GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Indole-3-acetic acid-amido synthetase GH3.2 (EC 6.3.2.-) (Auxin-responsive GH3-like protein 2) (AtGH3-2) (Protein YADOKARI 1)

 GH32_ARATH              Reviewed;         549 AA.
Q9SZT9; F4JS15; Q93Z39; Q9SLU3;
26-APR-2005, integrated into UniProtKB/Swiss-Prot.
22-FEB-2012, sequence version 3.
13-FEB-2019, entry version 103.
RecName: Full=Indole-3-acetic acid-amido synthetase GH3.2;
EC=6.3.2.-;
AltName: Full=Auxin-responsive GH3-like protein 2;
Short=AtGH3-2;
AltName: Full=Protein YADOKARI 1;
Name=GH3.2; Synonyms=BRU6, CF4, YDK1; OrderedLocusNames=At4g37390;
ORFNames=F6G17.40;
Arabidopsis thaliana (Mouse-ear cress).
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae;
Arabidopsis.
NCBI_TaxID=3702;
[1]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
STRAIN=cv. Columbia;
PubMed=10617198; DOI=10.1038/47134;
Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G.,
Pohl T., Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N.,
Harris B., Ansorge W., Brandt P., Grivell L.A., Rieger M.,
Weichselgartner M., de Simone V., Obermaier B., Mache R., Mueller M.,
Kreis M., Delseny M., Puigdomenech P., Watson M., Schmidtheini T.,
Reichert B., Portetelle D., Perez-Alonso M., Boutry M., Bancroft I.,
Vos P., Hoheisel J., Zimmermann W., Wedler H., Ridley P.,
Langham S.-A., McCullagh B., Bilham L., Robben J.,
van der Schueren J., Grymonprez B., Chuang Y.-J., Vandenbussche F.,
Braeken M., Weltjens I., Voet M., Bastiaens I., Aert R., Defoor E.,
Weitzenegger T., Bothe G., Ramsperger U., Hilbert H., Braun M.,
Holzer E., Brandt A., Peters S., van Staveren M., Dirkse W.,
Mooijman P., Klein Lankhorst R., Rose M., Hauf J., Koetter P.,
Berneiser S., Hempel S., Feldpausch M., Lamberth S., Van den Daele H.,
De Keyser A., Buysshaert C., Gielen J., Villarroel R., De Clercq R.,
van Montagu M., Rogers J., Cronin A., Quail M.A., Bray-Allen S.,
Clark L., Doggett J., Hall S., Kay M., Lennard N., McLay K., Mayes R.,
Pettett A., Rajandream M.A., Lyne M., Benes V., Rechmann S.,
Borkova D., Bloecker H., Scharfe M., Grimm M., Loehnert T.-H.,
Dose S., de Haan M., Maarse A.C., Schaefer M., Mueller-Auer S.,
Gabel C., Fuchs M., Fartmann B., Granderath K., Dauner D., Herzl A.,
Neumann S., Argiriou A., Vitale D., Liguori R., Piravandi E.,
Massenet O., Quigley F., Clabauld G., Muendlein A., Felber R.,
Schnabl S., Hiller R., Schmidt W., Lecharny A., Aubourg S.,
Chefdor F., Cooke R., Berger C., Monfort A., Casacuberta E.,
Gibbons T., Weber N., Vandenbol M., Bargues M., Terol J., Torres A.,
Perez-Perez A., Purnelle B., Bent E., Johnson S., Tacon D., Jesse T.,
Heijnen L., Schwarz S., Scholler P., Heber S., Francs P., Bielke C.,
Frishman D., Haase D., Lemcke K., Mewes H.-W., Stocker S.,
Zaccaria P., Bevan M., Wilson R.K., de la Bastide M., Habermann K.,
Parnell L., Dedhia N., Gnoj L., Schutz K., Huang E., Spiegel L.,
Sekhon M., Murray J., Sheet P., Cordes M., Abu-Threideh J.,
Stoneking T., Kalicki J., Graves T., Harmon G., Edwards J.,
Latreille P., Courtney L., Cloud J., Abbott A., Scott K., Johnson D.,
Minx P., Bentley D., Fulton B., Miller N., Greco T., Kemp K.,
Kramer J., Fulton L., Mardis E., Dante M., Pepin K., Hillier L.W.,
Nelson J., Spieth J., Ryan E., Andrews S., Geisel C., Layman D.,
Du H., Ali J., Berghoff A., Jones K., Drone K., Cotton M., Joshu C.,
Antonoiu B., Zidanic M., Strong C., Sun H., Lamar B., Yordan C.,
Ma P., Zhong J., Preston R., Vil D., Shekher M., Matero A., Shah R.,
Swaby I.K., O'Shaughnessy A., Rodriguez M., Hoffman J., Till S.,
Granat S., Shohdy N., Hasegawa A., Hameed A., Lodhi M., Johnson A.,
Chen E., Marra M.A., Martienssen R., McCombie W.R.;
"Sequence and analysis of chromosome 4 of the plant Arabidopsis
thaliana.";
Nature 402:769-777(1999).
[2]
GENOME REANNOTATION.
STRAIN=cv. Columbia;
PubMed=27862469; DOI=10.1111/tpj.13415;
Cheng C.Y., Krishnakumar V., Chan A.P., Thibaud-Nissen F., Schobel S.,
Town C.D.;
"Araport11: a complete reannotation of the Arabidopsis thaliana
reference genome.";
Plant J. 89:789-804(2017).
[3]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
STRAIN=cv. Columbia;
PubMed=14593172; DOI=10.1126/science.1088305;
Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J.,
Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F.,
Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.,
Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J.,
Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y.,
Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P.,
Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F.,
Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M.,
Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J.,
Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T.,
Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y.,
Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
"Empirical analysis of transcriptional activity in the Arabidopsis
genome.";
Science 302:842-846(2003).
[4]
NUCLEOTIDE SEQUENCE [MRNA] OF 281-549 (ISOFORM 1).
PubMed=10548732; DOI=10.1016/S0378-1119(99)00403-5;
Kato A., Suzuki M., Kuwahara A., Ooe H., Higano-Inaba K., Komeda Y.;
"Isolation and analysis of cDNA within a 300 kb Arabidopsis thaliana
genomic region located around the 100 map unit of chromosome 1.";
Gene 239:309-316(1999).
[5]
FUNCTION, TISSUE SPECIFICITY, AND INDUCTION.
PubMed=14756757; DOI=10.1046/j.1365-313X.2003.01973.x;
Takase T., Nakazawa M., Ishikawa A., Kawashima M., Ichikawa T.,
Takahashi N., Shimada H., Manabe K., Matsui M.;
"ydk1-D, an auxin-responsive GH3 mutant that is involved in hypocotyl
and root elongation.";
Plant J. 37:471-483(2004).
[6]
FUNCTION, CHARACTERIZATION, AND INDUCTION.
PubMed=15659623; DOI=10.1105/tpc.104.026690;
Staswick P.E., Serban B., Rowe M., Tiryaki I., Maldonado M.T.,
Maldonado M.C., Suza W.;
"Characterization of an Arabidopsis enzyme family that conjugates
amino acids to indole-3-acetic acid.";
Plant Cell 17:616-627(2005).
[7]
NOMENCLATURE.
PubMed=12036261; DOI=10.1023/A:1015207114117;
Hagen G., Guilfoyle T.J.;
"Auxin-responsive gene expression: genes, promoters and regulatory
factors.";
Plant Mol. Biol. 49:373-385(2002).
-!- FUNCTION: Catalyzes the synthesis of indole-3-acetic acid (IAA)-
amino acid conjugates, providing a mechanism for the plant to cope
with the presence of excess auxin. Strongly reactive with Glu,
Gln, Trp, Asp, Ala, Leu, Phe, Gly, Tyr, Met, Ile and Val. Little
or no product formation with His, Ser, Thr, Arg, Lys, or Cys. Also
active on pyruvic and butyric acid analogs of IAA, PAA and the
synthetic auxin naphthaleneacetic acid (NAA). The two chlorinated
synthetic auxin herbicides 2,4-D and 3,6-dichloro-o-anisic acid
(dicamba) cannot be used as substrates.
{ECO:0000269|PubMed:14756757, ECO:0000269|PubMed:15659623}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=Q9SZT9-1; Sequence=Displayed;
Name=2;
IsoId=Q9SZT9-2; Sequence=VSP_042266;
Note=Constructed according to the conserved gene model. Derived
from EST data. No experimental confirmation available.;
-!- TISSUE SPECIFICITY: Expressed in flowers, pollen, cotyledons,
stipules, true leaves, hypocotyls, and all parts of the roots
except for the primary root tips. {ECO:0000269|PubMed:14756757}.
-!- INDUCTION: By auxin. Down-regulated by blue and far red lights.
{ECO:0000269|PubMed:14756757, ECO:0000269|PubMed:15659623}.
-!- SIMILARITY: Belongs to the IAA-amido conjugating enzyme family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAA87950.1; Type=Frameshift; Positions=540; Evidence={ECO:0000305};
Sequence=CAB38206.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
Sequence=CAB80404.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AL035601; CAB38206.1; ALT_SEQ; Genomic_DNA.
EMBL; AL161591; CAB80404.1; ALT_SEQ; Genomic_DNA.
EMBL; CP002687; AEE86787.1; -; Genomic_DNA.
EMBL; AY058161; AAL25575.1; -; mRNA.
EMBL; AB028224; BAA87950.1; ALT_FRAME; mRNA.
PIR; T04733; T04733.
PIR; T52435; T52435.
RefSeq; NP_195455.1; NM_119902.4. [Q9SZT9-2]
UniGene; At.23361; -.
ProteinModelPortal; Q9SZT9; -.
SMR; Q9SZT9; -.
STRING; 3702.AT4G37390.1; -.
PaxDb; Q9SZT9; -.
PRIDE; Q9SZT9; -.
EnsemblPlants; AT4G37390.1; AT4G37390.1; AT4G37390. [Q9SZT9-2]
GeneID; 829893; -.
Gramene; AT4G37390.1; AT4G37390.1; AT4G37390. [Q9SZT9-2]
KEGG; ath:AT4G37390; -.
Araport; AT4G37390; -.
TAIR; locus:2126362; AT4G37390.
eggNOG; ENOG410IJ43; Eukaryota.
eggNOG; ENOG410XQH0; LUCA.
HOGENOM; HOG000238302; -.
InParanoid; Q9SZT9; -.
KO; K14487; -.
OMA; LEMAGCW; -.
OrthoDB; 374623at2759; -.
BioCyc; ARA:AT4G37390-MONOMER; -.
PRO; PR:Q9SZT9; -.
Proteomes; UP000006548; Chromosome 4.
Genevisible; Q9SZT9; AT.
GO; GO:0010279; F:indole-3-acetic acid amido synthetase activity; IDA:TAIR.
GO; GO:0010252; P:auxin homeostasis; TAS:TAIR.
GO; GO:0009733; P:response to auxin; IMP:TAIR.
InterPro; IPR004993; GH3.
PANTHER; PTHR31901; PTHR31901; 1.
Pfam; PF03321; GH3; 1.
1: Evidence at protein level;
Alternative splicing; Complete proteome; Ligase; Reference proteome.
CHAIN 1 549 Indole-3-acetic acid-amido synthetase
GH3.2.
/FTId=PRO_0000203571.
VAR_SEQ 540 549 GDTCGTERYV -> EIRVVRNGTFEELMDYAISRGASINQY
KVPRCVSFTPIMELLDSRVVSAHFSPSLPHWSPERRR (in
isoform 2). {ECO:0000305}.
/FTId=VSP_042266.
CONFLICT 422 422 L -> F (in Ref. 4; BAA87950).
{ECO:0000305}.
CONFLICT 474 474 V -> G (in Ref. 3; AAL25575).
{ECO:0000305}.
SEQUENCE 549 AA; 61827 MW; D2C807C4FD5145D4 CRC64;
MAVDSPLQSR MVSATTSEKD VKALKFIEEM TRNPDSVQEK VLGEILTRNS NTEYLKRFDL
DGVVDRKTFK SKVPVVTYED LKPEIQRISN GDCSPILSSH PITEFLTSSG TSAGERKLMP
TIEEDLDRRQ LLYSLLMPVM NLYVPGLDKG KGLYFLFVKS ESKTSGGLPA RPVLTSYYKS
DHFKRRPYDP YNVYTSPNEA ILCSDSSQSM YAQMLCGLLM RHEVLRLGAV FASGLLRAIS
FLQNNWKELA RDISTGTLSS RIFDPAIKNR MSKILTKPDQ ELAEFLVGVC SQENWEGIIT
KIWPNTKYLD VIVTGAMAQY IPTLEYYSGG LPMACTMYAS SESYFGINLK PMCKPSEVSY
TIMPNMAYFE FLPHNHDGDG AAEASLDETS LVELANVEVG KEYELVITTY AGLYRYRVGD
ILRVTGFHNS APQFKFIRRK NVLLSVESDK TDEAELQKAV ENASRLFAEQ GTRVIEYTSY
AETKTIPGHY VIYWELLGRD QSNALMSEEV MAKCCLEMEE SLNSVYRQSR VADKSIGPLG
DTCGTERYV


Related products :

Catalog number Product name Quantity
AS09 420 Antibody: IAA | indole-3-acetic acid (C1') (1mg), Immunogen: BSA-conjugated, via C1 carboxyl group, indole-3-acetic acid (C1'), Host: rabbit, polyclonal, Confirmed reactivity: IAA | indole-3-acetic ac 1 mg
AS09 441 Antibody: IAA | indole-3-acetic acid (C1') (5mg), Immunogen: BSA-conjugated, via C1 carboxyl group, indole-3-acetic acid (C1'), Host: rabbit, polyclonal, Confirmed reactivity: IAA | indole-3-acetic ac 5 mg
AS09 421 Antibody: IAA | indole-3-acetic acid (N1) (for immunolocalization), Immunogen: BSA-conjugated, via C1 carobxyl group, indole-3-acetic acid (N1), Host: rabbit, polyclonal, Confirmed reactivity: indole- 200
AS09 445 Antibody: IAA | indole-3-acetic acid (C1') (for immunolocalization), Immunogen: BSA- conjugated, via C1 carboxyl group, indole-3-acetic acid (C1'), Host: rabbit, polyclonal, Confirmed reactivity: indo 200
AS06 193 Antibody: IAA | indole 3 acetic acid, Immunogen: BSA-conjugated synthetic indole 3 acetic acid, Host: rabbit, polyclonal, Confirmed reactivity: Arabidoppsis thaliana, Euphorbia pulcherrima, Medicago s 100
AS06 193 Indole 3 acetic acid (IAA) 0.1 ml
CI003 Indole-3-acetic acid 5x25g
IB0723 3-Indole acetic acid (IAA) 100g
AS06 193 IAA | indole 3 acetic acid 100 ul
I885-5G INDOLE-3 - ACETIC ACID
AS06193 IAA | indole 3 acetic acid 100 ul
AS06 193 Indole 3 acetic acid (IAA) 0.1 ml
IB0723 3-Indole acetic acid (IAA) 25g
CI002 Indole-3-acetic acid 5x5g
CP052-025 Indole-3-acetic Acid (IAA) 25g x 5
30631010-2 Indole-3-acetic acid (IAA) 10 g
I014-5g Indole-3-acetic acid 5 g
M12865413 Indole-3-acetic acid CAS: [87-51-4] 100 g
30631010-3 Indole-3-acetic acid (IAA) 25 g
30631010-4 Indole-3-acetic acid (IAA) 100 g
CP052-100 Indole-3-acetic Acid (IAA) 100g
CP052-025 Indole-3-acetic Acid (IAA) 25g
30631010-1 Indole-3-acetic acid (IAA) 5 g
I885-25G INDOLE-3 - ACETIC ACID
I014-25g Indole-3-acetic acid 25 g

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP1654: gamma-Hexachlorocyclohexane degradation
WP1700: Selenoamino acid metabolism
WP2199: Seed Development
WP1049: G Protein Signaling Pathways
WP1165: G Protein Signaling Pathways
WP1371: G Protein Signaling Pathways
WP1438: Influenza A virus infection
WP1493: Carbon assimilation C4 pathway
WP1502: Mitochondrial biogenesis
WP1531: Vitamin D synthesis
WP1566: Citrate cycle (TCA cycle)
WP1577: amino acid conjugation of benzoic acid
WP1613: 1,4-Dichlorobenzene degradation
WP1616: ABC transporters
WP1624: Bacterial secretion system
WP1625: Base excision repair
WP1644: DNA replication
WP1650: Fluorobenzoate degradation
WP1657: Glycerolipid metabolism
WP1659: Glycine, serine and threonine metabolism
WP1661: Glyoxylate and dicarboxylate metabolism
WP1663: Homologous recombination
WP1665: Limonene and pinene degradation
WP1672: Mismatch repair
WP1673: Naphthalene and anthracene degradation

Related Genes :
[GH3.12 GDG1 PBS3 WIN3 At5g13320 T22N19.5 T31B5.140] 4-substituted benzoates-glutamate ligase GH3.12 (EC 6.3.2.-) (Auxin-responsive GH3-like protein 12) (AtGH3-12) (Protein GH3-LIKE DEFENSE GENE 1) (Protein GRETCHEN HAGEN 3.12) (Protein HOPW1-1-INTERACTING 3) (Protein avrPPHB SUSCEPTIBLE 3)
[GH3.6 DFL1 At5g54510 F24B18.13] Indole-3-acetic acid-amido synthetase GH3.6 (EC 6.3.2.-) (Auxin-responsive GH3-like protein 6) (AtGH3-6) (Protein DWARF IN LIGHT 1) (DFL-1)
[GH3.2 BRU6 CF4 YDK1 At4g37390 F6G17.40] Indole-3-acetic acid-amido synthetase GH3.2 (EC 6.3.2.-) (Auxin-responsive GH3-like protein 2) (AtGH3-2) (Protein YADOKARI 1)
[GH3.17 At1g28130 F13K9.22 F3H9.21 F3H9_19] Indole-3-acetic acid-amido synthetase GH3.17 (EC 6.3.2.-) (Auxin-responsive GH3-like protein 17) (AtGH3-17)
[GH3.5 At4g27260 M4I22.70] Indole-3-acetic acid-amido synthetase GH3.5 (EC 6.3.2.-) (Auxin-responsive GH3-like protein 5) (AtGH3-5)
[GH3.4 At1g59500 T30E16.2 T4M14.15] Indole-3-acetic acid-amido synthetase GH3.4 (EC 6.3.2.-) (Auxin-responsive GH3-like protein 4) (AtGH3-4) (CF4-like protein)
[GH3.3 At2g23170 T20D16.20] Indole-3-acetic acid-amido synthetase GH3.3 (EC 6.3.2.-) (Auxin-responsive GH3-like protein 3) (AtGH3-3)
[JAR1 FIN219 At2g46370 F11C10.6] Jasmonoyl--L-amino acid synthetase JAR1 (EC 6.3.2.52) (Jasmonate-amino acid synthetase JAR1) (Jasmonic acid-amido synthetase JAR1) (Protein FAR-RED INSENSITIVE 219) (Protein JASMONATE RESISTANT 1)
[] Genome polyprotein [Cleaved into: Capsid protein C (Capsid protein) (Core protein); Protein prM (Precursor membrane protein); Peptide pr (Peptide precursor); Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)]
[hchA A8C65_13880 A9R57_25255 AKG99_20940 AMK83_16550 B7C53_22525 B9M99_11580 B9T59_01945 BJJ90_15205 BMT49_12710 BMT53_00170 BUE81_10670 BW690_17225 BZL69_29425 C2U48_24800 C5715_19445 C5N07_21380 C6669_19295 C7B06_02290 C7B07_03930 CDL37_00765 CG691_19145 CG705_13560 CG706_14580 CIJ94_05515 COD46_23180 CRD98_26150 D3I61_11545 DL800_09215 DNQ41_14245 DQE83_22775 DTL43_21780 DTL84_23375 DTM25_06080 EC95NR1_00961 ERS085379_01273 ERS085386_05041 HMPREF3040_01583 HW43_13705 NCTC10082_04431 NCTC10418_03071 NCTC10767_03558 NCTC11022_01867 NCTC11126_04427 NCTC11181_05650 NCTC12950_02263 NCTC13462_05714 NCTC8985_00529 NCTC9111_05933 NCTC9703_00277 PU06_24500 SAMEA3472055_03589 SAMEA3472056_01268 SAMEA3472070_00654 SAMEA3472080_04213 SAMEA3472090_03376 SAMEA3472110_00060 SAMEA3472112_00448 SAMEA3752372_00752 SAMEA3753106_00003 SAMEA3753391_00513 UN91_23615 WQ89_10695] Protein/nucleic acid deglycase HchA (EC 3.1.2.-) (EC 3.5.1.-) (EC 3.5.1.124) (Maillard deglycase)
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[] Genome polyprotein [Cleaved into: P3; Protein 3AB; P2; P1; Capsid protein VP0 (VP4-VP2); Capsid protein VP4 (P1A) (Virion protein 4); Capsid protein VP2 (P1B) (Virion protein 2); Capsid protein VP3 (P1C) (Virion protein 3); Capsid protein VP1 (P1D) (Virion protein 1); Protease 2A (P2A) (EC 3.4.22.29) (Picornain 2A) (Protein 2A); Protein 2B (P2B); Protein 2C (P2C) (EC 3.6.1.15); Protein 3A (P3A); Viral protein genome-linked (VPg) (Protein 3B) (P3B); Protein 3CD (EC 3.4.22.28); Protease 3C (P3C); RNA-directed RNA polymerase (RdRp) (EC 2.7.7.48) (3D polymerase) (3Dpol) (Protein 3D) (3D)]
[1a] Replicase polyprotein 1a (pp1a) (ORF1a polyprotein) [Cleaved into: Non-structural protein 1 (nsp1) (Leader protein); Non-structural protein 2 (nsp2) (p65 homolog); Non-structural protein 3 (nsp3) (EC 3.4.19.12) (EC 3.4.22.69) (PL2-PRO) (Papain-like proteinase) (PL-PRO) (SARS coronavirus main proteinase); Non-structural protein 4 (nsp4); 3C-like proteinase (3CL-PRO) (3CLp) (EC 3.4.22.-) (nsp5); Non-structural protein 6 (nsp6); Non-structural protein 7 (nsp7); Non-structural protein 8 (nsp8); Non-structural protein 9 (nsp9); Non-structural protein 10 (nsp10) (Growth factor-like peptide) (GFL); Non-structural protein 11 (nsp11)]
[AHK4 CRE1 RAW1 WOL At2g01830 T23K3.2] Histidine kinase 4 (EC 2.7.13.3) (Arabidopsis histidine kinase 4) (AtHK4) (Cytokinin receptor CYTOKININ RESPONSE 1) (AtCRE1) (Cytokinin receptor CRE1) (Phosphoprotein phosphatase AHK4) (EC 3.1.3.16) (Protein AUTHENTIC HIS-KINASE 4) (Protein ROOT AS IN WOL 1) (Protein WOODEN LEG)
[] Genome polyprotein [Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)]
[] Genome polyprotein [Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Non-structural protein 2A-alpha (NS2A-alpha); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)]
[Acvr1b Acvrlk4 Alk4] Activin receptor type-1B (EC 2.7.11.30) (Activin receptor type IB) (ACTR-IB) (Activin receptor-like kinase 4) (ALK-4) (Serine/threonine-protein kinase receptor R2) (SKR2)
[] Genome polyprotein [Cleaved into: Protein VP0 (VP4-VP2); Protein VP4 (P1A) (Virion protein 4); Capsid protein VP2 (P1B) (Virion protein 2); Capsid protein VP3 (P1C) (Virion protein 3); Protein VP1-2A (VPX); Capsid protein VP1 (P1D) (Virion protein 1); Assembly signal 2A (pX); Protein 2BC; Protein 2B (P2B); Protein 2C (P2C) (EC 3.6.1.15); Protein 3ABCD (P3); Protein 3ABC; Protein 3AB; Protein 3A (P3A); Viral protein genome-linked (VPg) (Protein 3B) (P3B); Protein 3CD; Protease 3C (P3C) (EC 3.4.22.28) (Picornain 3C); RNA-directed RNA polymerase 3D-POL (P3D-POL) (EC 2.7.7.48)]
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.47) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[] Genome polyprotein [Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)]
[Kcnh6 Erg2] Potassium voltage-gated channel subfamily H member 6 (Ether-a-go-go-related gene potassium channel 2) (ERG-2) (Eag-related protein 2) (Ether-a-go-go-related protein 2) (Voltage-gated potassium channel subunit Kv11.2)
[] Genome polyprotein [Cleaved into: Core protein p21 (Capsid protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (p23) (EC 3.4.22.-); Serine protease NS3 (EC 3.4.21.98) (EC 3.6.1.15) (EC 3.6.4.13) (Hepacivirin) (NS3P) (p70); Non-structural protein 4A (NS4A) (p8); Non-structural protein 4B (NS4B) (p27); Non-structural protein 5A (NS5A) (p56); RNA-directed RNA polymerase (EC 2.7.7.48) (NS5B) (p68)]
[] Genome polyprotein [Cleaved into: P3; Protein 3AB; P2; P1; Capsid protein VP0 (VP4-VP2); Capsid protein VP4 (P1A) (Virion protein 4); Capsid protein VP2 (P1B) (Virion protein 2); Capsid protein VP3 (P1C) (Virion protein 3); Capsid protein VP1 (P1D) (Virion protein 1); Protease 2A (P2A) (EC 3.4.22.29) (Picornain 2A) (Protein 2A); Protein 2B (P2B); Protein 2C (P2C) (EC 3.6.1.15); Protein 3A (P3A); Viral protein genome-linked (VPg) (Protein 3B) (P3B); Protein 3CD (EC 3.4.22.28); Protease 3C (P3C) (EC 3.4.22.28); RNA-directed RNA polymerase (RdRp) (EC 2.7.7.48) (3D polymerase) (3Dpol) (Protein 3D) (3D)]
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.16) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[] Genome polyprotein [Cleaved into: Capsid protein C (Core protein); Protein prM; Peptide pr; Small envelope protein M (Matrix protein); Envelope protein E; Non-structural protein 1 (NS1); Non-structural protein 2A (NS2A); Serine protease subunit NS2B (Flavivirin protease NS2B regulatory subunit) (Non-structural protein 2B); Serine protease NS3 (EC 3.4.21.91) (EC 3.6.1.15) (EC 3.6.4.13) (Flavivirin protease NS3 catalytic subunit) (Non-structural protein 3); Non-structural protein 4A (NS4A); Peptide 2k; Non-structural protein 4B (NS4B); RNA-directed RNA polymerase NS5 (EC 2.1.1.56) (EC 2.1.1.57) (EC 2.7.7.48) (Non-structural protein 5)]
[hchA A9819_11910 ACN81_03425 AML35_08765 AW059_23935 BHF46_18455 BMT91_24760 C4J69_22715 C7B08_25495 CR538_10415 D2F89_25795 EC3234A_36c00010 NCTC8500_02249 NCTC9010_02117 NCTC9037_02122 NCTC9117_02637 NCTC9969_02156 SAMEA3472108_01151 SAMEA3484427_04795 SAMEA3484429_02051 SAMEA3752557_05476 SAMEA3752559_04333] Protein/nucleic acid deglycase HchA (EC 3.1.2.-) (EC 3.5.1.-) (EC 3.5.1.124) (Maillard deglycase)
[] Genome polyprotein [Cleaved into: P3; Protein 3AB; P2; P1; Capsid protein VP0 (VP4-VP2); Capsid protein VP4 (P1A) (Virion protein 4); Capsid protein VP2 (P1B) (Virion protein 2); Capsid protein VP3 (P1C) (Virion protein 3); Capsid protein VP1 (P1D) (Virion protein 1); Protease 2A (P2A) (EC 3.4.22.29) (Picornain 2A) (Protein 2A); Protein 2B (P2B); Protein 2C (P2C) (EC 3.6.1.15); Protein 3A (P3A); Viral protein genome-linked (VPg) (Protein 3B) (P3B); Protein 3CD (EC 3.4.22.28); Protease 3C (P3C); RNA-directed RNA polymerase (RdRp) (EC 2.7.7.48) (3D polymerase) (3Dpol) (Protein 3D) (3D)]
[] Genome polyprotein [Cleaved into: Protein VP0 (P1AB) (Virion protein 0); Protein VP3 (P1C) (Virion protein 3); Protein VP1 (P1D) (Virion protein 1); Protein 2A (P2A); Protein 2B (P2B); Protein 2C (P2C) (EC 3.6.1.15); Protein 3A (P3A); Protein 3B (P3B) (VPg); Protease 3C (P3C) (EC 3.4.22.28) (EC 3.4.22.29) (Picornain 3C); RNA-directed RNA polymerase 3D-POL (P3D-POL) (EC 2.7.7.48)]
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.47) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]
[gag-pol] Gag-Pol polyprotein (Pr160Gag-Pol) [Cleaved into: Matrix protein p17 (MA); Capsid protein p24 (CA); Spacer peptide 1 (SP1) (p2); Nucleocapsid protein p7 (NC); Transframe peptide (TF); p6-pol (p6*); Protease (EC 3.4.23.47) (PR) (Retropepsin); Reverse transcriptase/ribonuclease H (EC 2.7.7.49) (EC 2.7.7.7) (EC 3.1.26.13) (Exoribonuclease H) (EC 3.1.13.2) (p66 RT); p51 RT; p15; Integrase (IN) (EC 2.7.7.-) (EC 3.1.-.-)]

Bibliography :