GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Doublesex- and mab-3-related transcription factor 1 (DM domain expressed in testis protein 1)

 DMRT1_HUMAN             Reviewed;         373 AA.
Q9Y5R6; B2R913; Q6T1H8; Q6T1H9; Q8IW77;
01-DEC-2000, integrated into UniProtKB/Swiss-Prot.
10-MAY-2005, sequence version 2.
13-FEB-2019, entry version 153.
RecName: Full=Doublesex- and mab-3-related transcription factor 1;
AltName: Full=DM domain expressed in testis protein 1;
Name=DMRT1; Synonyms=DMT1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND VARIANTS THR-45; SER-221;
SER-281 AND LEU-295.
TISSUE=Testis;
PubMed=10332030; DOI=10.1093/hmg/8.6.989;
Raymond C.S., Parker E.D., Kettlewell J.R., Brown L.G., Page D.C.,
Kusz K., Jaruzelska J., Reinberg Y., Flejter W.L., Bardwell V.J.,
Hirsch B., Zarkower D.;
"A region of human chromosome 9p required for testis development
contains two genes related to known sexual regulators.";
Hum. Mol. Genet. 8:989-996(1999).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-45, AND TISSUE
SPECIFICITY.
TISSUE=Testis;
PubMed=10857744; DOI=10.1006/geno.2000.6160;
Calvari V., Bertini V., De Grandi A., Peverali G., Zuffardi O.,
Ferguson-Smith M., Knudtzon J., Camerino G., Borsani G., Guioli S.;
"A new submicroscopic deletion that refines the 9p region for sex
reversal.";
Genomics 65:203-212(2000).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), AND VARIANT THR-45.
PubMed=16617334; DOI=10.1038/sj.cr.7310050;
Cheng H.H., Ying M., Tian Y.H., Guo Y., McElreavey K., Zhou R.J.;
"Transcriptional diversity of DMRT1 (dsx- and mab3-related
transcription factor 1) in human testis.";
Cell Res. 16:389-393(2006).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
TISSUE=Testis;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15164053; DOI=10.1038/nature02465;
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E.,
Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C.,
Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S.,
Babbage A.K., Babbage S., Bagguley C.L., Bailey J., Banerjee R.,
Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P.,
Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W.,
Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G.,
Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M.,
Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W.,
Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A.,
Frankland J.A., French L., Fricker D.G., Garner P., Garnett J.,
Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S.,
Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E.,
Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D.,
Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E.,
Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K.,
Kimberley A.M., King A., Knights A., Laird G.K., Langford C.,
Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M.,
Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S.,
McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J.,
Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R.,
Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M.,
Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M.,
Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A.,
Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P.,
Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W.,
Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M.,
Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S.,
Rogers J., Dunham I.;
"DNA sequence and analysis of human chromosome 9.";
Nature 429:369-374(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
POSSIBLE INVOLVEMENT IN SRXY4.
PubMed=9718346; DOI=10.1086/302016;
Flejter W.L., Fergestad J., Gorski J., Varvill T.,
Chandrasekharappa S.;
"A gene involved in XY sex reversal is located on chromosome 9, distal
to marker D9S1779.";
Am. J. Hum. Genet. 63:794-802(1998).
[9]
POSSIBLE INVOLVEMENT IN SRXY4.
PubMed=9490411; DOI=10.1038/35618;
Raymond C.S., Shamu C.E., Shen M.M., Seifert K.J., Hirsch B.,
Hodgkin J., Zarkower D.;
"Evidence for evolutionary conservation of sex-determining genes.";
Nature 391:691-695(1998).
[10]
POSSIBLE INVOLVEMENT IN TGCT.
PubMed=20543847; DOI=10.1038/ng.607;
Turnbull C., Rapley E.A., Seal S., Pernet D., Renwick A., Hughes D.,
Ricketts M., Linger R., Nsengimana J., Deloukas P., Huddart R.A.,
Bishop D.T., Easton D.F., Stratton M.R., Rahman N.;
"Variants near DMRT1, TERT and ATF7IP are associated with testicular
germ cell cancer.";
Nat. Genet. 42:604-607(2010).
[11]
POSSIBLE INVOLVEMENT IN SRXY4.
PubMed=21048976; DOI=10.1371/journal.pone.0015392;
Tannour-Louet M., Han S., Corbett S.T., Louet J.F., Yatsenko S.,
Meyers L., Shaw C.A., Kang S.H., Cheung S.W., Lamb D.J.;
"Identification of de novo copy number variants associated with human
disorders of sexual development.";
PLoS ONE 5:E15392-E15392(2010).
[12]
TISSUE SPECIFICITY.
PubMed=23436708; DOI=10.1002/pmic.201200489;
Liu M., Hu Z., Qi L., Wang J., Zhou T., Guo Y., Zeng Y., Zheng B.,
Wu Y., Zhang P., Chen X., Tu W., Zhang T., Zhou Q., Jiang M., Guo X.,
Zhou Z., Sha J.;
"Scanning of novel cancer/testis proteins by human testis proteomic
analysis.";
Proteomics 13:1200-1210(2013).
-!- FUNCTION: Transcription factor that plays a key role in male sex
determination and differentiation by controlling testis
development and male germ cell proliferation. Plays a central role
in spermatogonia by inhibiting meiosis in undifferentiated
spermatogonia and promoting mitosis, leading to spermatogonial
development and allowing abundant and continuous production of
sperm. Acts both as a transcription repressor and activator:
prevents meiosis by restricting retinoic acid (RA)-dependent
transcription and repressing STRA8 expression and promotes
spermatogonial development by activating spermatogonial
differentiation genes, such as SOHLH1. Also plays a key role in
postnatal sex maintenance by maintaining testis determination and
preventing feminization: represses transcription of female
promoting genes such as FOXL2 and activates male-specific genes.
May act as a tumor suppressor. May also play a minor role in
oogenesis (By similarity). {ECO:0000250}.
-!- INTERACTION:
Self; NbExp=4; IntAct=EBI-7963304, EBI-7963304;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000255|PROSITE-
ProRule:PRU00070}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1; Synonyms=DMRT1a;
IsoId=Q9Y5R6-1; Sequence=Displayed;
Name=2; Synonyms=DMRT1b;
IsoId=Q9Y5R6-2; Sequence=VSP_042961, VSP_042962;
Name=3; Synonyms=DMRT1c;
IsoId=Q9Y5R6-3; Sequence=VSP_042959, VSP_042960;
-!- TISSUE SPECIFICITY: Testis-specific. Expressed in prostate cancer
(at protein level). {ECO:0000269|PubMed:10857744,
ECO:0000269|PubMed:23436708}.
-!- DEVELOPMENTAL STAGE: Expressed in the genital ridges of six-week-
old male embryos. Becomes confined to the forming seminiferous
tubules (probably Sertoli cells) at seven weeks. Not detected in
female embryos.
-!- DISEASE: Testicular germ cell tumor (TGCT) [MIM:273300]: A common
malignancy in males representing 95% of all testicular neoplasms.
TGCTs have various pathologic subtypes including: unclassified
intratubular germ cell neoplasia, seminoma (including cases with
syncytiotrophoblastic cells), spermatocytic seminoma, embryonal
carcinoma, yolk sac tumor, choriocarcinoma, and teratoma.
{ECO:0000269|PubMed:20543847}. Note=The disease may be caused by
mutations affecting the gene represented in this entry.
-!- DISEASE: 46,XY sex reversal 4 (SRXY4) [MIM:154230]: A condition
characterized by male-to-female sex reversal in the presence of a
normal 46,XY karyotype. Patients display complete or partial
gonadal dysgenesis and a chromosome 9p deletion.
{ECO:0000269|PubMed:21048976, ECO:0000269|PubMed:9490411,
ECO:0000269|PubMed:9718346}. Note=The disease may be caused by
mutations affecting the gene represented in this entry.
-!- SIMILARITY: Belongs to the DMRT family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF130728; AAD40474.1; -; mRNA.
EMBL; AL162131; CAB82427.1; -; mRNA.
EMBL; AY442914; AAR89619.1; -; mRNA.
EMBL; AY442915; AAR89620.1; -; mRNA.
EMBL; AK313594; BAG36360.1; -; mRNA.
EMBL; AJ276801; CAB82851.1; -; mRNA.
EMBL; AL136365; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471071; EAW58820.1; -; Genomic_DNA.
EMBL; BC040847; AAH40847.1; -; mRNA.
CCDS; CCDS6442.1; -. [Q9Y5R6-1]
RefSeq; NP_068770.2; NM_021951.2. [Q9Y5R6-1]
UniGene; Hs.98586; -.
PDB; 4YJ0; X-ray; 3.81 A; A/B/C=70-131.
PDBsum; 4YJ0; -.
ProteinModelPortal; Q9Y5R6; -.
SMR; Q9Y5R6; -.
BioGrid; 108101; 2.
DIP; DIP-58084N; -.
IntAct; Q9Y5R6; 1.
MINT; Q9Y5R6; -.
STRING; 9606.ENSP00000371711; -.
iPTMnet; Q9Y5R6; -.
PhosphoSitePlus; Q9Y5R6; -.
BioMuta; DMRT1; -.
DMDM; 83305820; -.
jPOST; Q9Y5R6; -.
PaxDb; Q9Y5R6; -.
PeptideAtlas; Q9Y5R6; -.
PRIDE; Q9Y5R6; -.
ProteomicsDB; 86485; -.
ProteomicsDB; 86486; -. [Q9Y5R6-2]
ProteomicsDB; 86487; -. [Q9Y5R6-3]
DNASU; 1761; -.
Ensembl; ENST00000382276; ENSP00000371711; ENSG00000137090. [Q9Y5R6-1]
GeneID; 1761; -.
KEGG; hsa:1761; -.
UCSC; uc003zgv.5; human. [Q9Y5R6-1]
CTD; 1761; -.
DisGeNET; 1761; -.
EuPathDB; HostDB:ENSG00000137090.11; -.
GeneCards; DMRT1; -.
GeneReviews; DMRT1; -.
HGNC; HGNC:2934; DMRT1.
HPA; HPA027850; -.
MalaCards; DMRT1; -.
MIM; 154230; phenotype.
MIM; 273300; phenotype.
MIM; 602424; gene.
neXtProt; NX_Q9Y5R6; -.
OpenTargets; ENSG00000137090; -.
Orphanet; 242; 46,XY complete gonadal dysgenesis.
PharmGKB; PA27381; -.
eggNOG; KOG3815; Eukaryota.
eggNOG; ENOG410XSK9; LUCA.
GeneTree; ENSGT00940000156489; -.
HOGENOM; HOG000059585; -.
HOVERGEN; HBG055845; -.
InParanoid; Q9Y5R6; -.
KO; K19488; -.
OMA; NRHAMSS; -.
OrthoDB; 1209937at2759; -.
PhylomeDB; Q9Y5R6; -.
TreeFam; TF317837; -.
ChiTaRS; DMRT1; human.
GeneWiki; DMRT1; -.
GenomeRNAi; 1761; -.
PRO; PR:Q9Y5R6; -.
Proteomes; UP000005640; Chromosome 9.
Bgee; ENSG00000137090; Expressed in 19 organ(s), highest expression level in female gonad.
ExpressionAtlas; Q9Y5R6; baseline and differential.
Genevisible; Q9Y5R6; HS.
GO; GO:0005737; C:cytoplasm; IEA:Ensembl.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0003682; F:chromatin binding; IEA:Ensembl.
GO; GO:0001228; F:DNA-binding transcription activator activity, RNA polymerase II-specific; IEA:Ensembl.
GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; ISA:NTNU_SB.
GO; GO:0042802; F:identical protein binding; IPI:IntAct.
GO; GO:0046872; F:metal ion binding; IEA:UniProtKB-KW.
GO; GO:0046982; F:protein heterodimerization activity; IBA:GO_Central.
GO; GO:0042803; F:protein homodimerization activity; IBA:GO_Central.
GO; GO:0000987; F:proximal promoter sequence-specific DNA binding; ISS:UniProtKB.
GO; GO:0000977; F:RNA polymerase II regulatory region sequence-specific DNA binding; IEA:Ensembl.
GO; GO:0000902; P:cell morphogenesis; IEA:Ensembl.
GO; GO:0008354; P:germ cell migration; IEA:Ensembl.
GO; GO:0035556; P:intracellular signal transduction; IEA:Ensembl.
GO; GO:0002176; P:male germ cell proliferation; ISS:UniProtKB.
GO; GO:0030238; P:male sex determination; ISS:UniProtKB.
GO; GO:0046661; P:male sex differentiation; ISS:UniProtKB.
GO; GO:0045835; P:negative regulation of meiotic nuclear division; ISS:UniProtKB.
GO; GO:0000122; P:negative regulation of transcription by RNA polymerase II; ISS:UniProtKB.
GO; GO:0048599; P:oocyte development; IBA:GO_Central.
GO; GO:2000020; P:positive regulation of male gonad development; IEA:Ensembl.
GO; GO:0060903; P:positive regulation of meiosis I; IBA:GO_Central.
GO; GO:0045840; P:positive regulation of mitotic nuclear division; ISS:UniProtKB.
GO; GO:0045944; P:positive regulation of transcription by RNA polymerase II; ISS:UniProtKB.
GO; GO:1900107; P:regulation of nodal signaling pathway; IEA:Ensembl.
GO; GO:0060009; P:Sertoli cell development; IEA:Ensembl.
GO; GO:0060008; P:Sertoli cell differentiation; ISS:UniProtKB.
GO; GO:0007283; P:spermatogenesis; IEA:Ensembl.
Gene3D; 4.10.1040.10; -; 1.
InterPro; IPR001275; DM_DNA-bd.
InterPro; IPR036407; DM_DNA-bd_sf.
InterPro; IPR026607; DMRT/dsx/mab-3.
InterPro; IPR022114; DMRT1-like.
PANTHER; PTHR12322; PTHR12322; 1.
Pfam; PF00751; DM; 1.
Pfam; PF12374; Dmrt1; 1.
SMART; SM00301; DM; 1.
SUPFAM; SSF82927; SSF82927; 1.
PROSITE; PS40000; DM_1; 1.
PROSITE; PS50809; DM_2; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Complete proteome;
Developmental protein; Differentiation; DNA-binding; Metal-binding;
Nucleus; Phosphoprotein; Polymorphism; Reference proteome;
Sexual differentiation; Transcription; Transcription regulation; Zinc.
CHAIN 1 373 Doublesex- and mab-3-related
transcription factor 1.
/FTId=PRO_0000207042.
DNA_BIND 72 118 DM. {ECO:0000255|PROSITE-
ProRule:PRU00070}.
COMPBIAS 322 347 Pro/Ser-rich.
MOD_RES 339 339 Phosphoserine.
{ECO:0000250|UniProtKB:Q9QZ59}.
VAR_SEQ 120 175 ALRRQQAQEEELGISHPIPLPSAAELLVKRENNGSNPCLMT
ECSGTSQPPPASVPT -> GAGVREPGFSLSFFFFFFFFRW
SLARLPRLQCSGAILAHCNSASRVQAILLPQPPK (in
isoform 3).
{ECO:0000303|PubMed:16617334}.
/FTId=VSP_042959.
VAR_SEQ 176 373 Missing (in isoform 3).
{ECO:0000303|PubMed:16617334}.
/FTId=VSP_042960.
VAR_SEQ 275 275 M -> V (in isoform 2).
{ECO:0000303|PubMed:16617334}.
/FTId=VSP_042961.
VAR_SEQ 276 373 Missing (in isoform 2).
{ECO:0000303|PubMed:16617334}.
/FTId=VSP_042962.
VARIANT 45 45 S -> T (in dbSNP:rs3739583).
{ECO:0000269|PubMed:10332030,
ECO:0000269|PubMed:10857744,
ECO:0000269|PubMed:16617334}.
/FTId=VAR_009954.
VARIANT 221 221 Y -> S. {ECO:0000269|PubMed:10332030}.
/FTId=VAR_009955.
VARIANT 281 281 R -> S. {ECO:0000269|PubMed:10332030}.
/FTId=VAR_009956.
VARIANT 295 295 P -> L (in dbSNP:rs902482318).
{ECO:0000269|PubMed:10332030}.
/FTId=VAR_009957.
SEQUENCE 373 AA; 39473 MW; 23348B2C4A4733A1 CRC64;
MPNDEAFSKP STPSEAPHAP GVPPQGRAGG FGKASGALVG AASGSSAGGS SRGGGSGSGA
SDLGAGSKKS PRLPKCARCR NHGYASPLKG HKRFCMWRDC QCKKCNLIAE RQRVMAAQVA
LRRQQAQEEE LGISHPIPLP SAAELLVKRE NNGSNPCLMT ECSGTSQPPP ASVPTTAASE
GRMVIQDIPA VTSRGHVENT PDLVSDSTYY SSFYQPSLFP YYNNLYNCPQ YSMALAADSA
SGEVGNPLGG SPVKNSLRGL PGPYVPGQTG NQWQMKNMEN RHAMSSQYRM HSYYPPPSYL
GQSVPQFFTF EDAPSYPEAR ASVFSPPSSQ DSGLVSLSSS SPISNKSTKA VLECEPASEP
SSFTVTPVIE EDE


Related products :

Catalog number Product name Quantity
EIAAB11475 DM domain expressed in testis protein 1,DMRT1,DMT1,Doublesex- and mab-3-related transcription factor 1,Homo sapiens,Human
EIAAB11483 Dmrt8.1,Dmrtc1,Dmrtc1a,Doublesex- and mab-3-related transcription factor 8.1,Doublesex- and mab-3-related transcription factor C1,Mouse,Mus musculus
EIAAB11489 DMRT5,DMRTA2,Doublesex- and mab-3-related transcription factor 5,Doublesex- and mab-3-related transcription factor A2,Homo sapiens,Human
EIAAB11481 Dmrt6,Dmrtb1,Doublesex- and mab-3-related transcription factor 6,Doublesex- and mab-3-related transcription factor B1,Mouse,Mus musculus
EIAAB11480 Dmrt4,Dmrta1,Doublesex- and mab-3-related transcription factor 4,Doublesex- and mab-3-related transcription factor A1,Mouse,Mus musculus
EIAAB11490 Dmrt5,Dmrta2,Doublesex- and mab-3-related transcription factor 5,Doublesex- and mab-3-related transcription factor A2,Mouse,Mus musculus
EIAAB11491 Bos taurus,Bovine,DMRT5,DMRTA2,Doublesex- and mab-3-related transcription factor 5,Doublesex- and mab-3-related transcription factor A2
EIAAB11488 Dmrt7,Dmrtc2,Doublesex- and mab-3-related transcription factor 7,Doublesex- and mab-3-related transcription factor C2,Mouse,Mus musculus
EIAAB11476 DMRT2,Doublesex- and mab-3-related transcription factor 2,Doublesex-like 2 protein,DSXL2,DSXL-2,Homo sapiens,Human
18-003-43331 Doublesex- and mab-3-related transcription factor A1 - Doublesex- and mab-3-related transcription factor 4 Polyclonal 0.05 mg Aff Pur
18-003-43164 Doublesex- and mab-3-related transcription factor C2 - Doublesex- and mab-3-related transcription factor 7 Polyclonal 0.05 mg Aff Pur
EIAAB25065 Morf4l1,MORF-related gene 15 protein,Mortality factor 4-like protein 1,Mouse,Mrg15,Mus musculus,Testis-expressed gene 189 protein,Tex189,Transcription factor-like protein MRG15
27-546 Forkhead Box Protein E3 (FOXE3, forkhead-related protein FKHL12, forkhead-related transcription factor 8) is a forkhead_winged helix transcription factor, which is expressed in the developing lens fro 0.05 mg
DMRT1_PIG Pig ELISA Kit FOR Doublesex- and mab-3-related transcription factor 1 96T
DMRTA_MOUSE Mouse ELISA Kit FOR Doublesex- and mab-3-related transcription factor A1 96T
DMRTA1 DMRT2 Gene doublesex and mab-3 related transcription factor 2
DMRT3 DMRT1 Gene doublesex and mab-3 related transcription factor 1
EIAAB11472 DMRT1,Doublesex- and mab-3-related transcription factor 1,Pig,Sus scrofa
DMRT1_MOUSE Mouse ELISA Kit FOR Doublesex- and mab-3-related transcription factor 1 96T
DMRTD_BOVIN Bovine ELISA Kit FOR Doublesex- and mab-3-related transcription factor C2 96T
DMRTA2 DMRT3 Gene doublesex and mab-3 related transcription factor 3
E1313m Human ELISA Kit FOR Doublesex- and mab-3-related transcription factor A1 96T
DMRT3_HUMAN Human ELISA Kit FOR Doublesex- and mab-3-related transcription factor 3 96T
CSB-EL006975RA Rat Doublesex- and mab-3-related transcription factor C1(DMRTC1) ELISA kit 96T
DMTA2_HUMAN Human ELISA Kit FOR Doublesex- and mab-3-related transcription factor A2 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1689: Porphyrin and chlorophyll metabolism
WP2199: Seed Development
WP2272: Pathogenic Escherichia coli infection
WP731: Sterol regulatory element binding protein related
WP1046: Signaling of Hepatocyte Growth Factor Receptor
WP1049: G Protein Signaling Pathways
WP1066: Eukaryotic Transcription Initiation
WP1162: Signaling of Hepatocyte Growth Factor Receptor
WP1165: G Protein Signaling Pathways
WP1182: Eukaryotic Transcription Initiation
WP1206: Signaling of Hepatocyte Growth Factor Receptor
WP1235: Signaling of Hepatocyte Growth Factor Receptor
WP1238: Eukaryotic Transcription Initiation
WP1371: G Protein Signaling Pathways
WP1438: Influenza A virus infection
WP1493: Carbon assimilation C4 pathway
WP1497: Hedgehog-related genes
WP1502: Mitochondrial biogenesis
WP1531: Vitamin D synthesis
WP1541: Energy Metabolism
WP1559: TFs Regulate miRNAs related to cardiac hypertrophy
WP1566: Citrate cycle (TCA cycle)
WP1613: 1,4-Dichlorobenzene degradation
WP1616: ABC transporters
WP1624: Bacterial secretion system

Related Genes :
[DMRT1 DMT1] Doublesex- and mab-3-related transcription factor 1 (DM domain expressed in testis protein 1)
[Dmrt2] Doublesex- and mab-3-related transcription factor 2 (Doublesex-like 2 protein) (Terra)
[DMRT3] Doublesex and mab-3 related transcription factor 3, truncated (Duplex and mab-3 related transcription factor 3 allele A)
[DMRT2 DSXL2] Doublesex- and mab-3-related transcription factor 2 (Doublesex-like 2 protein) (DSXL-2)
[Foxc1 Fkh1 Fkhl7 Freac3 Mf1] Forkhead box protein C1 (Forkhead-related protein FKHL7) (Forkhead-related transcription factor 3) (FREAC-3) (Mesoderm/mesenchyme forkhead 1) (MF-1) (Transcription factor FKH-1)
[DMRT3] Doublesex and mab-3 related transcription factor 3
[Morf4l1 Mrg15 Tex189] Mortality factor 4-like protein 1 (MORF-related gene 15 protein) (Testis-expressed gene 189 protein) (Transcription factor-like protein MRG15)
[Nfe2l1 Nrf1] Endoplasmic reticulum membrane sensor NFE2L1 (Locus control region-factor 1) (LCR-F1) (Nuclear factor erythroid 2-related factor 1) (NF-E2-related factor 1) (NFE2-related factor 1) (Nuclear factor, erythroid derived 2, like 1) [Cleaved into: Transcription factor NRF1]
[Hey2 Chf1 Herp Herp1 Hesr2 Hrt2] Hairy/enhancer-of-split related with YRPW motif protein 2 (HES-related repressor protein 2) (Hairy and enhancer of split-related protein 2) (HESR-2) (Hairy-related transcription factor 2) (HRT-2) (mHRT2) (Protein gridlock homolog)
[Pitx1 Bft Potx Ptx1] Pituitary homeobox 1 (Hindlimb-expressed homeobox protein backfoot) (Homeobox protein P-OTX) (Homeobox protein PITX1) (Paired-like homeodomain transcription factor 1) (Pituitary OTX-related factor)
[RUNX1 AML1 CBFA2] Runt-related transcription factor 1 (Acute myeloid leukemia 1 protein) (Core-binding factor subunit alpha-2) (CBF-alpha-2) (Oncogene AML-1) (Polyomavirus enhancer-binding protein 2 alpha B subunit) (PEA2-alpha B) (PEBP2-alpha B) (SL3-3 enhancer factor 1 alpha B subunit) (SL3/AKV core-binding factor alpha B subunit)
[NFE2L1 HBZ17 NRF1 TCF11] Endoplasmic reticulum membrane sensor NFE2L1 (Locus control region-factor 1) (LCR-F1) (Nuclear factor erythroid 2-related factor 1) (NF-E2-related factor 1) (NFE2-related factor 1) (Nuclear factor, erythroid derived 2, like 1) (Protein NRF1, p120 form) (Transcription factor 11) (TCF-11) [Cleaved into: Transcription factor NRF1 (Protein NRF1, p110 form)]
[hey1 bc8 hrt1] Hairy/enhancer-of-split related with YRPW motif protein 1 (XHey-1) (Hairy and enhancer of split-related protein 1) (Hesr-1) (Hairy-related transcription factor 1) (HRT-1) (XHRT1) (xHRT-1) (Protein xbc8)
[Hey1 Herp2 Hesr1 Hrt1] Hairy/enhancer-of-split related with YRPW motif protein 1 (Hairy and enhancer of split-related protein 1) (HESR-1) (Hairy-related transcription factor 1) (HRT-1) (mHRT1)
[RUNX2 AML3 CBFA1 OSF2 PEBP2A] Runt-related transcription factor 2 (Acute myeloid leukemia 3 protein) (Core-binding factor subunit alpha-1) (CBF-alpha-1) (Oncogene AML-3) (Osteoblast-specific transcription factor 2) (OSF-2) (Polyomavirus enhancer-binding protein 2 alpha A subunit) (PEA2-alpha A) (PEBP2-alpha A) (SL3-3 enhancer factor 1 alpha A subunit) (SL3/AKV core-binding factor alpha A subunit)
[DMRT1] Doublesex- and mab-3-related transcription factor 1
[FOXM1 FKHL16 HFH11 MPP2 WIN] Forkhead box protein M1 (Forkhead-related protein FKHL16) (Hepatocyte nuclear factor 3 forkhead homolog 11) (HFH-11) (HNF-3/fork-head homolog 11) (M-phase phosphoprotein 2) (MPM-2 reactive phosphoprotein 2) (Transcription factor Trident) (Winged-helix factor from INS-1 cells)
[1a] Replicase polyprotein 1a (pp1a) (ORF1a polyprotein) [Cleaved into: Non-structural protein 1 (nsp1) (Leader protein); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.69) (PL2-PRO) (Papain-like proteinase) (PL-PRO) (SARS coronavirus main proteinase); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (nsp5); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); Non-structural protein 11 (nsp11)]
[BAZ1A ACF1 WCRF180 HSPC317] Bromodomain adjacent to zinc finger domain protein 1A (ATP-dependent chromatin-remodeling protein) (ATP-utilizing chromatin assembly and remodeling factor 1) (hACF1) (CHRAC subunit ACF1) (Williams syndrome transcription factor-related chromatin-remodeling factor 180) (WCRF180) (hWALp1)
[GL1 MYB0 At3g27920 K16N12.17] Trichome differentiation protein GL1 (Myb-related protein 0) (AtMYB0) (Protein GLABRA 1) (Protein GLABROUS 1) (R2R3-MYB transcription factor GL1)
[Ebf2 Coe2 Mmot1] Transcription factor COE2 (Early B-cell factor 2) (EBF-2) (Metencephalon-mesencephalon-olfactory transcription factor 1) (MET-mesencephalon-olfactory TF1) (MET-mesencephalon-olfactory transcription factor 1) (Olf-1/EBF-like 3) (O/E-3) (OE-3)
[TCF3 BHLHB21 E2A ITF1] Transcription factor E2-alpha (Class B basic helix-loop-helix protein 21) (bHLHb21) (Immunoglobulin enhancer-binding factor E12/E47) (Immunoglobulin transcription factor 1) (Kappa-E2-binding factor) (Transcription factor 3) (TCF-3) (Transcription factor ITF-1)
[MORF4L1 MRG15 FWP006 HSPC008 HSPC061 PP368] Mortality factor 4-like protein 1 (MORF-related gene 15 protein) (Protein MSL3-1) (Transcription factor-like protein MRG15)
[HEY1 BHLHB31 CHF2 HERP2 HESR1 HRT1] Hairy/enhancer-of-split related with YRPW motif protein 1 (Cardiovascular helix-loop-helix factor 2) (CHF-2) (Class B basic helix-loop-helix protein 31) (bHLHb31) (HES-related repressor protein 1) (Hairy and enhancer of split-related protein 1) (HESR-1) (Hairy-related transcription factor 1) (HRT-1) (hHRT1)
[Phf1 Plc1 Tctex-3 Tctex3] PHD finger protein 1 (Protein PHF1) (Polycomb-like protein 1) (mPCl1) (T-complex testis-expressed 3)
[HLTF HIP116A RNF80 SMARCA3 SNF2L3 ZBU1] Helicase-like transcription factor (EC 2.3.2.27) (EC 3.6.4.-) (DNA-binding protein/plasminogen activator inhibitor 1 regulator) (HIP116) (RING finger protein 80) (RING-type E3 ubiquitin transferase HLTF) (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3) (Sucrose nonfermenting protein 2-like 3)
[Runx1 Aml1 Cbfa2 Pebp2ab] Runt-related transcription factor 1 (Acute myeloid leukemia 1 protein) (Core-binding factor subunit alpha-2) (CBF-alpha-2) (Oncogene AML-1) (Polyomavirus enhancer-binding protein 2 alpha B subunit) (PEA2-alpha B) (PEBP2-alpha B) (SL3-3 enhancer factor 1 alpha B subunit) (SL3/AKV core-binding factor alpha B subunit)
[Taf1 Ccg1] Transcription initiation factor TFIID subunit 1 (EC 2.3.1.48) (EC 2.7.11.1) (Cell cycle gene 1 protein) (TBP-associated factor 250 kDa) (p250) (Transcription initiation factor TFIID 250 kDa subunit) (TAF(II)250) (TAFII-250) (TAFII250)
[Tex19.1 Tex19 Tex19a] Testis-expressed protein 19.1 (mTex19.1) (Testis-expressed protein 19A)
[Elf3 Ert Esx Jen] ETS-related transcription factor Elf-3 (E74-like factor 3) (Epithelial-restricted with serine box) (Epithelium-restricted Ets protein ESX) (Epithelium-specific Ets transcription factor 1) (ESE-1)

Bibliography :
[24566822] Characterization of the Dmrt1 gene in the black rockfish Sebastes schlegeli revealed a remarkable sex-dimorphic expression.
[21621532] DMRT1 promotes oogenesis by transcriptional activation of Stra8 in the mammalian fetal ovary.
[20616082] Genome-wide analysis of DNA binding and transcriptional regulation by the mammalian Doublesex homolog DMRT1 in the juvenile testis.
[20573695] Opposite roles of DMRT1 and its W-linked paralogue, DM-W, in sexual dimorphism of Xenopus laevis: implications of a ZZ/ZW-type sex-determining system.
[20363354] Sexually dimorphic expression of dmrt1 in immature and mature Atlantic cod (Gadus morhua L.).
[19293249] Identification of multiple dmrt1s in catfish: localization, dimorphic expression pattern, changes during testicular cycle and after methyltestosterone treatment.
[19067156] Isolation and characterization of testis-specific DMRT1 in the tropical abalone (Haliotis asinina).
[18391515] mRNA expression analysis and the molecular basis of neonatal testis defects in Dmrt1 mutant mice.
[18268317] A W-linked DM-domain gene, DM-W, participates in primary ovary development in Xenopus laevis.
[18092860] Influences of 4-nonylphenol on doublesex- and mab-3-related transcription factor 1 gene expression and vitellogenin mRNA induction of adult rare minnow (Gobiocypris rarus).
?>