GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

ECF RNA polymerase sigma factor SigR (ECF sigma factor SigR) (Alternative RNA polymerase sigma factor SigR) (RNA polymerase sigma-R factor) (Sigma-R factor)

 SIGR_STRCO              Reviewed;         227 AA.
Q7AKG9; O87834;
16-OCT-2013, integrated into UniProtKB/Swiss-Prot.
16-MAY-2012, sequence version 1.
16-JAN-2019, entry version 47.
RecName: Full=ECF RNA polymerase sigma factor SigR;
Short=ECF sigma factor SigR;
AltName: Full=Alternative RNA polymerase sigma factor SigR;
AltName: Full=RNA polymerase sigma-R factor;
Short=Sigma-R factor;
Name=sigR; OrderedLocusNames=SCO5216;
Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145).
Bacteria; Actinobacteria; Streptomycetales; Streptomycetaceae;
Streptomyces; Streptomyces albidoflavus group.
NCBI_TaxID=100226;
[1]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], PROTEIN SEQUENCE OF 5-24, FUNCTION
AS A SIGMA FACTOR, INDUCTION, AUTOREGULATION, AND DISRUPTION
PHENOTYPE.
STRAIN=ATCC BAA-471 / A3(2) / M145;
PubMed=9755177; DOI=10.1093/emboj/17.19.5776;
Paget M.S., Kang J.G., Roe J.H., Buttner M.J.;
"sigmaR, an RNA polymerase sigma factor that modulates expression of
the thioredoxin system in response to oxidative stress in Streptomyces
coelicolor A3(2).";
EMBO J. 17:5776-5782(1998).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=ATCC BAA-471 / A3(2) / M145;
PubMed=12000953; DOI=10.1038/417141a;
Bentley S.D., Chater K.F., Cerdeno-Tarraga A.-M., Challis G.L.,
Thomson N.R., James K.D., Harris D.E., Quail M.A., Kieser H.,
Harper D., Bateman A., Brown S., Chandra G., Chen C.W., Collins M.,
Cronin A., Fraser A., Goble A., Hidalgo J., Hornsby T., Howarth S.,
Huang C.-H., Kieser T., Larke L., Murphy L.D., Oliver K., O'Neil S.,
Rabbinowitsch E., Rajandream M.A., Rutherford K.M., Rutter S.,
Seeger K., Saunders D., Sharp S., Squares R., Squares S., Taylor K.,
Warren T., Wietzorrek A., Woodward J.R., Barrell B.G., Parkhill J.,
Hopwood D.A.;
"Complete genome sequence of the model actinomycete Streptomyces
coelicolor A3(2).";
Nature 417:141-147(2002).
[3]
FUNCTION AS A SIGMA-FACTOR, INTERACTION WITH RSRA, AND SUBUNIT.
STRAIN=ATCC BAA-471 / A3(2) / M145;
PubMed=10428967; DOI=10.1093/emboj/18.15.4292;
Kang J.G., Paget M.S.B., Seok Y.J., Hahn M.Y., Bae J.B., Hahn J.S.;
"RsrA, an anti-sigma factor regulated by redox change.";
EMBO J. 18:4292-4298(1999).
[4]
FUNCTION, SUBUNIT, AND REGULON.
STRAIN=ATCC BAA-471 / A3(2) / M145;
PubMed=11737643; DOI=10.1046/j.1365-2958.2001.02675.x;
Paget M.S.B., Molle V., Cohen G., Aharonowitz Y., Buttner M.J.;
"Defining the disulphide stress response in Streptomyces coelicolor
A3(2): identification of the sigmaR regulon.";
Mol. Microbiol. 42:1007-1020(2001).
[5]
FUNCTION AS A SIGMA FACTOR, AND INTERACTION WITH RSRA.
STRAIN=ATCC BAA-471 / A3(2) / M145;
PubMed=14529630; DOI=10.1016/j.jmb.2003.08.038;
Li W., Bottrill A.R., Bibb M.J., Buttner M.J., Paget M.S.,
Kleanthous C.;
"The role of zinc in the disulphide stress-regulated anti-sigma factor
RsrA from Streptomyces coelicolor.";
J. Mol. Biol. 333:461-472(2003).
[6]
REGULON, INDUCTION, AND DISRUPTION PHENOTYPE.
STRAIN=ATCC BAA-471 / A3(2) / M145;
PubMed=18430082; DOI=10.1111/j.1365-2958.2008.06191.x;
Park J.H., Roe J.H.;
"Mycothiol regulates and is regulated by a thiol-specific antisigma
factor RsrA and sigma(R) in Streptomyces coelicolor.";
Mol. Microbiol. 68:861-870(2008).
[7]
INDUCTION, ALTERNATIVE INITIATION (SIGR PRIME), AND PROBABLE CLEAVAGE.
STRAIN=ATCC BAA-471 / A3(2) / M145;
PubMed=19682253; DOI=10.1111/j.1365-2958.2009.06824.x;
Kim M.S., Hahn M.Y., Cho Y., Cho S.N., Roe J.H.;
"Positive and negative feedback regulatory loops of thiol-oxidative
stress response mediated by an unstable isoform of sigmaR in
actinomycetes.";
Mol. Microbiol. 73:815-825(2009).
[8]
REGULON.
PubMed=22651816; DOI=10.1111/j.1365-2958.2012.08115.x;
Kim M.S., Dufour Y.S., Yoo J.S., Cho Y.B., Park J.H., Nam G.B.,
Kim H.M., Lee K.L., Donohue T.J., Roe J.H.;
"Conservation of thiol-oxidative stress responses regulated by SigR
orthologues in actinomycetes.";
Mol. Microbiol. 85:326-344(2012).
[9]
X-RAY CRYSTALLOGRAPHY (2.38 ANGSTROMS) OF 23-109, AND INTERACTION WITH
RSRA.
STRAIN=ATCC BAA-471 / A3(2) / M145;
PubMed=12381317; DOI=10.1016/S0022-2836(02)00948-8;
Li W., Stevenson C.E., Burton N., Jakimowicz P., Paget M.S.,
Buttner M.J., Lawson D.M., Kleanthous C.;
"Identification and structure of the anti-sigma factor-binding domain
of the disulphide-stress regulated sigma factor sigma(R) from
Streptomyces coelicolor.";
J. Mol. Biol. 323:225-236(2002).
-!- FUNCTION: Sigma factors are initiation factors that promote the
attachment of RNA polymerase to specific initiation sites and are
then released. Extracytoplasmic function (ECF) sigma factors are
held in an inactive form by an anti-sigma factor (RsrA) until
released. Responds to thiol-oxidative stress, involved in
regulation of about 30 genes and operons, including the
thioredoxin system (trxB-trxA, trxC), ribosomal protein L31, RNA
polymerase-binding protein RbpA and mycothiol (MSH) biosynthetic
(mshA) and recycling genes (mca). In conjunction with its cognate
anti-sigma factor RsrA may sense the intracellular level of
reduced MSH. {ECO:0000269|PubMed:10428967,
ECO:0000269|PubMed:11737643, ECO:0000269|PubMed:14529630,
ECO:0000269|PubMed:9755177}.
-!- SUBUNIT: Interacts transiently with the RNA polymerase catalytic
core formed by RpoA, RpoB, RpoC and RpoZ (2 alpha, 1 beta, 1 beta'
and 1 omega subunit) to form the RNA polymerase holoenzyme that
can initiate transcription. Interacts with cognate anti-sigma
factor RsrA under reducing but not oxiding conditions, which
prevents it binding to RNA polymerase. Treatment with the thiol-
oxidzing agent diamide inhibits the interaction.
{ECO:0000269|PubMed:10428967, ECO:0000269|PubMed:11737643,
ECO:0000269|PubMed:12381317, ECO:0000269|PubMed:14529630}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative initiation; Named isoforms=2;
Name=SigR;
IsoId=Q7AKG9-1; Sequence=Displayed;
Note=Constitutively expressed major isoform, not induced by
diamide (at protein level), contributes about half of the
diamide-induced expression of the regulon.;
Name=SigR prime;
IsoId=Q7AKG9-2; Sequence=VSP_053231;
Note=Present in low amounts in unstressed cells, strongly but
transiently produced upon diamide induction. Functions as a
sigma factor, contributes about half of the diamide-induced
expression of the regulon. Unstable, half-life of about 10
minutes.;
-!- INDUCTION: Expressed from 2 promoters, 1 of which (sigRp2)
positively regulates its own expression. The same promoter is
transiently induced (about 70-fold) by the thiol-oxiding agent
diamide. Also induced when mycothiol is oxidized or conjugated.
{ECO:0000269|PubMed:18430082, ECO:0000269|PubMed:19682253,
ECO:0000269|PubMed:9755177}.
-!- DOMAIN: The sigma-70 factor domain-2 mediates sequence-specific
interaction with the -10 element in promoter DNA, and plays an
important role in melting the double-stranded DNA and the
formation of the transcription bubble. The sigma-70 factor domain-
2 mediates interaction with the RNA polymerase subunits RpoB and
RpoC (By similarity). Interactions between sigma-70 factor domain-
2 and anti-sigma factors prevents interaction of sigma factors
with the RNA polymerase catalytic core (Probable). {ECO:0000250,
ECO:0000305}.
-!- DOMAIN: The sigma-70 factor domain-4 contains a helix-turn-helix
(H-T-H) motif that mediates interaction with the -35 element in
promoter DNA. The domain also mediates interaction with the RNA
polymerase subunit RpoA (By similarity). {ECO:0000250}.
-!- PTM: SigR is present in multiple forms of different pI, suggesting
other unknown post-translational modifications.
-!- PTM: SigR prime is probably partially degraded by ClpP1-ClpP2.
-!- DISRUPTION PHENOTYPE: Increased sensitivity to redox-cycling
compounds menadione and plumbagin, and to diamide. Loss of
expression of mycothiol biosynthetic and recycling genes.
{ECO:0000269|PubMed:18430082, ECO:0000269|PubMed:9755177}.
-!- SIMILARITY: Belongs to the sigma-70 factor family. ECF subfamily.
{ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AJ010320; CAA09088.1; -; Genomic_DNA.
EMBL; AL939122; CAB94601.1; -; Genomic_DNA.
PIR; T42015; T42015.
RefSeq; NP_629363.1; NC_003888.3. [Q7AKG9-1]
RefSeq; WP_003973756.1; NC_003888.3.
PDB; 1H3L; X-ray; 2.38 A; A/B=23-109.
PDB; 5FGM; X-ray; 2.60 A; A=143-207.
PDBsum; 1H3L; -.
PDBsum; 5FGM; -.
ProteinModelPortal; Q7AKG9; -.
SMR; Q7AKG9; -.
STRING; 100226.SCO5216; -.
PRIDE; Q7AKG9; -.
EnsemblBacteria; CAB94601; CAB94601; CAB94601.
GeneID; 1100657; -.
KEGG; sco:SCO5216; -.
PATRIC; fig|100226.15.peg.5300; -.
eggNOG; ENOG4105EMN; Bacteria.
eggNOG; COG1595; LUCA.
HOGENOM; HOG000094755; -.
InParanoid; Q7AKG9; -.
KO; K03088; -.
OMA; TYINLYR; -.
PhylomeDB; Q7AKG9; -.
Proteomes; UP000001973; Chromosome.
GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW.
GO; GO:0003700; F:DNA-binding transcription factor activity; IEA:InterPro.
GO; GO:0016987; F:sigma factor activity; IDA:UniProtKB.
GO; GO:0006352; P:DNA-templated transcription, initiation; IEA:InterPro.
GO; GO:0006979; P:response to oxidative stress; IDA:UniProtKB.
Gene3D; 1.10.10.10; -; 1.
InterPro; IPR039425; RNA_pol_sigma-70.
InterPro; IPR014284; RNA_pol_sigma-70_dom.
InterPro; IPR014293; RNA_pol_sigma70_actinobac.
InterPro; IPR000838; RNA_pol_sigma70_ECF_CS.
InterPro; IPR007627; RNA_pol_sigma70_r2.
InterPro; IPR013249; RNA_pol_sigma70_r4_t2.
InterPro; IPR013325; RNA_pol_sigma_r2.
InterPro; IPR013324; RNA_pol_sigma_r3/r4-like.
InterPro; IPR036388; WH-like_DNA-bd_sf.
PANTHER; PTHR43133; PTHR43133; 1.
Pfam; PF04542; Sigma70_r2; 1.
Pfam; PF08281; Sigma70_r4_2; 1.
SUPFAM; SSF88659; SSF88659; 1.
SUPFAM; SSF88946; SSF88946; 1.
TIGRFAMs; TIGR02947; SigH_actino; 1.
TIGRFAMs; TIGR02937; sigma70-ECF; 1.
PROSITE; PS01063; SIGMA70_ECF; 1.
1: Evidence at protein level;
3D-structure; Alternative initiation; Complete proteome;
Direct protein sequencing; DNA-binding; Reference proteome;
Sigma factor; Transcription; Transcription regulation.
CHAIN 1 227 ECF RNA polymerase sigma factor SigR.
/FTId=PRO_0000423649.
DNA_BIND 173 192 H-T-H motif. {ECO:0000250}.
REGION 43 106 Sigma-70 factor domain-2.
REGION 148 198 Sigma-70 factor domain-4.
MOTIF 63 66 Polymerase core binding. {ECO:0000255}.
VAR_SEQ 1 1 M -> MGSAFCPSRSSRADLDWTVLHAAKTAPIRAAGGPDR
RLSSDSSETGLGFTTTSEEM (in isoform SigR
prime). {ECO:0000305}.
/FTId=VSP_053231.
HELIX 29 42 {ECO:0000244|PDB:1H3L}.
HELIX 44 55 {ECO:0000244|PDB:1H3L}.
HELIX 58 75 {ECO:0000244|PDB:1H3L}.
HELIX 76 78 {ECO:0000244|PDB:1H3L}.
STRAND 81 83 {ECO:0000244|PDB:1H3L}.
HELIX 85 99 {ECO:0000244|PDB:1H3L}.
HELIX 148 153 {ECO:0000244|PDB:5FGM}.
HELIX 157 167 {ECO:0000244|PDB:5FGM}.
HELIX 173 180 {ECO:0000244|PDB:5FGM}.
HELIX 184 204 {ECO:0000244|PDB:5FGM}.
SEQUENCE 227 AA; 25218 MW; AE89C2EF0ED4F366 CRC64;
MGPVTGTDAG TEHGQAEQPE GRGTGAESTA ERSARFERDA LEFLDQMYSA ALRMTRNPAD
AEDLVQETYA KAYASFHQFR EGTNLKAWLY RILTNTFINS YRKKQREPQR SAAEEIEDWQ
LARAESHMST GLRSAESQAL DHLPDSDVKQ ALQAIPEEFR IAVYLADVEG FAYKEIADIM
GTPIGTVMSR LHRGRRQLRG MLEDYARDRG LVPAGAGESN EAKGSGS


Related products :

Catalog number Product name Quantity
AB2B201 Polyclonal Antibodies: Anti-RNA polymerase sigma factor RpoE Polyclonal Antibody; Specificity: Anti-RNA polymerase sigma factor RpoE Polyclonal Antibody ; Application: IHC 0.1mg
E1384146 RNA Polymerase sigma Factor (ECF) ELISA Kit
E1381258 RNA Polymerase sigma Factor (ECF) ELISA Kit 1
E1380079 Guinea pig RNA Polymerase sigma Factor (ECF) ELISA Kit
20-272-190716 RNA polymerase sigma 70 - Mouse monoclonal [2G10] to RNA polymerase sigma 70 Monoclonal 0.05 ml
PAB16007 Rhodopseudomonas palustris<_i> RNA polymerase sigma factor RpoE protein polyclonal antibody 50 ug
15-288-22217F AP-3 complex subunit sigma-2 - Adapter-related protein complex 3 sigma-2 subunit; Sigma-adaptin 3b; AP-3 complex sigma-3B subunit; Sigma-3B-adaptin Polyclonal 0.1 mg
15-288-22217F AP-3 complex subunit sigma-2 - Adapter-related protein complex 3 sigma-2 subunit; Sigma-adaptin 3b; AP-3 complex sigma-3B subunit; Sigma-3B-adaptin Polyclonal 0.05 mg
10-288-22217F AP-3 complex subunit sigma-2 - Adapter-related protein complex 3 sigma-2 subunit; Sigma-adaptin 3b; AP-3 complex sigma-3B subunit; Sigma-3B-adaptin 0.1 mg
10-288-22217F AP-3 complex subunit sigma-2 - Adapter-related protein complex 3 sigma-2 subunit; Sigma-adaptin 3b; AP-3 complex sigma-3B subunit; Sigma-3B-adaptin 0.05 mg
GTX12088 RNA polymerase sigma 70 _ rpoD 50 µl
GTX12088 RNA polymerase sigma 70 [2G10] 50 µl
GWB-68CBEA RNA polymerase sigma 70 [2G10], Antibody
E4977h Human Polymerase DNA Directed Sigma ELISA Kit 96T
20-272-191004 14 - 3 - 3 sigma - Mouse monoclonal [1.N.6] to 14 - 3 - 3 sigma; Stratifin; Epithelial cell marker protein 1 Monoclonal 0.25 ml
20-272-191003 14 - 3 - 3 sigma - Mouse monoclonal [1.T.28] to 14 - 3 - 3 sigma; Stratifin; Epithelial cell marker protein 1 Monoclonal 0.05 mg
EIAAB29839 DNA polymerase kappa,DNA polymerase sigma,Homo sapiens,Human,LAK-1,PAP-associated domain-containing protein 7,PAPD7,POLS,Terminal uridylyltransferase 5,Topoisomerase-related function protein 4-1,TRF4,
LF-MA10299 anti-14-3-3 σ (14-3-3 sigma) (3C3), Mouse monoclonal to 14-3-3 σ (14-3-3 sigma), Isotype IgG1, Host Mouse 100 ug
PAPD7_MOUSE ELISA Kit FOR DNA polymerase sigma; organism: Mouse; gene name: Papd7 96T
PAPD7_HUMAN ELISA Kit FOR DNA polymerase sigma; organism: Human; gene name: PAPD7 96T
GTX12088 RNA polymerase sigma 70 _ rpoD Mouse IgG2b antibody Ab Ascites 50
EIAAB29838 DNA polymerase sigma,Mouse,Mus musculus,PAP-associated domain-containing protein 7,Papd7,Pols
GWB-848EC9 Polymerase (DNA Directed) Sigma (POLS) Rabbit anti-Human Polyclonal (aa447-462) Antibody
'GTX12088 RNA polymerase sigma 70 _ rpoD Clone '2G10 antibody Isotype IgG2b Host Mouse 50
'GTX12088 RNA polymerase sigma 70 rpoD Clone '2G10 antibody Isotype IgG2b Host Mouse 50

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1046: Signaling of Hepatocyte Growth Factor Receptor
WP1162: Signaling of Hepatocyte Growth Factor Receptor
WP1206: Signaling of Hepatocyte Growth Factor Receptor
WP1235: Signaling of Hepatocyte Growth Factor Receptor
WP1789: Binding of RNA by Insulin-like Growth Factor-2 mRNA Binding Proteins (IGF2BPs/IMPs/VICKZs)
WP1899: Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs)
WP193: Signaling of Hepatocyte Growth Factor Receptor
WP1983: Splicing factor NOVA regulated synpatic proteins
WP2148: Brain derived neurotrophic factor
WP272: Blood Clotting Cascade
WP313: Signaling of Hepatocyte Growth Factor Receptor
WP444: Signaling of Hepatocyte Growth Factor Receptor
WP654: ATM
WP810: Signaling of Hepatocyte Growth Factor Receptor
WP927: Signaling of Hepatocyte Growth Factor Receptor
WP94: Signaling of Hepatocyte Growth Factor Receptor
WP1438: Influenza A virus infection
WP1644: DNA replication
WP1663: Homologous recombination
WP1672: Mismatch repair
WP1693: Purine metabolism
WP1694: Pyrimidine metabolism
WP1699: RNA polymerase
WP1905: RNA Polymerase I, RNA Polymerase III, and Mitochondrial Transcription
WP1906: RNA Polymerase II Transcription

Related Genes :
[sigR SCO5216] ECF RNA polymerase sigma factor SigR (ECF sigma factor SigR) (Alternative RNA polymerase sigma factor SigR) (RNA polymerase sigma-R factor) (Sigma-R factor)
[rsrA SCO5217] Anti-sigma factor RsrA (Regulator of SigR) (Sigma-R anti-sigma factor RsrA)
[sigC Rv2069 MTCY49.08] ECF RNA polymerase sigma factor SigC (ECF sigma factor SigC) (Alternative RNA polymerase sigma factor SigC) (RNA polymerase sigma-C factor) (Sigma-C factor)
[sigF Rv3286c] RNA polymerase sigma factor SigF (Sigma factor SigF) (Alternative RNA polymerase sigma factor SigF) (RNA polymerase sigma-F factor) (Sigma-F factor) (Stress response/stationary phase sigma factor SigF)
[rpoE sigE b2573 JW2557] ECF RNA polymerase sigma-E factor (RNA polymerase sigma-E factor) (Sigma-24)
[sigL Rv0735] ECF RNA polymerase sigma factor SigL (ECF sigma factor SigL) (Alternative RNA polymerase sigma factor SigL) (RNA polymerase sigma-L factor) (Sigma-L factor)
[SIGF SIG6 SOLDAT8 At2g36990 T1J8] RNA polymerase sigma factor sigF, chloroplastic (Sigma factor F) (Sigma-F) (Protein SINGLET OXYGEN-LINKED DEATH ACTIVATOR 8) (RNA polymerase sigma factor sig6) (Atsig6) (Sigma factor 6)
[sigH rpoE MSMEG_1914 MSMEI_1874] ECF RNA polymerase sigma factor SigH (ECF sigma factor SigH) (Alternative RNA polymerase sigma factor SigH) (RNA polymerase sigma-H factor) (Sigma-H factor)
[sigW ybbL BSU01730] ECF RNA polymerase sigma factor SigW (ECF sigma factor SigW) (Alternative RNA polymerase sigma factor SigW) (RNA polymerase sigma-W factor) (Sigma-W factor)
[sigM Rv3911] ECF RNA polymerase sigma factor SigM (ECF sigma factor SigM) (Alternative RNA polymerase sigma factor SigM) (RNA polymerase sigma-M factor) (Sigma-M factor)
[rpoH fam hin htpR b3461 JW3426] RNA polymerase sigma factor RpoH (Heat shock regulatory protein F33.4) (RNA polymerase sigma-32 factor)
[rpoE sigE STM14_3234] ECF RNA polymerase sigma-E factor (RNA polymerase sigma-E factor)
[rpoS appR katF nur otsX sigS b2741 JW5437] RNA polymerase sigma factor RpoS (Sigma S) (Sigma-38)
[rpoE RHOS4_27100 RSP_1092] ECF RNA polymerase sigma factor RpoE (Alternative RNA polymerase sigma factor RpoE) (RNA polymerase sigma-E factor) (Sigma-24)
[sigH rpoE MT3320] ECF RNA polymerase sigma factor SigH (ECF sigma factor SigH) (Alternative RNA polymerase sigma factor SigH) (RNA polymerase sigma-H factor) (Sigma-H factor)
[algU algT PA0762] RNA polymerase sigma-H factor (Sigma-30)
[sigC MT2129] ECF RNA polymerase sigma factor SigC (ECF sigma factor SigC) (Alternative RNA polymerase sigma factor SigC) (RNA polymerase sigma-C factor) (Sigma-C factor)
[sigJ Rv3328c] ECF RNA polymerase sigma factor SigJ (ECF sigma factor SigJ) (Alternative RNA polymerase sigma factor SigJ) (RNA polymerase sigma-J factor) (Sigma-J factor)
[rseA mclA yfiJ b2572 JW2556] Anti-sigma-E factor RseA (Regulator of SigE) (Sigma-E anti-sigma factor RseA) (Sigma-E factor negative regulatory protein)
[sigB mysB Rv2710] RNA polymerase sigma factor SigB
[sigE MSMEG_5072 MSMEI_4945] ECF RNA polymerase sigma factor SigE (ECF sigma factor SigE) (Alternative RNA polymerase sigma factor SigE) (RNA polymerase sigma-E factor) (Sigma-E factor)
[sigA mysA rpoD rpoV Rv2703 MTCY05A6.24] RNA polymerase sigma factor SigA (Sigma-A)
[rslA Rv0736] Anti-sigma-L factor RslA (Regulator of SigL) (Sigma-L anti-sigma factor RslA)
[GCN4 AAS3 ARG9 YEL009C] General control protein GCN4 (Amino acid biosynthesis regulatory protein)
[sigH rpoE BQ2027_MB3250C] ECF RNA polymerase sigma factor SigH (ECF sigma factor SigH) (Alternative RNA polymerase sigma factor SigH) (RNA polymerase sigma-H factor) (Sigma-H factor)
[MPR1] N-acetyltransferase MPR1 (EC 2.3.1.271) ((S)-1-pyrroline-5-carboxylate acetyltransferase) (L-azetidine-2-carboxylate acetyltransferase) (AZC acetyltransferase) (Sigma1278b gene for proline-analog resistance 1)
[TAF1B] TATA box-binding protein-associated factor RNA polymerase I subunit B (RNA polymerase I-specific TBP-associated factor 63 kDa) (TAFI63) (TATA box-binding protein-associated factor 1B) (TBP-associated factor 1B) (Transcription initiation factor SL1/TIF-IB subunit B)
[TAF1C] TATA box-binding protein-associated factor RNA polymerase I subunit C (RNA polymerase I-specific TBP-associated factor 110 kDa) (TAFI110) (TATA box-binding protein-associated factor 1C) (TBP-associated factor 1C) (Transcription initiation factor SL1/TIF-IB subunit C)
[rshA Rv3221A] Anti-sigma factor RshA (Regulator of SigH) (Sigma-H anti-sigma factor RshA)
[TAF1A] TATA box-binding protein-associated factor RNA polymerase I subunit A (RNA polymerase I-specific TBP-associated factor 48 kDa) (TAFI48) (TATA box-binding protein-associated factor 1A) (TBP-associated factor 1A) (Transcription factor SL1) (Transcription initiation factor SL1/TIF-IB subunit A)

Bibliography :