GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Filamin A-interacting protein 1-like (130 kDa GPBP-interacting protein) (90 kDa GPBP-interacting protein) (Protein down-regulated in ovarian cancer 1) (DOC-1)

 FIL1L_HUMAN             Reviewed;        1135 AA.
Q4L180; B2CNV7; B2CNV8; Q13597; Q2YDY5; Q6KFX5; Q6KFX6; Q6KFX7; Q8IUM3;
Q8N6Z0;
04-DEC-2007, integrated into UniProtKB/Swiss-Prot.
04-DEC-2007, sequence version 2.
29-SEP-2021, entry version 119.
RecName: Full=Filamin A-interacting protein 1-like;
AltName: Full=130 kDa GPBP-interacting protein;
AltName: Full=90 kDa GPBP-interacting protein;
AltName: Full=Protein down-regulated in ovarian cancer 1;
Short=DOC-1;
Name=FILIP1L; Synonyms=COL4A3BPIP, DOC1, GIP90;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
Wong K.-K., Mok S.C.;
"Cloning and sequencing of full length Doc1 and Doc2 mRNAs.";
Submitted (APR-1996) to the EMBL/GenBank/DDBJ databases.
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
TISSUE=Skeletal muscle;
Revert-Ros F., Raya A., Granero F., Saus J.;
Submitted (DEC-2000) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), AND VARIANT HIS-168.
Revert-Ros F.J., Saus J.;
Submitted (MAY-2002) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND VARIANT HIS-168.
Revert F., Revert-Ros F.J., Saus J.;
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 6 AND 7).
TISSUE=Skeletal muscle;
Revert-Ros F.J., Lopez-Pascual E., Saus J.;
"Molecular cloning of novel isoforms of downregulated in ovarian cancer 1
(DOC1) protein.";
Submitted (FEB-2008) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16641997; DOI=10.1038/nature04728;
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J.,
Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P.,
Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A.,
Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L.,
Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G.,
Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W.,
Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M.,
Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P.,
Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H.,
Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J.,
Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W.,
Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B.,
Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O.,
Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B.,
Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H.,
Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J.,
Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X.,
Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R.,
Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.;
"The DNA sequence, annotation and analysis of human chromosome 3.";
Nature 440:1194-1198(2006).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
Hunkapiller M.W., Myers E.W., Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
TISSUE=Pancreas, and Skeletal muscle;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[9]
TISSUE SPECIFICITY.
PubMed=8314147; DOI=10.1006/gyno.1994.1040;
Mok S.C., Wong K.-K., Chan R.K.W., Lau C.C., Tsao S.-W., Knapp R.C.,
Berkowitz R.S.;
"Molecular cloning of differentially expressed genes in human epithelial
ovarian cancer.";
Gynecol. Oncol. 52:247-252(1994).
[10]
INDUCTION.
PubMed=15935955; DOI=10.1016/j.cyto.2005.01.020;
Tandle A.T., Mazzanti C., Alexander H.R., Roberts D.D., Libutti S.K.;
"Endothelial monocyte activating polypeptide-II induced gene expression
changes in endothelial cells.";
Cytokine 30:347-358(2005).
[11]
FUNCTION, INDUCTION, SUBCELLULAR LOCATION, AND TISSUE SPECIFICITY.
PubMed=18794120; DOI=10.1158/0008-5472.can-08-1087;
Kwon M., Hanna E., Lorang D., He M., Quick J.S., Adem A., Stevenson C.,
Chung J.-Y., Hewitt S.M., Zudaire E., Esposito D., Cuttitta F.,
Libutti S.K.;
"Functional characterization of filamin a interacting protein 1-like, a
novel candidate for antivascular cancer therapy.";
Cancer Res. 68:7332-7341(2008).
[12]
PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-791, AND IDENTIFICATION BY
MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Liver;
PubMed=24275569; DOI=10.1016/j.jprot.2013.11.014;
Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L.,
Ye M., Zou H.;
"An enzyme assisted RP-RPLC approach for in-depth analysis of human liver
phosphoproteome.";
J. Proteomics 96:253-262(2014).
-!- FUNCTION: Acts as a regulator of the antiangiogenic activity on
endothelial cells. When overexpressed in endothelial cells, leads to
inhibition of cell proliferation and migration and an increase in
apoptosis. Inhibits melanoma growth When expressed in tumor-associated
vasculature. {ECO:0000269|PubMed:18794120}.
-!- INTERACTION:
Q4L180-3; P53814-5: SMTN; NbExp=3; IntAct=EBI-12221557, EBI-11100581;
-!- SUBCELLULAR LOCATION: Cytoplasm {ECO:0000269|PubMed:18794120}. Membrane
{ECO:0000269|PubMed:18794120}. Nucleus {ECO:0000269|PubMed:18794120}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=7;
Name=1; Synonyms=a, d;
IsoId=Q4L180-1; Sequence=Displayed;
Name=2; Synonyms=b, c;
IsoId=Q4L180-2; Sequence=VSP_029206;
Name=3;
IsoId=Q4L180-3; Sequence=VSP_029201, VSP_029206;
Name=4;
IsoId=Q4L180-4; Sequence=VSP_029202, VSP_029203;
Name=5;
IsoId=Q4L180-5; Sequence=VSP_029201, VSP_029204, VSP_029205,
VSP_029206;
Name=6;
IsoId=Q4L180-6; Sequence=VSP_036502;
Name=7;
IsoId=Q4L180-7; Sequence=VSP_029201;
-!- TISSUE SPECIFICITY: Expressed in endothelial cells, colon and colon
cancers. In the colon, expressed in the vasculature and muscularis
mucosa. In colon cancer, strongly expressed in tumor stroma and the
vasculature (at protein level). Expressed in ovarian epithelial cells.
Down-regulated in ovarian cancer. {ECO:0000269|PubMed:18794120,
ECO:0000269|PubMed:8314147}.
-!- INDUCTION: Up-regulated in endothelial cells with the angiogenesis
inhibitors endostatin and fumagillin. By endothelial monocyte-
activating polypeptide II in endothelial cells.
{ECO:0000269|PubMed:15935955, ECO:0000269|PubMed:18794120}.
-!- SIMILARITY: Belongs to the FILIP1 family. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=AAA98972.1; Type=Frameshift; Evidence={ECO:0000305};
Sequence=AAN16206.1; Type=Frameshift; Evidence={ECO:0000305};
Sequence=ACB37436.1; Type=Frameshift; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; U53445; AAA98972.1; ALT_FRAME; mRNA.
EMBL; AF329092; AAN16206.1; ALT_FRAME; mRNA.
EMBL; AF514867; AAQ08177.1; -; mRNA.
EMBL; AF514868; AAQ08178.1; -; mRNA.
EMBL; AF514869; AAQ08179.1; -; mRNA.
EMBL; AY642382; AAV34207.1; -; mRNA.
EMBL; EU531865; ACB37436.1; ALT_FRAME; mRNA.
EMBL; EU531866; ACB37437.1; -; mRNA.
EMBL; AC024938; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC069222; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; AC117419; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471052; EAW79833.1; -; Genomic_DNA.
EMBL; BC020941; AAH20941.1; -; mRNA.
EMBL; BC027860; AAH27860.1; -; mRNA.
CCDS; CCDS43117.1; -. [Q4L180-1]
CCDS; CCDS43118.1; -. [Q4L180-2]
CCDS; CCDS43119.1; -. [Q4L180-3]
CCDS; CCDS63700.1; -. [Q4L180-7]
CCDS; CCDS74969.1; -. [Q4L180-6]
RefSeq; NP_001035924.1; NM_001042459.2. [Q4L180-2]
RefSeq; NP_001269722.1; NM_001282793.1. [Q4L180-6]
RefSeq; NP_001269723.1; NM_001282794.1. [Q4L180-7]
RefSeq; NP_055705.2; NM_014890.3. [Q4L180-3]
RefSeq; NP_878913.2; NM_182909.3. [Q4L180-1]
RefSeq; XP_006713549.1; XM_006713486.2.
SMR; Q4L180; -.
BioGRID; 116419; 6.
IntAct; Q4L180; 7.
STRING; 9606.ENSP00000346560; -.
GlyGen; Q4L180; 1 site, 1 O-linked glycan (1 site).
iPTMnet; Q4L180; -.
PhosphoSitePlus; Q4L180; -.
BioMuta; FILIP1L; -.
DMDM; 162416295; -.
jPOST; Q4L180; -.
MassIVE; Q4L180; -.
MaxQB; Q4L180; -.
PaxDb; Q4L180; -.
PeptideAtlas; Q4L180; -.
PRIDE; Q4L180; -.
ProteomicsDB; 62218; -. [Q4L180-1]
ProteomicsDB; 62219; -. [Q4L180-2]
ProteomicsDB; 62220; -. [Q4L180-3]
ProteomicsDB; 62221; -. [Q4L180-4]
ProteomicsDB; 62222; -. [Q4L180-5]
ProteomicsDB; 62223; -. [Q4L180-6]
ProteomicsDB; 62224; -. [Q4L180-7]
Antibodypedia; 46504; 106 antibodies.
DNASU; 11259; -.
Ensembl; ENST00000331335; ENSP00000327880; ENSG00000168386. [Q4L180-2]
Ensembl; ENST00000354552; ENSP00000346560; ENSG00000168386. [Q4L180-1]
Ensembl; ENST00000383694; ENSP00000373192; ENSG00000168386. [Q4L180-3]
Ensembl; ENST00000398326; ENSP00000381371; ENSG00000168386. [Q4L180-4]
Ensembl; ENST00000471562; ENSP00000419642; ENSG00000168386. [Q4L180-7]
Ensembl; ENST00000487087; ENSP00000417774; ENSG00000168386. [Q4L180-6]
GeneID; 11259; -.
KEGG; hsa:11259; -.
UCSC; uc003dtm.4; human. [Q4L180-1]
CTD; 11259; -.
DisGeNET; 11259; -.
GeneCards; FILIP1L; -.
HGNC; HGNC:24589; FILIP1L.
HPA; ENSG00000168386; Low tissue specificity.
MIM; 612993; gene.
neXtProt; NX_Q4L180; -.
OpenTargets; ENSG00000168386; -.
PharmGKB; PA162388580; -.
VEuPathDB; HostDB:ENSG00000168386; -.
eggNOG; KOG1103; Eukaryota.
GeneTree; ENSGT00950000182852; -.
HOGENOM; CLU_104016_0_0_1; -.
InParanoid; Q4L180; -.
OMA; NGNFMQP; -.
OrthoDB; 111454at2759; -.
PhylomeDB; Q4L180; -.
TreeFam; TF331399; -.
PathwayCommons; Q4L180; -.
SIGNOR; Q4L180; -.
BioGRID-ORCS; 11259; 7 hits in 1024 CRISPR screens.
ChiTaRS; FILIP1L; human.
GenomeRNAi; 11259; -.
Pharos; Q4L180; Tbio.
PRO; PR:Q4L180; -.
Proteomes; UP000005640; Chromosome 3.
RNAct; Q4L180; protein.
Bgee; ENSG00000168386; Expressed in thoracic aorta and 229 other tissues.
ExpressionAtlas; Q4L180; baseline and differential.
Genevisible; Q4L180; HS.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell.
GO; GO:0016020; C:membrane; IEA:UniProtKB-SubCell.
GO; GO:0005634; C:nucleus; IEA:UniProtKB-SubCell.
InterPro; IPR019131; Cortactin-binding_p2_N.
Pfam; PF09727; CortBP2; 1.
1: Evidence at protein level;
Alternative splicing; Coiled coil; Cytoplasm; Membrane; Nucleus;
Phosphoprotein; Reference proteome.
CHAIN 1..1135
/note="Filamin A-interacting protein 1-like"
/id="PRO_0000309470"
REGION 1..65
/note="Disordered"
/evidence="ECO:0000256|SAM:MobiDB-lite"
COILED 164..782
/evidence="ECO:0000255"
COMPBIAS 1..16
/note="Basic and acidic residues"
/evidence="ECO:0000256|SAM:MobiDB-lite"
MOD_RES 791
/note="Phosphoserine"
/evidence="ECO:0007744|PubMed:24275569"
MOD_RES 986
/note="Phosphothreonine"
/evidence="ECO:0000250|UniProtKB:Q6P6L0"
MOD_RES 994
/note="Phosphothreonine"
/evidence="ECO:0000250|UniProtKB:Q6P6L0"
MOD_RES 1052
/note="Phosphoserine"
/evidence="ECO:0000250|UniProtKB:Q6P6L0"
VAR_SEQ 1..424
/note="Missing (in isoform 6)"
/evidence="ECO:0000303|Ref.5"
/id="VSP_036502"
VAR_SEQ 1..240
/note="Missing (in isoform 3, isoform 5 and isoform 7)"
/evidence="ECO:0000303|PubMed:15489334, ECO:0000303|Ref.1,
ECO:0000303|Ref.5"
/id="VSP_029201"
VAR_SEQ 203..255
/note="LKKLIDQEIKSQEEKEQEKEKRVTTLKEELTKLKSFALMVVDEQQRLTAQLT
L -> WSLALLPRLECNGMILAHCNLCLLGSSDSPASAFQVAGITGTRHHAQLVFVFL
(in isoform 4)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_029202"
VAR_SEQ 256..1135
/note="Missing (in isoform 4)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_029203"
VAR_SEQ 373..386
/note="Missing (in isoform 5)"
/evidence="ECO:0000303|Ref.1"
/id="VSP_029204"
VAR_SEQ 1075..1080
/note="Missing (in isoform 5)"
/evidence="ECO:0000303|Ref.1"
/id="VSP_029205"
VAR_SEQ 1129..1135
/note="EPLLLPH -> SNIYN (in isoform 2, isoform 3 and
isoform 5)"
/evidence="ECO:0000303|PubMed:15489334, ECO:0000303|Ref.1,
ECO:0000303|Ref.3"
/id="VSP_029206"
VARIANT 168
/note="R -> H (in dbSNP:rs793440)"
/evidence="ECO:0000269|Ref.3, ECO:0000269|Ref.4"
/id="VAR_050993"
VARIANT 884
/note="A -> P (in dbSNP:rs28362487)"
/id="VAR_050994"
CONFLICT 532
/note="V -> A (in Ref. 5; ACB37437)"
/evidence="ECO:0000305"
CONFLICT 576
/note="E -> G (in Ref. 5; ACB37436)"
/evidence="ECO:0000305"
CONFLICT 746..747
/note="LQ -> CK (in Ref. 1; AAA98972)"
/evidence="ECO:0000305"
CONFLICT 919
/note="I -> T (in Ref. 5; ACB37436)"
/evidence="ECO:0000305"
CONFLICT 961
/note="T -> A (in Ref. 5; ACB37436)"
/evidence="ECO:0000305"
SEQUENCE 1135 AA; 130382 MW; 8F1E896D20F5B776 CRC64;
MRSRGSDTEG SAQKKFPRHT KGHSFQGPKN MKHRQQDKDS PSESDVILPC PKAEKPHSGN
GHQAEDLSRD DLLFLLSILE GELQARDEVI GILKAEKMDL ALLEAQYGFV TPKKVLEALQ
RDAFQAKSTP WQEDIYEKPM NELDKVVEKH KESYRRILGQ LLVAEKSRRQ TILELEEEKR
KHKEYMEKSD EFICLLEQEC ERLKKLIDQE IKSQEEKEQE KEKRVTTLKE ELTKLKSFAL
MVVDEQQRLT AQLTLQRQKI QELTTNAKET HTKLALAEAR VQEEEQKATR LEKELQTQTT
KFHQDQDTIM AKLTNEDSQN RQLQQKLAAL SRQIDELEET NRSLRKAEEE LQDIKEKISK
GEYGNAGIMA EVEELRKRVL DMEGKDEELI KMEEQCRDLN KRLERETLQS KDFKLEVEKL
SKRIMALEKL EDAFNKSKQE CYSLKCNLEK ERMTTKQLSQ ELESLKVRIK ELEAIESRLE
KTEFTLKEDL TKLKTLTVMF VDERKTMSEK LKKTEDKLQA ASSQLQVEQN KVTTVTEKLI
EETKRALKSK TDVEEKMYSV TKERDDLKNK LKAEEEKGND LLSRVNMLKN RLQSLEAIEK
DFLKNKLNQD SGKSTTALHQ ENNKIKELSQ EVERLKLKLK DMKAIEDDLM KTEDEYETLE
RRYANERDKA QFLSKELEHV KMELAKYKLA EKTETSHEQW LFKRLQEEEA KSGHLSREVD
ALKEKIHEYM ATEDLICHLQ GDHSVLQKKL NQQENRNRDL GREIENLTKE LERYRHFSKS
LRPSLNGRRI SDPQVFSKEV QTEAVDNEPP DYKSLIPLER AVINGQLYEE SENQDEDPND
EGSVLSFKCS QSTPCPVNRK LWIPWMKSKE GHLQNGKMQT KPNANFVQPG DLVLSHTPGQ
PLHIKVTPDH VQNTATLEIT SPTTESPHSY TSTAVIPNCG TPKQRITILQ NASITPVKSK
TSTEDLMNLE QGMSPITMAT FARAQTPESC GSLTPERTMS PIQVLAVTGS ASSPEQGRSP
EPTEISAKHA IFRVSPDRQS SWQFQRSNSN SSSVITTEDN KIHIHLGSPY MQAVASPVRP
ASPSAPLQDN RTQGLINGAL NKTTNKVTSS ITITPTATPL PRQSQITVEP LLLPH


Related products :

Catalog number Product name Quantity
EIAAB27017 45 kDa NF-AT-interacting protein,45 kDa NFAT-interacting protein,Homo sapiens,Human,NFATC2-interacting protein,NFATC2IP,NIP45,Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein
EIAAB27018 45 kDa NF-AT-interacting protein,45 kDa NFAT-interacting protein,Mouse,Mus musculus,NFATC2-interacting protein,Nfatc2ip,Nip45,Nuclear factor of activated T-cells, cytoplasmic 2-interacting protein
EIAAB31218 Homo sapiens,hPIP1,Human,p21-activated protein kinase-interacting protein 1,PAK_PLC-interacting protein 1,PAK1-interacting protein 1,PAK1IP1,PIP1,WD repeat-containing protein 84,WDR84
EIAAB39347 Mouse,Mus musculus,Spata24,Spermatogenesis-associated protein 24,TATA-binding protein-like factor-interacting protein,Testis protein T6441 homolog,Tipt,Tipt2,TLF-interacting protein,TRF2-interacting p
EIAAB46349 Homo sapiens,Human,Protein PRPL-2,WAS_WASL-interacting protein family member 1,WASP-interacting protein,WASPIP,WIP,WIPF1,Wiskott-Aldrich syndrome protein-interacting protein
EIAAB07420 Cdc42-interacting protein 4,CIP4,Homo sapiens,hSTP,Human,Protein Felic,Salt tolerant protein,STOT,STP,Thyroid receptor-interacting protein 10,TR-interacting protein 10,TRIP10,TRIP-10
EIAAB14471 FBLIM1,FBLP1,FBLP-1,Filamin-binding LIM protein 1,Homo sapiens,Human,MIG2-interacting protein,Migfilin,Mitogen-inducible 2-interacting protein
EIAAB39604 54 kDa VacA-interacting protein,54 kDa vimentin-interacting protein,90 kDa SH3 protein interacting with Nck,AF3p21,AF3P21,Dia-interacting protein 1,Diaphanous protein-interacting protein,DIP-1,Homo sa
EIAAB39603 54 kDa VacA-interacting protein,90 kDa N-WASP-interacting protein,90 kDa SH3 protein interacting with Nck,Mouse,Mus musculus,NCK-interacting protein with SH3 domain,Nckipsd,N-WASP-binding protein,SH3
EIAAB31034 Androgen receptor-interacting protein 3,ARIP3,DAB2-interacting protein,DIP,E3 SUMO-protein ligase PIAS2,Homo sapiens,Human,Miz1,Msx-interacting zinc finger protein,PIAS2,PIAS-NY protein,PIASX,Protein
EIAAB30253 Aip1,ALG-2-interacting protein 1,ALG-2-interacting protein X,Alix,E2F1-inducible protein,Eig2,Mouse,Mus musculus,Pdcd6ip,Programmed cell death 6-interacting protein
EIAAB32252 Addicsin,ADP-ribosylation factor-like protein 6-interacting protein 5,Aip5,Aip-5,ARL-6-interacting protein 5,Arl6ip5,Glutamate transporter EAAC1-interacting protein,GTRAP3-18,Jwa,Mouse,Mus musculus,PR
EIAAB46351 Rat,Rattus norvegicus,WAS_WASL-interacting protein family member 1,WASP-interacting protein,Waspip,Wip,Wipf1,Wiskott-Aldrich syndrome protein-interacting protein
EIAAB46350 Mouse,Mus musculus,WAS_WASL-interacting protein family member 1,WASP-interacting protein,Waspip,Wip,Wipf1,Wiskott-Aldrich syndrome protein-interacting protein
EIAAB44012 Homo sapiens,Human,OIP1,OIP-1,Opa-interacting protein 1,Thyroid receptor-interacting protein 6,TR-interacting protein 6,TRIP6,TRIP-6,ZRP-1,Zyxin-related protein 1
EIAAB07421 Cdc42-interacting protein 4,Cip4,Rat,Rattus norvegicus,Salt tolerant protein,Stp,Thyroid receptor-interacting protein 10,TR-interacting protein 10,Trip10,TRIP-10
EIAAB31033 Androgen receptor-interacting protein 3,ARIP3,DAB2-interacting protein,DIP,E3 SUMO-protein ligase PIAS2,Miz1,Mouse,Msx-interacting zinc finger protein,Mus musculus,Pias2,Piasx,Protein inhibitor of act
EIAAB31032 Androgen receptor-interacting protein 3,ARIP3,DAB2-interacting protein,DIP,E3 SUMO-protein ligase PIAS2,Miz1,Msx-interacting-zinc finger protein,Pias2,Piasx,Protein inhibitor of activated STAT x,Prote
10-288-21983F Calcium and integrin-binding protein 1 - Calmyrin; DNA-PKcs-interacting protein; Kinase-interacting protein; KIP; CIB; SNK-interacting protein 2-28; SIP2-28 0.1 mg
10-288-21983F Calcium and integrin-binding protein 1 - Calmyrin; DNA-PKcs-interacting protein; Kinase-interacting protein; KIP; CIB; SNK-interacting protein 2-28; SIP2-28 0.05 mg
EIAAB29754 Homo sapiens,HSPC218,Human,PABP-interacting protein 2,PAIP2,PAIP-2,PAIP2A,Poly(A)-binding protein-interacting protein 2,Polyadenylate-binding protein-interacting protein 2
EIAAB29748 Homo sapiens,Human,KIAA1155,PABP-interacting protein 2B,PAIP2B,PAIP-2B,Poly(A)-binding protein-interacting protein 2B,Polyadenylate-binding protein-interacting protein 2B
EIAAB30252 AIP1,ALG-2-interacting protein 1,ALIX,Homo sapiens,Hp95,Human,KIAA1375,PDCD6-interacting protein,PDCD6IP,Programmed cell death 6-interacting protein
EIAAB32248 ADP-ribosylation factor-like protein 6-interacting protein 5,Aip-5,ARL-6-interacting protein 5,Arl6ip5,Glutamate transporter EAAC1-interacting protein,GTRAP3-18,Gtrap3-18,Jwa,PRA1 family protein 3,Pra
EIAAB29747 Kiaa1155,Mouse,Mus musculus,PABP-interacting protein 2B,Paip2b,PAIP-2B,Poly(A)-binding protein-interacting protein 2B,Polyadenylate-binding protein-interacting protein 2B
Pathways :
WP525: Mitochondrial Unfolded-Protein Response
WP1676: Non-homologous end-joining
WP232: G Protein Signaling Pathways
WP1689: Porphyrin and chlorophyll metabolism
WP1624: Bacterial secretion system
WP2032: TSH signaling pathway
WP1650: Fluorobenzoate degradation
WP211: BMP signaling pathway
WP1693: Purine metabolism
WP2371: Parkinsons Disease Pathway
WP1371: G Protein Signaling Pathways
WP1713: Two-component system
WP1659: Glycine, serine and threonine metabolism
WP2218: sGC
WP1665: Limonene and pinene degradation
WP2272: Pathogenic Escherichia coli infection
WP1493: Carbon assimilation C4 pathway
WP1892: Protein folding
WP1566: Citrate cycle (TCA cycle)
WP1675: Nitrogen metabolism
WP2292: Chemokine signaling pathway
WP1685: Peptidoglycan biosynthesis
WP1616: ABC transporters
WP731: Sterol regulatory element binding protein related
WP1644: DNA replication

Related Genes :
[NCKIPSD AF3P21 SPIN90] NCK-interacting protein with SH3 domain (54 kDa VacA-interacting protein) (54 kDa vimentin-interacting protein) (VIP54) (90 kDa SH3 protein interacting with Nck) (AF3p21) (Dia-interacting protein 1) (DIP-1) (Diaphanous protein-interacting protein) (SH3 adapter protein SPIN90) (WASP-interacting SH3-domain protein) (WISH) (Wiskott-Aldrich syndrome protein-interacting protein)
[MED1 ARC205 CRSP1 CRSP200 DRIP205 DRIP230 PBP PPARBP PPARGBP RB18A TRAP220 TRIP2] Mediator of RNA polymerase II transcription subunit 1 (Activator-recruited cofactor 205 kDa component) (ARC205) (Mediator complex subunit 1) (Peroxisome proliferator-activated receptor-binding protein) (PBP) (PPAR-binding protein) (Thyroid hormone receptor-associated protein complex 220 kDa component) (Trap220) (Thyroid receptor-interacting protein 2) (TR-interacting protein 2) (TRIP-2) (Vitamin D receptor-interacting protein complex component DRIP205) (p53 regulatory protein RB18A)
[BNIP3L BNIP3A BNIP3H NIX] BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (Adenovirus E1B19K-binding protein B5) (BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A) (NIP3-like protein X) (NIP3L)
[NCOA3 AIB1 BHLHE42 RAC3 TRAM1] Nuclear receptor coactivator 3 (NCoA-3) (EC 2.3.1.48) (ACTR) (Amplified in breast cancer 1 protein) (AIB-1) (CBP-interacting protein) (pCIP) (Class E basic helix-loop-helix protein 42) (bHLHe42) (Receptor-associated coactivator 3) (RAC-3) (Steroid receptor coactivator protein 3) (SRC-3) (Thyroid hormone receptor activator molecule 1) (TRAM-1)
[UBQLN4 C1orf6 CIP75 UBIN] Ubiquilin-4 (Ataxin-1 interacting ubiquitin-like protein) (A1Up) (Ataxin-1 ubiquitin-like-interacting protein A1U) (Connexin43-interacting protein of 75 kDa) (CIP75)
[BECN1 GT197] Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]
[RUVBL1 INO80H NMP238 TIP49 TIP49A] RuvB-like 1 (EC 3.6.4.12) (49 kDa TATA box-binding protein-interacting protein) (49 kDa TBP-interacting protein) (54 kDa erythrocyte cytosolic protein) (ECP-54) (INO80 complex subunit H) (Nuclear matrix protein 238) (NMP 238) (Pontin 52) (TIP49a) (TIP60-associated protein 54-alpha) (TAP54-alpha)
[NCOA6 AIB3 KIAA0181 RAP250 TRBP] Nuclear receptor coactivator 6 (Activating signal cointegrator 2) (ASC-2) (Amplified in breast cancer protein 3) (Cancer-amplified transcriptional coactivator ASC-2) (Nuclear receptor coactivator RAP250) (NRC RAP250) (Nuclear receptor-activating protein, 250 kDa) (Peroxisome proliferator-activated receptor-interacting protein) (PPAR-interacting protein) (PRIP) (Thyroid hormone receptor-binding protein)
[WIPI1 WIPI49] WD repeat domain phosphoinositide-interacting protein 1 (WIPI-1) (Atg18 protein homolog) (WD40 repeat protein interacting with phosphoinositides of 49 kDa) (WIPI 49 kDa)
[Wipi1 D11Ertd498e] WD repeat domain phosphoinositide-interacting protein 1 (WIPI-1) (WD40 repeat protein interacting with phosphoinositides of 49 kDa) (WIPI 49 kDa)
[DAB2IP AF9Q34 AIP1 KIAA1743] Disabled homolog 2-interacting protein (DAB2 interaction protein) (DAB2-interacting protein) (ASK-interacting protein 1) (AIP-1) (DOC-2/DAB-2 interactive protein)
[CERT1 CERT COL4A3BP STARD11] Ceramide transfer protein (hCERT) (Collagen type IV alpha-3-binding protein) (Goodpasture antigen-binding protein) (GPBP) (START domain-containing protein 11) (StARD11) (StAR-related lipid transfer protein 11)
[Dab2ip] Disabled homolog 2-interacting protein (DAB2-interacting protein) (ASK-interacting protein 1) (AIP-1) (DIP1/2) (DOC-2/DAB2 interactive protein)
[NAV2 HELAD1 KIAA1419 POMFIL2 RAINB1 STEERIN2] Neuron navigator 2 (EC 3.6.4.12) (Helicase APC down-regulated 1) (Pore membrane and/or filament-interacting-like protein 2) (Retinoic acid inducible in neuroblastoma 1) (Steerin-2) (Unc-53 homolog 2) (unc53H2)
[Dab2ip Kiaa1743] Disabled homolog 2-interacting protein (DAB2-interacting protein) (ASK-interacting protein 1) (DOC-2/DAB-2 interactive protein)
[PUF60 FIR ROBPI SIAHBP1] Poly(U)-binding-splicing factor PUF60 (60 kDa poly(U)-binding-splicing factor) (FUSE-binding protein-interacting repressor) (FBP-interacting repressor) (Ro-binding protein 1) (RoBP1) (Siah-binding protein 1) (Siah-BP1)
[Ubqln4 Cip75 Ubin] Ubiquilin-4 (Ataxin-1 interacting ubiquitin-like protein) (A1Up) (Ataxin-1 ubiquitin-like-interacting protein A1U) (Connexin43-interacting protein of 75 kDa) (CIP75)
[Becn1] Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]
[Hsp90b1 Grp94 Tra-1 Tra1] Endoplasmin (94 kDa glucose-regulated protein) (GRP-94) (Endoplasmic reticulum resident protein 99) (ERp99) (Heat shock protein 90 kDa beta member 1) (Polymorphic tumor rejection antigen 1) (Tumor rejection antigen gp96)
[Ncoa6 Aib3 Prip Rap250 Trbp] Nuclear receptor coactivator 6 (Activating signal cointegrator 2) (ASC-2) (Amplified in breast cancer protein 3) (Cancer-amplified transcriptional coactivator ASC-2) (Nuclear receptor coactivator RAP250) (NRC) (Nuclear receptor-activating protein, 250 kDa) (Peroxisome proliferator-activated receptor-interacting protein) (PPAR-interacting protein) (Thyroid hormone receptor-binding protein)
[HSP90AA1 HSP90A HSPC1 HSPCA] Heat shock protein HSP 90-alpha (EC 3.6.4.10) (Heat shock 86 kDa) (HSP 86) (HSP86) (Lipopolysaccharide-associated protein 2) (LAP-2) (LPS-associated protein 2) (Renal carcinoma antigen NY-REN-38)
[RIPK1 RIP RIP1] Receptor-interacting serine/threonine-protein kinase 1 (EC 2.7.11.1) (Cell death protein RIP) (Receptor-interacting protein 1) (RIP-1)
[OPTN FIP2 GLC1E HIP7 HYPL NRP] Optineurin (E3-14.7K-interacting protein) (FIP-2) (Huntingtin yeast partner L) (Huntingtin-interacting protein 7) (HIP-7) (Huntingtin-interacting protein L) (NEMO-related protein) (Optic neuropathy-inducing protein) (Transcription factor IIIA-interacting protein) (TFIIIA-IntP)
[BRIP1 BACH1 FANCJ] Fanconi anemia group J protein (Protein FACJ) (EC 3.6.4.13) (ATP-dependent RNA helicase BRIP1) (BRCA1-associated C-terminal helicase 1) (BRCA1-interacting protein C-terminal helicase 1) (BRCA1-interacting protein 1)
[RRAGA] Ras-related GTP-binding protein A (Rag A) (RagA) (EC 3.6.5.-) (Adenovirus E3 14.7 kDa-interacting protein 1) (FIP-1)
[RACK1 GNB2L1 HLC7 PIG21] Receptor of activated protein C kinase 1 (Cell proliferation-inducing gene 21 protein) (Guanine nucleotide-binding protein subunit beta-2-like 1) (Guanine nucleotide-binding protein subunit beta-like protein 12.3) (Human lung cancer oncogene 7 protein) (HLC-7) (Receptor for activated C kinase) (Small ribosomal subunit protein RACK1) [Cleaved into: Receptor of activated protein C kinase 1, N-terminally processed (Guanine nucleotide-binding protein subunit beta-2-like 1, N-terminally processed)]
[SH3KBP1 CIN85] SH3 domain-containing kinase-binding protein 1 (CD2-binding protein 3) (CD2BP3) (Cbl-interacting protein of 85 kDa) (Human Src family kinase-binding protein 1) (HSB-1)
[KAT5 HTATIP TIP60] Histone acetyltransferase KAT5 (EC 2.3.1.48) (60 kDa Tat-interactive protein) (Tip60) (Histone acetyltransferase HTATIP) (HIV-1 Tat interactive protein) (Lysine acetyltransferase 5) (cPLA(2)-interacting protein)
[MAPK14 CSBP CSBP1 CSBP2 CSPB1 MXI2 SAPK2A] Mitogen-activated protein kinase 14 (MAP kinase 14) (MAPK 14) (EC 2.7.11.24) (Cytokine suppressive anti-inflammatory drug-binding protein) (CSAID-binding protein) (CSBP) (MAP kinase MXI2) (MAX-interacting protein 2) (Mitogen-activated protein kinase p38 alpha) (MAP kinase p38 alpha) (Stress-activated protein kinase 2a) (SAPK2a)
[SART3 KIAA0156 TIP110] Squamous cell carcinoma antigen recognized by T-cells 3 (SART-3) (Tat-interacting protein of 110 kDa) (Tip110) (p110 nuclear RNA-binding protein)

Bibliography :