECO:0000244|PDB:3O4R}.
HELIX 221 223 {ECO:0000244|PDB:3O4R}.
HELIX 227 237 {ECO:0000244|PDB:3O4R}.
HELIX 245 248 {ECO:0000244|PDB:3O4R}.
HELIX 249 255 {ECO:0000244|PDB:3O4R}.
HELIX 258 260 {ECO:0000244|PDB:3O4R}.
STRAND 267 271 {ECO:0000244|PDB:3O4R}.
SEQUENCE 278 AA; 29537 MW; 3B06A229E1BBE47B CRC64;
MHKAGLLGLC ARAWNSVRMA SSGMTRRDPL ANKVALVTAS TDGIGFAIAR RLAQDGAHVV
VSSRKQQNVD QAVATLQGEG LSVTGTVCHV GKAEDRERLV ATAVKLHGGI DILVSNAAVN
PFFGSIMDVT EEVWDKTLDI NVKAPALMTK AVVPEMEKRG GGSVVIVSSI AAFSPSPGFS
PYNVSKTALL GLTKTLAIEL APRNIRVNCL APGLIKTSFS RMLWMDKEKE ESMKETLRIR
RLGEPEDCAG IVSFLCSEDA SYITGETVVV GGGTPSRL


Related products :

Catalog number Product name Quantity
EIAAB34168 EPHD-2,Epidermal retinol dehydrogenase 2,Mouse,Mus musculus,Rdhe2,RDH-E2,Retinal short-chain dehydrogenase reductase 2,retSDR2,Scdr9,Sdr16c5,Short-chain dehydrogenase reductase 9,Short-chain dehydroge
EIAAB34167 EPHD-2,Epidermal retinol dehydrogenase 2,Homo sapiens,Human,RDHE2,RDH-E2,Retinal short-chain dehydrogenase reductase 2,retSDR2,SDR16C5,Short-chain dehydrogenase_reductase family 16C member 5
EIAAB11177 CR,Dehydrogenase_reductase SDR family member 4,DHRS4,NADPH-dependent carbonyl reductase_NADP-retinol dehydrogenase,NADPH-dependent retinol dehydrogenase_reductase,NDRD,Peroxisomal short-chain alcohol
EIAAB11176 CR,Dehydrogenase_reductase SDR family member 4,Dhrs4,NADPH-dependent carbonyl reductase_NADP-retinol dehydrogenase,NADPH-dependent retinol dehydrogenase_reductase,NDRD,Peroxisomal short-chain alcohol
EIAAB05621 15-hydroxyprostaglandin dehydrogenase [NADP+],20-beta-hydroxysteroid dehydrogenase,Carbonyl reductase [NADPH] 1,CBR,CBR1,NADPH-dependent carbonyl reductase 1,Oryctolagus cuniculus,Prostaglandin 9-keto
EIAAB05616 15-hydroxyprostaglandin dehydrogenase [NADP+],20-beta-hydroxysteroid dehydrogenase,Carbonyl reductase [NADPH] 1,CBR,CBR1,CRN,NADPH-dependent carbonyl reductase 1,Pig,Prostaglandin 9-ketoreductase,Pros
EIAAB05618 15-hydroxyprostaglandin dehydrogenase [NADP+],20-beta-hydroxysteroid dehydrogenase,Carbonyl reductase [NADPH] 1,Cbr,Cbr1,NADPH-dependent carbonyl reductase 1,Prostaglandin 9-ketoreductase,Prostaglandi
EIAAB11173 CR,Dehydrogenase_reductase SDR family member 4,DHRS4,Homo sapiens,Human,humNRDR,NADPH-dependent carbonyl reductase_NADP-retinol dehydrogenase,NADPH-dependent retinol dehydrogenase_reductase,NRDR,Perox
RPR-385 Recombinant Human Short Chain Dehydrogenase Reductase Family 16C, Member 5 5
pro-1385 Recombinant Human Short Chain Dehydrogenase per Reductase Family 16C, Member 5 20
pro-1385 Recombinant Human Short Chain Dehydrogenase per Reductase Family 16C, Member 5 1mg
DR9C7_MOUSE Mouse ELISA Kit FOR Short-chain dehydrogenase per reductase family 9C member 7 96T
E12793m Bovine ELISA Kit FOR Short-chain dehydrogenase per reductase family 9C member 7 96T
pro-1385 Recombinant Human Short Chain Dehydrogenase per Reductase Family 16C, Member 5 5
H0682 Short-chain dehydrogenase reductase family 9C member 7 (SDR9C7), Human, ELISA Kit 96T
H0683 Short-chain dehydrogenase reductase family 9C member 7 (SDR9C7), Mouse, ELISA Kit 96T
H0681 Short-chain dehydrogenase reductase family 9C member 7 (SDR9C7), Bovine, ELISA Kit 96T
H0680 Short-chain dehydrogenase reductase family 42E member 1 (SDR42E1), Mouse, ELISA Kit 96T
H0677 Short-chain dehydrogenase reductase family 16C member 6 (SDR16C6), Mouse, ELISA Kit 96T
H0679 Short-chain dehydrogenase reductase family 42E member 1 (SDR42E1), Human, ELISA Kit 96T
H0678 Short-chain dehydrogenase reductase family 42E member 1 (SDR42E1), Bovine, ELISA Kit 96T
H0676 Short-chain dehydrogenase reductase family 16C member 6 (SDR16C6), Human, ELISA Kit 96T
H0675 Short-chain dehydrogenase reductase family 16C member 6 (SDR16C6), Bovine, ELISA Kit 96T
E0879m Human ELISA Kit FOR Putative short-chain dehydrogenase per reductase family 42E member 2 96T
G5565 Putative short-chain dehydrogenase reductase family 42E member 2 (SDR42E2), Human, ELISA Kit 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1626: Benzoate degradation via CoA ligation
WP1614: 1- and 2-Methylnaphthalene degradation
WP1633: Bisphenol A degradation
WP1647: Fatty acid biosynthesis
WP1654: gamma-Hexachlorocyclohexane degradation
WP1665: Limonene and pinene degradation
WP1673: Naphthalene and anthracene degradation
WP1566: Citrate cycle (TCA cycle)
WP1634: Butanoate metabolism
WP1680: Oxidative phosphorylation
WP1493: Carbon assimilation C4 pathway
WP1461: Photosynthetic Carbon Reduction
WP1567: Glycolysis and Gluconeogenesis
WP1581: Histidine metabolism
WP1612: 1,2-Dichloroethane degradation
WP1615: 3-Chloroacrylic acid degradation
WP1621: Arginine and proline metabolism
WP1622: Ascorbate and aldarate metabolism
WP1627: Benzoate degradation via hydroxylation
WP1628: beta-Alanine metabolism
WP1652: Fructose and mannose metabolism
WP1655: Geraniol degradation
WP1657: Glycerolipid metabolism
WP1666: Linoleic acid metabolism
WP167: Eicosanoid Synthesis

Related Genes :
[DHRS4 SDR25C2 UNQ851/PRO1800] Dehydrogenase/reductase SDR family member 4 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase) (CR) (PHCR) (NADPH-dependent retinol dehydrogenase/reductase) (NRDR) (humNRDR) (Peroxisomal short-chain alcohol dehydrogenase) (PSCD) (SCAD-SRL) (Short chain dehydrogenase/reductase family 25C member 2) (Short-chain dehydrogenase/reductase family member 4)
[Dhrs4 D14Ucla2] Dehydrogenase/reductase SDR family member 4 (EC 1.1.1.184) (NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase) (CR) (PHCR) (NADPH-dependent retinol dehydrogenase/reductase) (NDRD) (mouNRDR) (Peroxisomal short-chain alcohol dehydrogenase) (PSCD)
[RDH11 ARSDR1 PSDR1 SDR7C1 CGI-82] Retinol dehydrogenase 11 (EC 1.1.1.300) (Androgen-regulated short-chain dehydrogenase/reductase 1) (HCV core-binding protein HCBP12) (Prostate short-chain dehydrogenase/reductase 1) (Retinal reductase 1) (RalR1) (Short chain dehydrogenase/reductase family 7C member 1)
[DHRS2 SDR25C1] Dehydrogenase/reductase SDR family member 2, mitochondrial (EC 1.1.1.-) (Dicarbonyl reductase HEP27) (Protein D) (Short chain dehydrogenase/reductase family 25C member 1)
[CBR1 CBR CRN SDR21C1] Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (15-hydroxyprostaglandin dehydrogenase [NADP(+)]) (EC 1.1.1.197) (NADPH-dependent carbonyl reductase 1) (Prostaglandin 9-ketoreductase) (Prostaglandin-E(2) 9-reductase) (EC 1.1.1.189) (Short chain dehydrogenase/reductase family 21C member 1)
[RDH12 SDR7C2] Retinol dehydrogenase 12 (EC 1.1.1.300) (All-trans and 9-cis retinol dehydrogenase) (Short chain dehydrogenase/reductase family 7C member 2)
[SDR16C5 RDHE2] Epidermal retinol dehydrogenase 2 (EPHD-2) (RDH-E2) (EC 1.1.1.105) (Retinal short-chain dehydrogenase reductase 2) (retSDR2) (Short-chain dehydrogenase/reductase family 16C member 5)
[RDH13 SDR7C3 PSEC0082 UNQ736/PRO1430] Retinol dehydrogenase 13 (EC 1.1.1.300) (Short chain dehydrogenase/reductase family 7C member 3)
[RDH5 HSD17B9 RDH1 SDR9C5] 11-cis retinol dehydrogenase (11-cis RDH) (11-cis RoDH) (EC 1.1.1.315) (9-cis retinol dehydrogenase) (9cRDH) (Retinol dehydrogenase 5) (Short chain dehydrogenase/reductase family 9C member 5)
[CBR4 SDR45C1] Carbonyl reductase family member 4 (EC 1.-.-.-) (3-ketoacyl-[acyl-carrier-protein] reductase beta subunit) (KAR beta subunit) (3-oxoacyl-[acyl-carrier-protein] reductase) (EC 1.1.1.-) (Quinone reductase CBR4) (Short chain dehydrogenase/reductase family 45C member 1)
[HSD17B8 FABGL HKE6 RING2 SDR30C1] Estradiol 17-beta-dehydrogenase 8 (EC 1.1.1.62) (17-beta-hydroxysteroid dehydrogenase 8) (17-beta-HSD 8) (3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit) (KAR alpha subunit) (3-oxoacyl-[acyl-carrier-protein] reductase) (EC 1.1.1.-) (Protein Ke6) (Ke-6) (Really interesting new gene 2 protein) (Short chain dehydrogenase/reductase family 30C member 1) (Testosterone 17-beta-dehydrogenase 8) (EC 1.1.1.239)
[HSD17B10 ERAB HADH2 MRPP2 SCHAD SDR5C1 XH98G2] 3-hydroxyacyl-CoA dehydrogenase type-2 (EC 1.1.1.35) (17-beta-hydroxysteroid dehydrogenase 10) (17-beta-HSD 10) (EC 1.1.1.51) (2-methyl-3-hydroxybutyryl-CoA dehydrogenase) (MHBD) (3-hydroxy-2-methylbutyryl-CoA dehydrogenase) (EC 1.1.1.178) (3-hydroxyacyl-CoA dehydrogenase type II) (Endoplasmic reticulum-associated amyloid beta-peptide-binding protein) (Mitochondrial ribonuclease P protein 2) (Mitochondrial RNase P protein 2) (Short chain dehydrogenase/reductase family 5C member 1) (Short-chain type dehydrogenase/reductase XH98G2) (Type II HADH)
[HSD17B11 DHRS8 PAN1B SDR16C2 PSEC0029 UNQ207/PRO233] Estradiol 17-beta-dehydrogenase 11 (EC 1.1.1.62) (17-beta-hydroxysteroid dehydrogenase 11) (17-beta-HSD 11) (17bHSD11) (17betaHSD11) (17-beta-hydroxysteroid dehydrogenase XI) (17-beta-HSD XI) (17betaHSDXI) (Cutaneous T-cell lymphoma-associated antigen HD-CL-03) (CTCL-associated antigen HD-CL-03) (Dehydrogenase/reductase SDR family member 8) (Retinal short-chain dehydrogenase/reductase 2) (retSDR2) (Short chain dehydrogenase/reductase family 16C member 2)
[HSD17B14 DHRS10 SDR3 SDR47C1 UNQ502/PRO474] 17-beta-hydroxysteroid dehydrogenase 14 (17-beta-HSD 14) (EC 1.1.1.-) (17-beta-hydroxysteroid dehydrogenase DHRS10) (Dehydrogenase/reductase SDR family member 10) (Retinal short-chain dehydrogenase/reductase retSDR3) (Short chain dehydrogenase/reductase family 47C member 1)
[DCXR SDR20C1] L-xylulose reductase (XR) (EC 1.1.1.10) (Carbonyl reductase II) (Dicarbonyl/L-xylulose reductase) (Kidney dicarbonyl reductase) (kiDCR) (Short chain dehydrogenase/reductase family 20C member 1) (Sperm surface protein P34H)
[Sdr16c5 Rdhe2 Scdr9] Epidermal retinol dehydrogenase 2 (EPHD-2) (RDH-E2) (EC 1.1.1.105) (Retinal short-chain dehydrogenase reductase 2) (retSDR2) (Short-chain dehydrogenase reductase 9) (Short-chain dehydrogenase/reductase family 16C member 5)
[Dhrs11 Sdr24c1] Dehydrogenase/reductase SDR family member 11 (17-beta-hydroxysteroid dehydrogenase) (3-beta-hydroxysteroid 3-dehydrogenase) (EC 1.1.1.270) (Estradiol 17-beta-dehydrogenase) (EC 1.1.1.62) (Short-chain dehydrogenase/reductase family 24C member 1)
[BDH2 DHRS6 SDR15C1 UNQ6308/PRO20933] 3-hydroxybutyrate dehydrogenase type 2 (EC 1.1.1.-) (EC 1.1.1.30) (Dehydrogenase/reductase SDR family member 6) (Oxidoreductase UCPA) (R-beta-hydroxybutyrate dehydrogenase) (Short chain dehydrogenase/reductase family 15C member 1)
[AKR1C3 DDH1 HSD17B5 KIAA0119 PGFS] Aldo-keto reductase family 1 member C3 (EC 1.-.-.-) (17-beta-hydroxysteroid dehydrogenase type 5) (17-beta-HSD 5) (3-alpha-HSD type II, brain) (3-alpha-hydroxysteroid dehydrogenase type 2) (3-alpha-HSD type 2) (EC 1.1.1.357) (Chlordecone reductase homolog HAKRb) (Dihydrodiol dehydrogenase 3) (DD-3) (DD3) (Dihydrodiol dehydrogenase type I) (HA1753) (Indanol dehydrogenase) (EC 1.1.1.112) (Prostaglandin F synthase) (PGFS) (EC 1.1.1.188) (Testosterone 17-beta-dehydrogenase 5) (EC 1.1.1.239) (EC 1.1.1.64) (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase) (EC 1.3.1.20)
[HSD11B1 HSD11 HSD11L SDR26C1] Corticosteroid 11-beta-dehydrogenase isozyme 1 (EC 1.1.1.146) (11-beta-hydroxysteroid dehydrogenase 1) (11-DH) (11-beta-HSD1) (Short chain dehydrogenase/reductase family 26C member 1)
[Akr1a1 Akr1a4] Aldo-keto reductase family 1 member A1 (EC 1.1.1.2) (EC 1.1.1.33) (EC 1.1.1.372) (EC 1.1.1.54) (Alcohol dehydrogenase [NADP(+)]) (Aldehyde reductase) (Glucuronate reductase) (EC 1.1.1.19) (Glucuronolactone reductase) (EC 1.1.1.20)
[Cbr1 Cbr] Carbonyl reductase [NADPH] 1 (EC 1.1.1.184) (15-hydroxyprostaglandin dehydrogenase [NADP(+)]) (EC 1.1.1.197) (NADPH-dependent carbonyl reductase 1) (Prostaglandin 9-ketoreductase) (Prostaglandin-E(2) 9-reductase) (EC 1.1.1.189)
[HPGD PGDH1 SDR36C1] 15-hydroxyprostaglandin dehydrogenase [NAD(+)] (15-PGDH) (EC 1.1.1.141) (Prostaglandin dehydrogenase 1) (Short chain dehydrogenase/reductase family 36C member 1)
[SDR9C7 RDHS SDRO] Short-chain dehydrogenase/reductase family 9C member 7 (EC 1.1.1.-) (Orphan short-chain dehydrogenase/reductase) (SDR-O) (RDH-S)
[DHRSX CXorf11 DHRS5X SDR46C1 SDR7C6 UNQ6508/PRO21433] Dehydrogenase/reductase SDR family member on chromosome X (EC 1.1.-.-) (DHRSXY) (Short chain dehydrogenase/reductase family 46C member 1) (Short chain dehydrogenase/reductase family 7C member 6)
[AKR1C4 CHDR] Aldo-keto reductase family 1 member C4 (EC 1.1.1.-) (3-alpha-HSD1) (3-alpha-hydroxysteroid dehydrogenase type I) (EC 1.1.1.357) (Chlordecone reductase) (CDR) (EC 1.1.1.225) (Dihydrodiol dehydrogenase 4) (DD-4) (DD4) (HAKRA)
[AKR1C1 DDH DDH1] Aldo-keto reductase family 1 member C1 (EC 1.1.1.-) (20-alpha-hydroxysteroid dehydrogenase) (20-alpha-HSD) (EC 1.1.1.149) (Chlordecone reductase homolog HAKRC) (Dihydrodiol dehydrogenase 1/2) (DD1/DD2) (High-affinity hepatic bile acid-binding protein) (HBAB) (Indanol dehydrogenase) (EC 1.1.1.112) (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase) (EC 1.3.1.20)
[AKR1C3] Aldo-keto reductase family 1 member C3 homolog (EC 1.-.-.-) (17-beta-hydroxysteroid dehydrogenase type 5) (17-beta-HSD 5) (3-alpha-hydroxysteroid dehydrogenase type 2) (3-alpha-HSD type 2) (EC 1.1.1.357) (Indanol dehydrogenase) (EC 1.1.1.112) (Prostaglandin F synthase) (PGFS) (EC 1.1.1.188) (Testosterone 17-beta-dehydrogenase 5) (EC 1.1.1.239) (EC 1.1.1.64) (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase) (EC 1.3.1.20)
[AKR1C2 DDH2] Aldo-keto reductase family 1 member C2 (EC 1.-.-.-) (3-alpha-HSD3) (Chlordecone reductase homolog HAKRD) (Dihydrodiol dehydrogenase 2) (DD-2) (DD2) (Dihydrodiol dehydrogenase/bile acid-binding protein) (DD/BABP) (Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase) (EC 1.3.1.20) (Type III 3-alpha-hydroxysteroid dehydrogenase) (EC 1.1.1.357)
[HSD11B2 HSD11K SDR9C3] Corticosteroid 11-beta-dehydrogenase isozyme 2 (EC 1.1.1.-) (11-beta-hydroxysteroid dehydrogenase type 2) (11-DH2) (11-beta-HSD2) (11-beta-hydroxysteroid dehydrogenase type II) (11-HSD type II) (11-beta-HSD type II) (NAD-dependent 11-beta-hydroxysteroid dehydrogenase) (11-beta-HSD) (Short chain dehydrogenase/reductase family 9C member 3)

Bibliography :
?>