GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial (Protein SITPEC)

 ECSIT_HUMAN             Reviewed;         431 AA.
Q9BQ95; E9PAN9; K7EMM0; Q96HQ7; Q9NYI1;
26-JUN-2007, integrated into UniProtKB/Swiss-Prot.
01-JUN-2001, sequence version 1.
31-JUL-2019, entry version 136.
RecName: Full=Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial;
AltName: Full=Protein SITPEC;
Flags: Precursor;
Name=ECSIT;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND VARIANT CYS-278.
Fitzgerald S.N., Brady K.J., Moynagh P.N.;
"Nucleotide sequence of the human ECSIT cDNA.";
Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
"Cloning of human full open reading frames in Gateway(TM) system entry
vector (pDONR201).";
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057824; DOI=10.1038/nature02399;
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J.,
Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M.,
Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E.,
Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M.,
Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C.,
Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M.,
Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T.,
Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H.,
Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S.,
Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J.,
Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M.,
Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J.,
Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D.,
Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A.,
Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I.,
Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
Rubin E.M., Lucas S.M.;
"The DNA sequence and biology of human chromosome 19.";
Nature 428:529-535(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
TISSUE=Eye, Lung, and Pancreas;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[6]
SUBCELLULAR LOCATION, IDENTIFICATION BY MASS SPECTROMETRY, AND
INTERACTION WITH NDUFAF1.
PubMed=17344420; DOI=10.1101/gad.408407;
Vogel R.O., Janssen R.J.R.J., van den Brand M.A.M., Dieteren C.E.J.,
Verkaart S., Koopman W.J.H., Willems P.H.G.M., Pluk W.,
van den Heuvel L.P.W.J., Smeitink J.A.M., Nijtmans L.G.J.;
"Cytosolic signaling protein Ecsit also localizes to mitochondria
where it interacts with chaperone NDUFAF1 and functions in complex I
assembly.";
Genes Dev. 21:615-624(2007).
[7]
INTERACTION WITH ACAD9.
PubMed=20816094; DOI=10.1016/j.cmet.2010.08.002;
Nouws J., Nijtmans L., Houten S.M., van den Brand M., Huynen M.,
Venselaar H., Hoefs S., Gloerich J., Kronick J., Hutchin T.,
Willems P., Rodenburg R., Wanders R., van den Heuvel L., Smeitink J.,
Vogel R.O.;
"Acyl-CoA dehydrogenase 9 is required for the biogenesis of oxidative
phosphorylation complex I.";
Cell Metab. 12:283-294(2010).
[8]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=21269460; DOI=10.1186/1752-0509-5-17;
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P.,
Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.;
"Initial characterization of the human central proteome.";
BMC Syst. Biol. 5:17-17(2011).
[9]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
PubMed=25944712; DOI=10.1002/pmic.201400617;
Vaca Jacome A.S., Rabilloud T., Schaeffer-Reiss C., Rompais M.,
Ayoub D., Lane L., Bairoch A., Van Dorsselaer A., Carapito C.;
"N-terminome analysis of the human mitochondrial proteome.";
Proteomics 15:2519-2524(2015).
-!- FUNCTION: Adapter protein of the Toll-like and IL-1 receptor
signaling pathway that is involved in the activation of NF-kappa-B
via MAP3K1. Promotes proteolytic activation of MAP3K1. Involved in
the BMP signaling pathway. Required for normal embryonic
development (By similarity). {ECO:0000250}.
-!- FUNCTION: Required for efficient assembly of mitochondrial
NADH:ubiquinone oxidoreductase.
-!- SUBUNIT: Interacts with MAP3K1, SMAD4 and TRAF6. Interacts with
SMAD1 only after BMP4-treatment (By similarity). Part of the
mitochondrial complex I assembly (MCIA) complex. The complex
comprises at least TMEM126B, NDUFAF1, ECSIT, and ACAD9 (By
similarity). Interacts with NDUFAF1 (PubMed:17344420). Interacts
with ACAD9 (PubMed:20816094). Interacts with TRIM59 (By
similarity). {ECO:0000250|UniProtKB:Q9QZH6}.
-!- INTERACTION:
P02649:APOE; NbExp=4; IntAct=EBI-712452, EBI-1222467;
Q9Y285:FARSA; NbExp=2; IntAct=EBI-712452, EBI-725361;
P49768:PSEN1; NbExp=4; IntAct=EBI-712452, EBI-297277;
P49810:PSEN2; NbExp=4; IntAct=EBI-712452, EBI-2010251;
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:17344420}.
Nucleus {ECO:0000269|PubMed:17344420}. Mitochondrion
{ECO:0000269|PubMed:17344420}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1;
IsoId=Q9BQ95-1; Sequence=Displayed;
Name=2;
IsoId=Q9BQ95-2; Sequence=VSP_026345, VSP_026346;
Name=3;
IsoId=Q9BQ95-3; Sequence=VSP_046689;
Note=Gene prediction based on EST data.;
Name=4;
IsoId=Q9BQ95-4; Sequence=VSP_055626, VSP_026346;
Note=No experimental confirmation available.;
-!- SIMILARITY: Belongs to the ECSIT family. {ECO:0000305}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF243044; AAF62100.1; -; mRNA.
EMBL; AK314905; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; CR457204; CAG33485.1; -; mRNA.
EMBL; AC008481; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC000193; AAH00193.1; -; mRNA.
EMBL; BC005119; AAH05119.1; -; mRNA.
EMBL; BC008279; AAH08279.1; -; mRNA.
CCDS; CCDS12262.1; -. [Q9BQ95-1]
CCDS; CCDS45979.1; -. [Q9BQ95-3]
CCDS; CCDS45980.1; -. [Q9BQ95-2]
CCDS; CCDS59353.1; -. [Q9BQ95-4]
RefSeq; NP_001135936.1; NM_001142464.2. [Q9BQ95-2]
RefSeq; NP_001135937.1; NM_001142465.2. [Q9BQ95-3]
RefSeq; NP_001230133.1; NM_001243204.1. [Q9BQ95-4]
RefSeq; NP_057665.2; NM_016581.4. [Q9BQ95-1]
BioGrid; 119446; 120.
CORUM; Q9BQ95; -.
IntAct; Q9BQ95; 72.
MINT; Q9BQ95; -.
STRING; 9606.ENSP00000270517; -.
iPTMnet; Q9BQ95; -.
PhosphoSitePlus; Q9BQ95; -.
SwissPalm; Q9BQ95; -.
BioMuta; ECSIT; -.
DMDM; 74752234; -.
EPD; Q9BQ95; -.
jPOST; Q9BQ95; -.
MaxQB; Q9BQ95; -.
PaxDb; Q9BQ95; -.
PeptideAtlas; Q9BQ95; -.
PRIDE; Q9BQ95; -.
ProteomicsDB; 19054; -.
ProteomicsDB; 78645; -. [Q9BQ95-1]
ProteomicsDB; 78646; -. [Q9BQ95-2]
TopDownProteomics; Q9BQ95-1; -. [Q9BQ95-1]
Ensembl; ENST00000252440; ENSP00000252440; ENSG00000130159. [Q9BQ95-2]
Ensembl; ENST00000270517; ENSP00000270517; ENSG00000130159. [Q9BQ95-1]
Ensembl; ENST00000417981; ENSP00000412712; ENSG00000130159. [Q9BQ95-3]
Ensembl; ENST00000591104; ENSP00000466559; ENSG00000130159. [Q9BQ95-4]
GeneID; 51295; -.
KEGG; hsa:51295; -.
UCSC; uc002msb.4; human. [Q9BQ95-1]
CTD; 51295; -.
DisGeNET; 51295; -.
GeneCards; ECSIT; -.
HGNC; HGNC:29548; ECSIT.
HPA; HPA042979; -.
MIM; 608388; gene.
neXtProt; NX_Q9BQ95; -.
OpenTargets; ENSG00000130159; -.
PharmGKB; PA147358104; -.
eggNOG; KOG3941; Eukaryota.
eggNOG; ENOG41100I6; LUCA.
GeneTree; ENSGT00390000005147; -.
HOGENOM; HOG000112324; -.
InParanoid; Q9BQ95; -.
KO; K04405; -.
OMA; INVMPKG; -.
OrthoDB; 995360at2759; -.
PhylomeDB; Q9BQ95; -.
TreeFam; TF314943; -.
Reactome; R-HSA-166058; MyD88:MAL(TIRAP) cascade initiated on plasma membrane.
Reactome; R-HSA-6799198; Complex I biogenesis.
Reactome; R-HSA-975138; TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation.
Reactome; R-HSA-975871; MyD88 cascade initiated on plasma membrane.
GenomeRNAi; 51295; -.
PRO; PR:Q9BQ95; -.
Proteomes; UP000005640; Chromosome 19.
Bgee; ENSG00000130159; Expressed in 213 organ(s), highest expression level in apex of heart.
ExpressionAtlas; Q9BQ95; baseline and differential.
Genevisible; Q9BQ95; HS.
GO; GO:0005737; C:cytoplasm; IDA:UniProtKB.
GO; GO:0005829; C:cytosol; IDA:HPA.
GO; GO:0005743; C:mitochondrial inner membrane; TAS:Reactome.
GO; GO:0005739; C:mitochondrion; IDA:UniProtKB.
GO; GO:0005654; C:nucleoplasm; IDA:HPA.
GO; GO:0005634; C:nucleus; IDA:UniProtKB.
GO; GO:0016651; F:oxidoreductase activity, acting on NAD(P)H; IDA:UniProtKB.
GO; GO:0045087; P:innate immune response; IEA:UniProtKB-KW.
GO; GO:0032981; P:mitochondrial respiratory chain complex I assembly; TAS:Reactome.
GO; GO:0051341; P:regulation of oxidoreductase activity; IDA:UniProtKB.
InterPro; IPR029342; ECIST_C.
InterPro; IPR010418; ECSIT.
PANTHER; PTHR13113; PTHR13113; 1.
Pfam; PF06239; ECSIT; 1.
Pfam; PF14784; ECSIT_C; 1.
SMART; SM01284; ECSIT_Cterm; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm; Immunity;
Innate immunity; Mitochondrion; Nucleus; Polymorphism;
Reference proteome; Transit peptide.
TRANSIT 1 48 Mitochondrion. {ECO:0000255}.
CHAIN 49 431 Evolutionarily conserved signaling
intermediate in Toll pathway,
mitochondrial.
/FTId=PRO_0000291985.
VAR_SEQ 35 248 Missing (in isoform 3). {ECO:0000305}.
/FTId=VSP_046689.
VAR_SEQ 266 296 GIQSPDQQAALARHNPARPVFVEGPFSLWLR -> ELTCCP
RRRGKWKRRRRSGTSTTRCSWTWSM (in isoform 4).
{ECO:0000303|PubMed:14702039}.
/FTId=VSP_055626.
VAR_SEQ 267 296 IQSPDQQAALARHNPARPVFVEGPFSLWLR -> SGRDAGG
VEPLLPDAAGPGVCEEWLGQLRV (in isoform 2).
{ECO:0000303|PubMed:15489334}.
/FTId=VSP_026345.
VAR_SEQ 297 431 Missing (in isoform 2 and isoform 4).
{ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334}.
/FTId=VSP_026346.
VARIANT 278 278 R -> C (in dbSNP:rs34803265).
{ECO:0000269|Ref.1}.
/FTId=VAR_032907.
VARIANT 406 406 G -> R (in dbSNP:rs2302971).
/FTId=VAR_032908.
CONFLICT 242 242 V -> A (in Ref. 2; AK314905).
{ECO:0000305}.
SEQUENCE 431 AA; 49148 MW; 42AFEBFFA6953C80 CRC64;
MSWVQATLLA RGLCRAWGGT CGAALTGTSI SQVPRRLPRG LHCSAAAHSS EQSLVPSPPE
PRQRPTKALV PFEDLFGQAP GGERDKASFL QTVQKFAEHS VRKRGHIDFI YLALRKMREY
GVERDLAVYN QLLNIFPKEV FRPRNIIQRI FVHYPRQQEC GIAVLEQMEN HGVMPNKETE
FLLIQIFGRK SYPMLKLVRL KLWFPRFMNV NPFPVPRDLP QDPVELAMFG LRHMEPDLSA
RVTIYQVPLP KDSTGAADPP QPHIVGIQSP DQQAALARHN PARPVFVEGP FSLWLRNKCV
YYHILRADLL PPEEREVEET PEEWNLYYPM QLDLEYVRSG WDNYEFDINE VEEGPVFAMC
MAGAHDQATM AKWIQGLQET NPTLAQIPVV FRLAGSTREL QTSSAGLEEP PLPEDHQEED
DNLQRQQQGQ S


Related products :

Catalog number Product name Quantity
EIAAB12398 Ecsit,Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial,Mouse,Mus musculus,Protein SITPEC,Sitpec
18-003-43975 Evolutionarily conserved signaling intermediate in Toll pathway. mitochondrial - Protein SITPEC Polyclonal 0.1 mg Protein A
EIAAB12400 ECSIT,Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial,Homo sapiens,Human,Protein SITPEC
18-661-15206 Evolutionarily conserved signaling intermediate in Toll pathway - SITPEC protein Polyclonal 0.1 mg
E0863r Rat ELISA Kit FOR Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial 96T
CSB-EL007386RA Rat Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial(ECSIT) ELISA kit 96T
EIAAB12401 Ecsit,Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial,Rat,Rattus norvegicus
CSB-EL007386BO Bovine Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial(ECSIT) ELISA kit 96T
CSB-EL007386RA Rat Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial(ECSIT) ELISA kit SpeciesRat 96T
EIAAB12399 Bos taurus,Bovine,ECSIT,Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
CSB-EL007386HU Human Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial(ECSIT) ELISA kit 96T
CSB-EL007386MO Mouse Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial(ECSIT) ELISA kit 96T
CSB-EL007386MO Mouse Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial(ECSIT) ELISA kit SpeciesMouse 96T
CSB-EL007386BO Bovine Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial(ECSIT) ELISA kit SpeciesBovine 96T
CSB-EL007386HU Human Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial(ECSIT) ELISA kit SpeciesHuman 96T
ECSIT_MOUSE ELISA Kit FOR Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial; organism: Mouse; gene name: Ecsit 96T
GWB-BC84C0 Evolutionarily Conserved Signaling Intermediate In Toll Pathway (ECSIT) Rabbit anti-Human Polyclonal (C-Terminus) Antibody
GWB-66DB9E Evolutionarily Conserved Signaling Intermediate In Toll Pathway (ECSIT) Rabbit anti-Human Polyclonal (C-Terminus) Antibody
30-426 MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. Western blots using two different antibodies 0.05 mg
30-427 MFNG is one of the evolutionarily conserved secreted proteins that act in the Notch receptor pathway to demarcate boundaries during embryonic development. Western blots using two different antibodies 0.05 mg
27-718 IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53), whereas ASPP1 and ASPP2 are activators of p53.IASPP is one of the most evolutionarily conserved inhibitors of p53 (TP53; MIM 0.05 mg
29-805 RGS18 is a member of the regulator of G-protein signaling family. This protein is contains a conserved, 120 amino acid motif called the RGS domain. The protein attenuates the signaling activity of G-p 0.1 mg
31-039 ROC1 encodes an evolutionarily conserved protein that interacts with cullins. The protein plays a unique role in the ubiquitination reaction by heterodimerizing with cullin-1 to catalyze ubiquitin pol 0.1 mg
25-367 ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The protein may function as an anticoagulant that indirectly inhibits the thromboplastin-s 0.05 mg
60511 SRE Reporter Kit (MAPK_ERK Signaling Pathway ),The MAPK_ERK signaling pathway is a major participant in the regulation of cell growth and differentiation. It can be activated by various extracellular 500 reactions
Pathways :
WP2272: Pathogenic Escherichia coli infection
WP949: Toll-like receptor signaling pathway
WP1309: Toll-like receptor signaling pathway
WP2292: Chemokine signaling pathway
WP1384: Toll-like receptor signaling pathway
WP931: G Protein Signaling Pathways
WP2032: TSH signaling pathway
WP1449: Regulation of toll-like receptor signaling pathway
WP1371: G Protein Signaling Pathways
WP73: G Protein Signaling Pathways
WP1183: Toll-like receptor signaling pathway
WP2203: TSLP Signaling Pathway
WP1271: Toll-like receptor signaling pathway
WP75: Toll-like receptor signaling pathway
WP232: G Protein Signaling Pathways
WP813: G Protein Signaling Pathways
WP35: G Protein Signaling Pathways
WP1165: G Protein Signaling Pathways
WP382: MAPK signaling pathway
WP829: Toll-like receptor signaling pathway
WP1049: G Protein Signaling Pathways
WP769: MAPK signaling pathway
WP1067: Toll-like receptor signaling pathway
WP211: BMP signaling pathway
WP1773: TLR3 signaling pathway

Related Genes :
[Ecsit Sitpec] Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial (Protein SITPEC)
[ECSIT] Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial (Protein SITPEC)
[Ecsit] Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
[ECSIT] Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
[ecsit] Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
[ecsit zgc:152999] Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
[ECSIT QccE-10646] Evolutionarily conserved signaling intermediate in Toll pathway, mitochondrial
[Mavs Ips1 Visa] Mitochondrial antiviral-signaling protein (MAVS) (CARD adapter inducing interferon beta) (Cardif) (Interferon beta promoter stimulator protein 1) (IPS-1) (Virus-induced-signaling adapter) (VISA)
[TICAM1 PRVTIRB TRIF] TIR domain-containing adapter molecule 1 (TICAM-1) (Proline-rich, vinculin and TIR domain-containing protein B) (Putative NF-kappa-B-activating protein 502H) (Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta) (MyD88-3) (TIR domain-containing adapter protein inducing IFN-beta)
[TICAM2 TIRAP3 TIRP TRAM] TIR domain-containing adapter molecule 2 (TICAM-2) (Putative NF-kappa-B-activating protein 502) (TRIF-related adapter molecule) (Toll-like receptor adaptor protein 3) (Toll/interleukin-1 receptor domain-containing protein) (MyD88-4)
[MAVS IPS1 KIAA1271 VISA] Mitochondrial antiviral-signaling protein (MAVS) (CARD adapter inducing interferon beta) (Cardif) (Interferon beta promoter stimulator protein 1) (IPS-1) (Putative NF-kappa-B-activating protein 031N) (Virus-induced-signaling adapter) (VISA)
[FXN FRDA X25] Frataxin, mitochondrial (EC 1.16.3.1) (Friedreich ataxia protein) (Fxn) [Cleaved into: Frataxin intermediate form (i-FXN); Frataxin(56-210) (m56-FXN); Frataxin(78-210) (d-FXN) (m78-FXN); Frataxin mature form (Frataxin(81-210)) (m81-FXN)]
[TOLLIP] Toll-interacting protein
[SEPTIN4 ARTS PNUTL2 SEP4 SEPT4 hucep-7] Septin-4 (Apoptosis-related protein in the TGF-beta signaling pathway) (ARTS) (Bradeion beta) (Brain protein H5) (CE5B3 beta) (Cell division control-related protein 2) (hCDCREL-2) (Cerebral protein 7) (Peanut-like protein 2)
[Mavs Ips1 Visa] Mitochondrial antiviral-signaling protein (MAVS) (Interferon beta promoter stimulator protein 1) (IPS-1) (Virus-induced-signaling adapter) (VISA)
[Ticam1 Trif] TIR domain-containing adapter molecule 1 (TICAM-1) (Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta) (TIR domain-containing adapter protein inducing IFN-beta)
[Ticam2 Tirp Tram] TIR domain-containing adapter molecule 2 (TICAM-2) (TRIF-related adapter molecule) (Toll/interleukin-1 receptor domain-containing protein)
[TLR2 TIL4] Toll-like receptor 2 (Toll/interleukin-1 receptor-like protein 4) (CD antigen CD282)
[TLR1 KIAA0012] Toll-like receptor 1 (Toll/interleukin-1 receptor-like protein) (TIL) (CD antigen CD281)
[TLR4] Toll-like receptor 4 (hToll) (CD antigen CD284)
[Tlr1] Toll-like receptor 1 (Toll/interleukin-1 receptor-like protein) (TIL) (CD antigen CD281)
[TLR6] Toll-like receptor 6 (CD antigen CD286)
[TLR5 TIL3] Toll-like receptor 5 (Toll/interleukin-1 receptor-like protein 3)
[PAM16 MAGMAS TIM16 TIMM16 CGI-136] Mitochondrial import inner membrane translocase subunit TIM16 (Mitochondria-associated granulocyte macrophage CSF-signaling molecule) (Presequence translocated-associated motor subunit PAM16)
[APEX1 APE APE1 APEX APX HAP1 REF1] DNA-(apurinic or apyrimidinic site) lyase (EC 3.1.-.-) (EC 4.2.99.18) (APEX nuclease) (APEN) (Apurinic-apyrimidinic endonuclease 1) (AP endonuclease 1) (APE-1) (REF-1) (Redox factor-1) [Cleaved into: DNA-(apurinic or apyrimidinic site) lyase, mitochondrial]
[Tlr4] Toll-like receptor 4 (Toll4) (CD antigen CD284)
[Apex1 Ape Apex Ref1] DNA-(apurinic or apyrimidinic site) lyase (EC 3.1.-.-) (EC 4.2.99.18) (APEX nuclease) (APEN) (Apurinic-apyrimidinic endonuclease 1) (AP endonuclease 1) (REF-1) (Redox factor-1) [Cleaved into: DNA-(apurinic or apyrimidinic site) lyase, mitochondrial]
[Apex1 Ape Apex Ref1] DNA-(apurinic or apyrimidinic site) lyase (EC 3.1.-.-) (EC 4.2.99.18) (APEX nuclease) (APEN) (Apurinic-apyrimidinic endonuclease 1) (AP endonuclease 1) (REF-1) (Redox factor-1) [Cleaved into: DNA-(apurinic or apyrimidinic site) lyase, mitochondrial]
[APEX1 APE APEX BAP1 REF1] DNA-(apurinic or apyrimidinic site) lyase (EC 3.1.-.-) (EC 4.2.99.18) (APEX nuclease) (APEN) (Apurinic-apyrimidinic endonuclease 1) (AP endonuclease 1) (REF-1) (Redox factor-1) [Cleaved into: DNA-(apurinic or apyrimidinic site) lyase, mitochondrial]
[Toll-7 CG8595] Toll-like receptor 7

Bibliography :