GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Homeodomain-only protein (Lung cancer-associated Y protein) (Not expressed in choriocarcinoma protein 1) (Odd homeobox protein 1)

 HOP_HUMAN               Reviewed;          73 AA.
Q9BPY8; A8K0Z2; E9PB55; G3V294; Q8N0V6; Q96CI1;
01-FEB-2005, integrated into UniProtKB/Swiss-Prot.
01-JUN-2001, sequence version 1.
13-FEB-2019, entry version 141.
RecName: Full=Homeodomain-only protein;
AltName: Full=Lung cancer-associated Y protein;
AltName: Full=Not expressed in choriocarcinoma protein 1;
AltName: Full=Odd homeobox protein 1;
Name=HOPX; Synonyms=HOD, HOP, LAGY, NECC1, OB1;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
TISSUE=Heart;
PubMed=14516659; DOI=10.1016/S0925-4773(03)00090-X;
Adu J., Leong F.T., Smith N.R., Leek J.P., Markham A.F.,
Robinson P.A., Mighell A.J.;
"Expression of mOb1, a novel atypical 73 amino acid K50-homeodomain
protein, during mouse development.";
Mech. Dev. 119:S43-S47(2002).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, AND
POSSIBLE INVOLVEMENT IN CHORIOCARCINOMA.
PubMed=12573257; DOI=10.1016/S0888-7543(02)00011-3;
Asanoma K., Matsuda T., Kondo H., Kato K., Kishino T., Niikawa N.,
Wake N., Kato H.;
"NECC1, a candidate choriocarcinoma suppressor gene that encodes a
homeodomain consensus motif.";
Genomics 81:15-25(2003).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, AND
POSSIBLE INVOLVEMENT IN LUNG CANCER.
PubMed=12759545; DOI=10.1159/000070306;
Chen Y., Petersen S., Pacyna-Gengelbach M., Pietas A., Petersen I.;
"Identification of a novel homeobox-containing gene, LAGY, which is
downregulated in lung cancer.";
Oncology 64:450-458(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15815621; DOI=10.1038/nature03466;
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H.,
Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M.,
Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E.,
Kremitzki C., Oddy L., Du H., Sun H., Bradshaw-Cordum H., Ali J.,
Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C.,
Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J.,
Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A.,
Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K.,
Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M.,
Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K.,
McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C.,
Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N.,
Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M.,
Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E.,
Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P.,
Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A.,
Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A.,
Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T.,
Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D.,
Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X.,
McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C.,
Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S.,
Miller W., Eichler E.E., Bork P., Suyama M., Torrents D.,
Waterston R.H., Wilson R.K.;
"Generation and annotation of the DNA sequences of human chromosomes 2
and 4.";
Nature 434:724-731(2005).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=B-cell;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[7]
INVOLVEMENT IN HEAD AND NECK SQUAMOUS CELL CARCINOMA.
PubMed=15213722; DOI=10.1038/sj.bjc.6601952;
Lemaire F., Millon R., Muller D., Rabouel Y., Bracco L., Abecassis J.,
Wasylyk B.;
"Loss of HOP tumour suppressor expression in head and neck squamous
cell carcinoma.";
Br. J. Cancer 91:258-261(2004).
[8]
INVOLVEMENT IN ORAL SQUAMOUS CELL CARCINOMA.
PubMed=15381369; DOI=10.1016/j.cancergencyto.2004.01.026;
Toruner G.A., Ulger C., Alkan M., Galante A.T., Rinaggio J., Wilk R.,
Tian B., Soteropoulos P., Hameed M.R., Schwalb M.N., Dermody J.J.;
"Association between gene expression profile and tumor invasion in
oral squamous cell carcinoma.";
Cancer Genet. Cytogenet. 154:27-35(2004).
[9]
FUNCTION, AND INTERACTION WITH HSPA1A; HSPA1B AND HSPA8.
PubMed=27708256; DOI=10.1038/ncomms12882;
Seo J.H., Park J.H., Lee E.J., Vo T.T., Choi H., Kim J.Y., Jang J.K.,
Wee H.J., Lee H.S., Jang S.H., Park Z.Y., Jeong J., Lee K.J.,
Seok S.H., Park J.Y., Lee B.J., Lee M.N., Oh G.T., Kim K.W.;
"ARD1-mediated Hsp70 acetylation balances stress-induced protein
refolding and degradation.";
Nat. Commun. 7:12882-12882(2016).
-!- FUNCTION: Atypical homeodomain protein which does not bind DNA and
is required to modulate cardiac growth and development. Acts via
its interaction with SRF, thereby modulating the expression of
SRF-dependent cardiac-specific genes and cardiac development.
Prevents SRF-dependent transcription either by inhibiting SRF
binding to DNA or by recruiting histone deacetylase (HDAC)
proteins that prevent transcription by SRF. Overexpression causes
cardiac hypertrophy (By similarity). May act as a tumor
suppressor. Acts as a co-chaperone for HSPA1A and HSPA1B chaperone
proteins and assists in chaperone-mediated protein refolding
(PubMed:27708256). {ECO:0000250|UniProtKB:Q8R1H0,
ECO:0000269|PubMed:27708256}.
-!- SUBUNIT: Interacts with serum response factor (SRF). Component of
a large complex containing histone deacetylases such as HDAC2 (By
similarity). Interacts with the acetylated forms of HSPA1A and
HSPA1B. Interacts with HSPA8 (PubMed:27708256).
{ECO:0000250|UniProtKB:Q8R1H0, ECO:0000269|PubMed:27708256}.
-!- INTERACTION:
Q99081:TCF12; NbExp=3; IntAct=EBI-10295883, EBI-722877;
-!- SUBCELLULAR LOCATION: Nucleus {ECO:0000250|UniProtKB:Q8R1H0}.
Cytoplasm {ECO:0000250|UniProtKB:Q8R1H0}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1; Synonyms=A;
IsoId=Q9BPY8-1; Sequence=Displayed;
Name=2; Synonyms=B;
IsoId=Q9BPY8-2; Sequence=VSP_012659;
Note=Ref.1 (AAM46830/AAM46831) sequences are in conflict in
position: 76:P->L. {ECO:0000305};
Name=3;
IsoId=Q9BPY8-3; Sequence=VSP_047290;
Note=Gene prediction based on EST data.;
Name=4;
IsoId=Q9BPY8-4; Sequence=VSP_047290, VSP_012659;
Note=Gene prediction based on EST data.;
-!- TISSUE SPECIFICITY: Widely expressed. Expressed in the heart,
brain, placenta, lung, skeletal and smooth muscles, uterus,
urinary bladder, kidney and spleen. Down-regulated in some types
of cancer such as lung cancer, choriocarcinoma, head and neck
squamous cell carcinoma and oral squamous cell carcinoma.
{ECO:0000269|PubMed:12573257, ECO:0000269|PubMed:12759545}.
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AF492675; AAM46827.1; -; mRNA.
EMBL; AF492676; AAM46828.1; -; mRNA.
EMBL; AF492677; AAM46829.1; -; mRNA.
EMBL; AF492678; AAM46830.1; -; mRNA.
EMBL; AF492679; AAM46831.1; -; mRNA.
EMBL; AF492680; AAM46832.1; -; mRNA.
EMBL; AF492681; AAM46833.1; -; mRNA.
EMBL; AB059408; BAB40926.1; -; mRNA.
EMBL; AB059409; BAB40927.1; -; mRNA.
EMBL; AB059410; BAB40928.1; -; mRNA.
EMBL; AF454763; AAL56613.1; -; mRNA.
EMBL; AK289707; BAF82396.1; -; mRNA.
EMBL; AC108215; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC014225; AAH14225.1; -; mRNA.
CCDS; CCDS3507.1; -. [Q9BPY8-1]
CCDS; CCDS47062.1; -. [Q9BPY8-3]
CCDS; CCDS54767.1; -. [Q9BPY8-4]
RefSeq; NP_001138931.1; NM_001145459.1. [Q9BPY8-1]
RefSeq; NP_001138932.1; NM_001145460.1. [Q9BPY8-4]
RefSeq; NP_115884.4; NM_032495.5. [Q9BPY8-3]
RefSeq; NP_631957.1; NM_139211.4. [Q9BPY8-1]
RefSeq; NP_631958.1; NM_139212.3. [Q9BPY8-1]
RefSeq; XP_016864218.1; XM_017008729.1.
RefSeq; XP_016864219.1; XM_017008730.1. [Q9BPY8-1]
RefSeq; XP_016864220.1; XM_017008731.1. [Q9BPY8-1]
RefSeq; XP_016864221.1; XM_017008732.1. [Q9BPY8-1]
RefSeq; XP_016864222.1; XM_017008733.1. [Q9BPY8-1]
RefSeq; XP_016864223.1; XM_017008734.1. [Q9BPY8-1]
UniGene; Hs.619396; -.
ProteinModelPortal; Q9BPY8; -.
SMR; Q9BPY8; -.
BioGrid; 124117; 11.
IntAct; Q9BPY8; 3.
MINT; Q9BPY8; -.
STRING; 9606.ENSP00000450527; -.
iPTMnet; Q9BPY8; -.
PhosphoSitePlus; Q9BPY8; -.
BioMuta; HOPX; -.
DMDM; 60392394; -.
jPOST; Q9BPY8; -.
PaxDb; Q9BPY8; -.
PeptideAtlas; Q9BPY8; -.
PRIDE; Q9BPY8; -.
ProteomicsDB; 78595; -.
ProteomicsDB; 78596; -. [Q9BPY8-2]
DNASU; 84525; -.
Ensembl; ENST00000317745; ENSP00000315198; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000337881; ENSP00000337330; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000381255; ENSP00000370654; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000381260; ENSP00000370659; ENSG00000171476. [Q9BPY8-2]
Ensembl; ENST00000420433; ENSP00000396275; ENSG00000171476. [Q9BPY8-3]
Ensembl; ENST00000503639; ENSP00000424101; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000508121; ENSP00000422175; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000553379; ENSP00000452340; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000554144; ENSP00000450527; ENSG00000171476. [Q9BPY8-4]
Ensembl; ENST00000555760; ENSP00000452098; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000556376; ENSP00000451794; ENSG00000171476. [Q9BPY8-1]
Ensembl; ENST00000556614; ENSP00000452003; ENSG00000171476. [Q9BPY8-1]
GeneID; 84525; -.
KEGG; hsa:84525; -.
UCSC; uc003hbz.3; human. [Q9BPY8-1]
CTD; 84525; -.
DisGeNET; 84525; -.
EuPathDB; HostDB:ENSG00000171476.21; -.
GeneCards; HOPX; -.
HGNC; HGNC:24961; HOPX.
HPA; CAB018632; -.
HPA; HPA030180; -.
MIM; 607275; gene.
neXtProt; NX_Q9BPY8; -.
OpenTargets; ENSG00000171476; -.
PharmGKB; PA162391564; -.
eggNOG; KOG0490; Eukaryota.
eggNOG; ENOG410YIJ3; LUCA.
GeneTree; ENSGT00390000017143; -.
HOGENOM; HOG000112932; -.
HOVERGEN; HBG051921; -.
InParanoid; Q9BPY8; -.
OMA; KVSKHPD; -.
OrthoDB; 1567787at2759; -.
PhylomeDB; Q9BPY8; -.
SIGNOR; Q9BPY8; -.
ChiTaRS; HOPX; human.
GeneWiki; HOPX; -.
GenomeRNAi; 84525; -.
PRO; PR:Q9BPY8; -.
Proteomes; UP000005640; Chromosome 4.
Bgee; ENSG00000171476; Expressed in 225 organ(s), highest expression level in caput epididymis.
Genevisible; Q9BPY8; HS.
GO; GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell.
GO; GO:0005634; C:nucleus; IDA:MGI.
GO; GO:0003677; F:DNA binding; IEA:UniProtKB-KW.
GO; GO:0000981; F:DNA-binding transcription factor activity, RNA polymerase II-specific; ISA:NTNU_SB.
GO; GO:0051131; P:chaperone-mediated protein complex assembly; IDA:CAFA.
GO; GO:0045596; P:negative regulation of cell differentiation; IDA:MGI.
GO; GO:0001829; P:trophectodermal cell differentiation; IDA:MGI.
CDD; cd00086; homeodomain; 1.
InterPro; IPR009057; Homeobox-like_sf.
InterPro; IPR001356; Homeobox_dom.
InterPro; IPR039162; HOPX.
PANTHER; PTHR21408; PTHR21408; 1.
Pfam; PF00046; Homeodomain; 1.
SMART; SM00389; HOX; 1.
SUPFAM; SSF46689; SSF46689; 1.
PROSITE; PS50071; HOMEOBOX_2; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Cytoplasm;
Developmental protein; Homeobox; Nucleus; Proto-oncogene;
Reference proteome; Repressor; Transcription;
Transcription regulation.
CHAIN 1 73 Homeodomain-only protein.
/FTId=PRO_0000049129.
DNA_BIND 3 62 Homeobox; atypical. {ECO:0000255|PROSITE-
ProRule:PRU00108}.
VAR_SEQ 1 1 M -> MLIFLGCYRRRLEERAGTM (in isoform 3
and isoform 4). {ECO:0000305}.
/FTId=VSP_047290.
VAR_SEQ 49 73 KWFKQRLAKWRRSEGLPSECRSVTD -> GSDLISRSKIWH
PESSPQREGYPHDSLPCLAFDYFSLLPPQCKEMV (in
isoform 2 and isoform 4).
{ECO:0000303|PubMed:14516659}.
/FTId=VSP_012659.
CONFLICT 72 72 T -> I (in Ref. 6; AAH14225).
{ECO:0000305}.
SEQUENCE 73 AA; 8260 MW; CE65E4D2A8972022 CRC64;
MSAETASGPT EDQVEILEYN FNKVDKHPDS TTLCLIAAEA GLSEEETQKW FKQRLAKWRR
SEGLPSECRS VTD


Related products :

Catalog number Product name Quantity
EIAAB31191 Bft,Hindlimb-expressed homeobox protein backfoot,Homeobox protein PITX1,Homeobox protein P-OTX,Mouse,Mus musculus,Paired-like homeodomain transcription factor 1,Pituitary homeobox 1,Pituitary OTX-rela
EIAAB31193 BFT,Hindlimb-expressed homeobox protein backfoot,Homeobox protein PITX1,Homo sapiens,Human,Paired-like homeodomain transcription factor 1,Pituitary homeobox 1,PITX1,PTX1
EIAAB27447 Homeobox protein NOBOX,Homeodomain-containing protein OG-2,Mouse,Mus musculus,Newborn ovary homeobox protein,Nobox,Og2x,Oocyte-specific homeobox protein
EIAAB24840 hMix,Homeobox protein MIXL1,Homeodomain protein MIX,Homo sapiens,Human,Mix.1 homeobox-like protein,MIX1 homeobox-like protein 1,MIXL,MIXL1
EIAAB30960 Aristaless homeobox protein homolog,ARIX,ARIX1 homeodomain protein,Homo sapiens,Human,Paired mesoderm homeobox protein 2A,Paired-like homeobox 2A,PHOX2A,PMX2A
EIAAB30959 Aristaless homeobox protein homolog,Arix,ARIX1 homeodomain protein,Paired mesoderm homeobox protein 2A,Paired-like homeobox 2A,Phox2a,Pmx2a,Rat,Rattus norvegicus
EIAAB24841 Homeobox protein MIXL1,Homeodomain protein MIX,Mix,Mix.1 homeobox-like protein,MIX1 homeobox-like protein 1,Mixl1,mMix,Mml,Mouse,Mus musculus
18-003-42195 Homeobox protein SIX6 - Sine oculis homeobox homolog 6; Optic homeobox 2; Homeodomain protein OPTX2 Polyclonal 0.05 mg Aff Pur
EIAAB30961 Aristaless homeobox protein homolog,Arix,Mouse,Mus musculus,Paired mesoderm homeobox protein 2A,Paired-like homeobox 2A,Phox2,Phox2a,PHOX2A homeodomain protein,Pmx2,Pmx2a
18-003-43781 Iroquois-class homeodomain protein IRX-4 - Iroquois homeobox protein 4; Homeodomain protein IRXA3 Polyclonal 0.1 mg Protein A
18-003-42398 Iroquois-class homeodomain protein IRX-1 - Iroquois homeobox protein 1; Homeodomain protein IRXA1 Polyclonal 0.1 mg Protein A
18-003-43944 Iroquois-class homeodomain protein IRX-3 - Iroquois homeobox protein 3; Homeodomain protein IRXB1 Polyclonal 0.1 mg Protein A
18-003-43786 Mix1 homeobox-like protein 1 - Mix.1 homeobox-like protein; Homeodomain protein MIX Polyclonal 0.05 mg Aff Pur
18-003-43167 Diencephalon_mesencephalon homeobox protein 1 - Diencephalon_mesencephalon-expressed brain homeobox gene 1 protein; Paired-like homeobox protein DMBX1; Paired-type homeobox Atx; Orthodenticle homolog 0.05 mg Aff Pur
EIAAB38314 Homeobox protein Og12X,Mouse,Mus musculus,OG-12,Og12x,Paired family homeodomain protein Prx3,Prx3,Short stature homeobox protein 2,Shox2
20-372-60079 iroquois homeobox protein 3 - Mouse monoclonal anti-human IRX3 antibody; Iroquois homeobox protein 3; Homeodomain protein IRXB1 Monoclonal 0.1 mg
EIAAB38535 Homeobox protein SIX6,Homeodomain protein OPTX2,Homo sapiens,Human,Optic homeobox 2,OPTX2,Sine oculis homeobox homolog 6,SIX6,SIX9
EIAAB38534 DM locus-associated homeodomain protein,DMAHP,Homeobox protein SIX5,Homo sapiens,Human,Sine oculis homeobox homolog 5,SIX5
EIAAB45354 Homeobox protein unc-4 homolog,Homeobox protein Uncx4.1,Paired-type homeodomain transcription factor 1,Phd1,Rat,Rattus norvegicus,Uncx,Uncx4.1
EIAAB47173 Kiaa0395,Mouse,Mus musculus,Tix1,Triple homeobox protein 1,Zhx3,Zinc finger and homeodomain protein 3,Zinc fingers and homeoboxes protein 3
EIAAB47171 Homo sapiens,Human,KIAA0395,TIX1,Triple homeobox protein 1,ZHX3,Zinc finger and homeodomain protein 3,Zinc fingers and homeoboxes protein 3
EIAAB11459 Cdmx,Diencephalon_mesencephalon homeobox protein 1,Diencephalon_mesencephalon-expressed brain homeobox gene 1 protein,Dmbx1,Mbx,Mouse,Mus musculus,Orthodenticle homolog 3,Otx3,Paired-like homeobox pro
EIAAB11376 Deleted in lung and esophageal cancer protein 1,Deleted in lung cancer protein 1,DLC1,DLC-1,DLEC1,Homo sapiens,Human
20-372-60100 iroquois homeobox protein 5 (IRX5) - Mouse monoclonal anti-human IRX5 antibody; Iroquois homeobox protein 5; Homeodomain protein IRXB2; IRX-2A Monoclonal 0.1 mg
EIAAB31197 ALL1-responsive protein ARP1,ARP1,Homeobox protein PITX2,Homo sapiens,Human,Paired-like homeodomain transcription factor 2,Pituitary homeobox 2,PITX2,RGS,RIEG,RIEG bicoid-related homeobox transcriptio

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :