GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Induced myeloid leukemia cell differentiation protein Mcl-1 (Bcl-2-like protein 3) (Bcl2-L-3) (Bcl-2-related protein EAT/mcl1) (mcl1/EAT)

 MCL1_HUMAN              Reviewed;         350 AA.
Q07820; B2R6B2; D3DV03; D3DV04; Q9HD91; Q9NRQ3; Q9NRQ4; Q9UHR7;
Q9UHR8; Q9UHR9; Q9UNJ1;
01-FEB-1995, integrated into UniProtKB/Swiss-Prot.
06-DEC-2005, sequence version 3.
31-JUL-2019, entry version 209.
RecName: Full=Induced myeloid leukemia cell differentiation protein Mcl-1;
AltName: Full=Bcl-2-like protein 3;
Short=Bcl2-L-3;
AltName: Full=Bcl-2-related protein EAT/mcl1;
AltName: Full=mcl1/EAT;
Name=MCL1; Synonyms=BCL2L3;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND VARIANT ASP-173.
TISSUE=Myeloid leukemia cell;
PubMed=7682708; DOI=10.1073/pnas.90.8.3516;
Kozopas K.M., Yang T., Buchan H.L., Zhou P., Craig R.W.;
"MCL1, a gene expressed in programmed myeloid cell differentiation,
has sequence similarity to BCL2.";
Proc. Natl. Acad. Sci. U.S.A. 90:3516-3520(1993).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), AND INDUCTION.
PubMed=8790944;
Umezawa A., Maruyama T., Inazawa J., Imai S., Takano T., Hata J.;
"Induction of mcl1/EAT, Bcl-2 related gene, by retinoic acid or heat
shock in the human embryonal carcinoma cells, NCR-G3.";
Cell Struct. Funct. 21:143-150(1996).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=11130466; DOI=10.1007/PL00000728;
Akgul C., Turner P.C., White M.R.H., Edwards S.W.;
"Functional analysis of the human MCL-1 gene.";
Cell. Mol. Life Sci. 57:684-691(2000).
[4]
NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORMS 1 AND 2), VARIANT ASP-173,
AND FUNCTION.
TISSUE=Myeloid leukemia cell, and Neuroblastoma;
PubMed=10766760; DOI=10.1074/jbc.M909572199;
Bingle C.D., Craig R.W., Swales B.M., Singleton V., Zhou P.,
Whyte M.K.B.;
"Exon skipping in Mcl-1 results in a Bcl-2 homology domain 3 only gene
product that promotes cell death.";
J. Biol. Chem. 275:22136-22146(2000).
[5]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), INTERACTION WITH BAX;
BAK1 AND BCL2L11, AND DIMERIZATION OF ISOFORMS 1 AND 2.
PubMed=10837489; DOI=10.1074/jbc.M909826199;
Bae J., Leo C.P., Hsu S.Y., Hsueh A.J.W.;
"MCL-1S, a splicing variant of the antiapoptotic BCL-2 family member
MCL-1, encodes a proapoptotic protein possessing only the BH3
domain.";
J. Biol. Chem. 275:25255-25261(2000).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S.,
Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y.,
Phelan M., Farmer A.;
"Cloning of human full-length CDSs in BD Creator(TM) system donor
vector.";
Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT
VAL-227.
TISSUE=Thalamus;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[8]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANT VAL-227.
NIEHS SNPs program;
Submitted (JUN-2005) to the EMBL/GenBank/DDBJ databases.
[9]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[10]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[11]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Mammary gland, and Placenta;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[12]
NUCLEOTIDE SEQUENCE [MRNA] OF 182-289 (ISOFORM 1), AND VARIANT
VAL-227.
TISSUE=Ewing sarcoma;
PubMed=10634649; DOI=10.1016/S0145-2126(99)00137-X;
Okita H., Umezawa A., Fukuma M., Hata J.;
"Acute myeloid leukemia possessing jumping translocation is related to
highly elevated levels of EAT/mcl-1, a Bcl-2 related gene with anti-
apoptotic functions.";
Leuk. Res. 24:73-77(2000).
[13]
PROTEIN SEQUENCE OF N-TERMINUS OF FRAGMENTS OBTAINED BY CASPASE
CLEAVAGE, AND MUTAGENESIS OF ASP-127 AND ASP-157.
PubMed=15122313; DOI=10.1038/sj.onc.1207648;
Michels J., O'Neill J.W., Dallman C.L., Mouzakiti A., Habens F.,
Brimmell M., Zhang K.Y.J., Craig R.W., Marcusson E.G., Johnson P.W.M.,
Packham G.;
"Mcl-1 is required for Akata6 B-lymphoma cell survival and is
converted to a cell death molecule by efficient caspase-mediated
cleavage.";
Oncogene 23:4818-4827(2004).
[14]
INDUCTION.
PubMed=9671497; DOI=10.1128/MCB.18.8.4883;
Chao J.-R., Wang J.-M., Lee S.-F., Peng H.-W., Lin Y.-H., Chou C.-H.,
Li J.-C., Huang H.-M., Chou C.-K., Kuo M.-L., Yen J.J.-Y.,
Yang-Yen H.-F.;
"Mcl-1 is an immediate-early gene activated by the granulocyte-
macrophage colony-stimulating factor (GM-CSF) signaling pathway and is
one component of the GM-CSF viability response.";
Mol. Cell. Biol. 18:4883-4898(1998).
[15]
INTERACTION WITH TPT1, AND SUBCELLULAR LOCATION.
PubMed=12149273; DOI=10.1074/jbc.M207413200;
Zhang D., Li F., Weidner D., Mnjoyan Z.H., Fujise K.;
"Physical and functional interaction between myeloid cell leukemia 1
protein (MCL1) and fortilin. The potential role of MCL1 as a fortilin
chaperone.";
J. Biol. Chem. 277:37430-37438(2002).
[16]
PHOSPHORYLATION AT SER-121 AND THR-163.
PubMed=12223490; DOI=10.1074/jbc.M207951200;
Inoshita S., Takeda K., Hatai T., Terada Y., Sano M., Hata J.,
Umezawa A., Ichijo H.;
"Phosphorylation and inactivation of myeloid cell leukemia 1 by JNK in
response to oxidative stress.";
J. Biol. Chem. 277:43730-43734(2002).
[17]
INTERACTION WITH BAK1, AND SUBCELLULAR LOCATION.
PubMed=15077116; DOI=10.1038/ncb1123;
Leu J.I.-J., Dumont P., Hafey M., Murphy M.E., George D.L.;
"Mitochondrial p53 activates Bak and causes disruption of a Bak-Mcl1
complex.";
Nat. Cell Biol. 6:443-450(2004).
[18]
PHOSPHORYLATION AT THR-163, AND MUTAGENESIS OF SER-162 AND THR-163.
PubMed=15241487; DOI=10.1038/sj.onc.1207692;
Domina A.M., Vrana J.A., Gregory M.A., Hann S.R., Craig R.W.;
"MCL1 is phosphorylated in the PEST region and stabilized upon ERK
activation in viable cells, and at additional sites with cytotoxic
okadaic acid or taxol.";
Oncogene 23:5301-5315(2004).
[19]
UBIQUITINATION, AND MUTAGENESIS OF LYS-5; LYS-40; LYS-136; LYS-194;
LYS-197; LYS-208 AND LYS-234.
PubMed=15989957; DOI=10.1016/j.cell.2005.06.009;
Zhong Q., Gao W., Du F., Wang X.;
"Mule/ARF-BP1, a BH3-only E3 ubiquitin ligase, catalyzes the
polyubiquitination of Mcl-1 and regulates apoptosis.";
Cell 121:1085-1095(2005).
[20]
FUNCTION AS INHIBITOR OF APOPTOSIS, PHOSPHORYLATION AT SER-159 BY
GSK3-ALPHA AND GSK3-BETA, UBIQUITINATION, AND MUTAGENESIS OF SER-159.
PubMed=16543145; DOI=10.1016/j.molcel.2006.02.009;
Maurer U., Charvet C., Wagman A.S., Dejardin E., Green D.R.;
"Glycogen synthase kinase-3 regulates mitochondrial outer membrane
permeabilization and apoptosis by destabilization of MCL-1.";
Mol. Cell 21:749-760(2006).
[21]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Cervix carcinoma;
PubMed=18669648; DOI=10.1073/pnas.0805139105;
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,
Elledge S.J., Gygi S.P.;
"A quantitative atlas of mitotic phosphorylation.";
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
[22]
SUBCELLULAR LOCATION, PHOSPHORYLATION AT SER-162 AND THR-163, AND
MUTAGENESIS OF SER-162.
PubMed=23024798; DOI=10.1371/journal.pone.0045088;
Thomas L.W., Lam C., Clark R.E., White M.R., Spiller D.G., Moots R.J.,
Edwards S.W.;
"Serine 162, an essential residue for the mitochondrial localization,
stability and anti-apoptotic function of Mcl-1.";
PLoS ONE 7:E45088-E45088(2012).
[23]
INTERACTION WITH RTL10/BOP.
PubMed=23055042; DOI=10.1007/s13238-012-2069-7;
Zhang X., Weng C., Li Y., Wang X., Jiang C., Li X., Xu Y., Chen Q.,
Pan L., Tang H.;
"Human Bop is a novel BH3-only member of the Bcl-2 protein family.";
Protein Cell 3:790-801(2012).
[24]
INTERACTION WITH BCL2L11.
PubMed=27013495; DOI=10.15252/embr.201541392;
Weber A., Heinlein M., Dengjel J., Alber C., Singh P.K., Haecker G.;
"The deubiquitinase Usp27x stabilizes the BH3-only protein Bim and
enhances apoptosis.";
EMBO Rep. 17:724-738(2016).
[25]
X-RAY CRYSTALLOGRAPHY (1.55 ANGSTROMS) OF 151-307 IN COMPLEXES WITH
PMAIP1 AND BCL2L11.
PubMed=17389404; DOI=10.1073/pnas.0701297104;
Czabotar P.E., Lee E.F., van Delft M.F., Day C.L., Smith B.J.,
Huang D.C.S., Fairlie W.D., Hinds M.G., Colman P.M.;
"Structural insights into the degradation of Mcl-1 induced by BH3
domains.";
Proc. Natl. Acad. Sci. U.S.A. 104:6217-6222(2007).
[26]
X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 172-327 IN COMPLEX WITH
BCL2L11.
PubMed=20562877; DOI=10.1038/nchembio.391;
Stewart M.L., Fire E., Keating A.E., Walensky L.D.;
"The MCL-1 BH3 helix is an exclusive MCL-1 inhibitor and apoptosis
sensitizer.";
Nat. Chem. Biol. 6:595-601(2010).
[27]
VARIANT [LARGE SCALE ANALYSIS] LEU-231.
PubMed=18987736; DOI=10.1038/nature07485;
Ley T.J., Mardis E.R., Ding L., Fulton B., McLellan M.D., Chen K.,
Dooling D., Dunford-Shore B.H., McGrath S., Hickenbotham M., Cook L.,
Abbott R., Larson D.E., Koboldt D.C., Pohl C., Smith S., Hawkins A.,
Abbott S., Locke D., Hillier L.W., Miner T., Fulton L., Magrini V.,
Wylie T., Glasscock J., Conyers J., Sander N., Shi X., Osborne J.R.,
Minx P., Gordon D., Chinwalla A., Zhao Y., Ries R.E., Payton J.E.,
Westervelt P., Tomasson M.H., Watson M., Baty J., Ivanovich J.,
Heath S., Shannon W.D., Nagarajan R., Walter M.J., Link D.C.,
Graubert T.A., DiPersio J.F., Wilson R.K.;
"DNA sequencing of a cytogenetically normal acute myeloid leukaemia
genome.";
Nature 456:66-72(2008).
-!- FUNCTION: Involved in the regulation of apoptosis versus cell
survival, and in the maintenance of viability but not of
proliferation. Mediates its effects by interactions with a number
of other regulators of apoptosis. Isoform 1 inhibits apoptosis.
Isoform 2 promotes apoptosis. {ECO:0000269|PubMed:10766760,
ECO:0000269|PubMed:16543145}.
-!- SUBUNIT: Interacts with HIF3A (via C-terminus domain) (By
similarity). Interacts with BAD, BOK, BIK and BMF (By similarity).
Interacts with PMAIP1 (PubMed:17389404). Interacts with BBC3 (By
similarity). Isoform 1 interacts with BAX, BAK1 and TPT1
(PubMed:10837489, PubMed:12149273, PubMed:15077116). Heterodimer
of isoform 1 and isoform 2. Homodimers of isoform 1 or isoform 2
are not detected. Isoform 2 does not interact with pro-apoptotic
BCL2-related proteins (PubMed:10837489). Interacts with RTL10/BOP
(PubMed:23055042). Interacts with BCL2L11; may sequester BCL2L11
to prevent its pro-apoptotic activity (PubMed:10837489,
PubMed:27013495, PubMed:17389404, PubMed:20562877). Interacts with
GIMAP5 and HSPA8/HSC70; the interaction between HSPA8 and MCL1 is
impaired in the absence of GIMAP5 (By similarity).
{ECO:0000250|UniProtKB:P97287, ECO:0000250|UniProtKB:Q9Z1P3,
ECO:0000269|PubMed:10837489, ECO:0000269|PubMed:12149273,
ECO:0000269|PubMed:15077116, ECO:0000269|PubMed:17389404,
ECO:0000269|PubMed:20562877, ECO:0000269|PubMed:23055042,
ECO:0000269|PubMed:27013495}.
-!- INTERACTION:
Q91AU0:- (xeno); NbExp=2; IntAct=EBI-1003422, EBI-9657017;
Q16611:BAK1; NbExp=15; IntAct=EBI-1003422, EBI-519866;
Q07812:BAX; NbExp=8; IntAct=EBI-1003422, EBI-516580;
Q9BXH1:BBC3; NbExp=4; IntAct=EBI-1003422, EBI-519884;
Q9BXH1-2:BBC3; NbExp=2; IntAct=EBI-1003422, EBI-519896;
O43521:BCL2L11; NbExp=15; IntAct=EBI-1003422, EBI-526406;
Q14457:BECN1; NbExp=2; IntAct=EBI-1003422, EBI-949378;
P55957:BID; NbExp=2; IntAct=EBI-1003422, EBI-519672;
Q03135:CAV1; NbExp=3; IntAct=EBI-1003422, EBI-603614;
P49817:Cav1 (xeno); NbExp=3; IntAct=EBI-1003422, EBI-1161338;
Q7Z6Z7:HUWE1; NbExp=6; IntAct=EBI-1003422, EBI-625934;
Q13794:PMAIP1; NbExp=5; IntAct=EBI-1003422, EBI-707392;
Q9JM54:Pmaip1 (xeno); NbExp=2; IntAct=EBI-1003422, EBI-709183;
Q7L3V2:RTL10; NbExp=2; IntAct=EBI-1003422, EBI-10697720;
Q93008:USP9X; NbExp=10; IntAct=EBI-1003422, EBI-302524;
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000305}; Single-pass membrane
protein {ECO:0000305}. Cytoplasm. Mitochondrion. Nucleus,
nucleoplasm. Note=Cytoplasmic, associated with mitochondria.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1; Synonyms=MCL1L, MCL-1L;
IsoId=Q07820-1; Sequence=Displayed;
Name=2; Synonyms=Delta S, MCL-1S, TM;
IsoId=Q07820-2; Sequence=VSP_000532, VSP_000533;
-!- INDUCTION: Expression increases early during phorbol ester-induced
differentiation along the monocyte/macrophage pathway in myeloid
leukemia cell line ML-1. Rapidly up-regulated by CSF2 in ML-1
cells. Up-regulated by heat shock-induced differentiation.
Expression increases early during retinoic acid-induced
differentiation. {ECO:0000269|PubMed:8790944,
ECO:0000269|PubMed:9671497}.
-!- PTM: Cleaved by CASP3 during apoptosis. In intact cells cleavage
occurs preferentially after Asp-127, yielding a pro-apoptotic 28
kDa C-terminal fragment.
-!- PTM: Rapidly degraded in the absence of phosphorylation on Thr-163
in the PEST region. {ECO:0000269|PubMed:12223490,
ECO:0000269|PubMed:15241487, ECO:0000269|PubMed:23024798}.
-!- PTM: Phosphorylated on Ser-159, by GSK3, in response to
IL3/interleukin-3 withdrawal. Phosphorylation at Ser-159 induces
ubiquitination and proteasomal degradation, abrogating the anti-
apoptotic activity. Treatment with taxol or okadaic acid induces
phosphorylation on additional sites.
{ECO:0000269|PubMed:16543145}.
-!- PTM: Ubiquitinated. Ubiquitination is induced by phosphorylation
at Ser-159. {ECO:0000269|PubMed:16543145}.
-!- SIMILARITY: Belongs to the Bcl-2 family. {ECO:0000305}.
-!- WEB RESOURCE: Name=NIEHS-SNPs;
URL="http://egp.gs.washington.edu/data/mcl1/";
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; L08246; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AF118124; AAD13299.1; -; mRNA.
EMBL; AF147742; AAF74821.1; -; Genomic_DNA.
EMBL; AF198614; AAF64255.1; -; Genomic_DNA.
EMBL; AF198614; AAF64256.1; -; Genomic_DNA.
EMBL; AF162677; AAG00896.1; -; Genomic_DNA.
EMBL; AF162676; AAG00896.1; JOINED; Genomic_DNA.
EMBL; AF203373; AAG00904.1; -; mRNA.
EMBL; BT006640; AAP35286.1; -; mRNA.
EMBL; AK312508; BAG35409.1; -; mRNA.
EMBL; DQ088966; AAY68220.1; -; Genomic_DNA.
EMBL; AL356356; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471121; EAW53538.1; -; Genomic_DNA.
EMBL; CH471121; EAW53539.1; -; Genomic_DNA.
EMBL; CH471121; EAW53540.1; -; Genomic_DNA.
EMBL; CH471121; EAW53541.1; -; Genomic_DNA.
EMBL; BC017197; AAH17197.1; -; mRNA.
EMBL; BC071897; AAH71897.1; -; mRNA.
EMBL; BC107735; AAI07736.1; -; mRNA.
EMBL; AF118276; AAF15309.1; -; mRNA.
EMBL; AF118277; AAF15310.1; -; mRNA.
EMBL; AF118278; AAF15311.1; -; mRNA.
CCDS; CCDS956.1; -. [Q07820-2]
CCDS; CCDS957.1; -. [Q07820-1]
PIR; A47476; A47476.
RefSeq; NP_001184249.1; NM_001197320.1.
RefSeq; NP_068779.1; NM_021960.4. [Q07820-1]
RefSeq; NP_877495.1; NM_182763.2. [Q07820-2]
PDB; 2KBW; NMR; -; A=163-326.
PDB; 2MHS; NMR; -; A=171-327.
PDB; 2NL9; X-ray; 1.55 A; A=209-327.
PDB; 2NLA; X-ray; 2.80 A; A=209-327.
PDB; 2PQK; X-ray; 2.00 A; A=172-327.
PDB; 3D7V; X-ray; 2.03 A; A=209-327.
PDB; 3IO9; X-ray; 2.40 A; A=209-327.
PDB; 3KJ0; X-ray; 1.70 A; A=172-327.
PDB; 3KJ1; X-ray; 1.94 A; A=172-327.
PDB; 3KJ2; X-ray; 2.35 A; A=172-327.
PDB; 3KZ0; X-ray; 2.35 A; A/B=172-327.
PDB; 3MK8; X-ray; 2.32 A; A=172-327, B=208-228.
PDB; 3PK1; X-ray; 2.49 A; A/C=174-326.
PDB; 3TWU; X-ray; 1.80 A; B=73-88.
PDB; 3WIX; X-ray; 1.90 A; A/B/C/D=172-327.
PDB; 3WIY; X-ray; 2.15 A; A/B/C/D/E/F=172-327.
PDB; 4BPI; X-ray; 1.98 A; A=209-327.
PDB; 4BPJ; X-ray; 1.60 A; A=209-327.
PDB; 4HW2; X-ray; 2.80 A; A/B/C/D/E/F=172-323.
PDB; 4HW3; X-ray; 2.40 A; A/B/C/D/E/F/G/H/I/J/K/L=172-323.
PDB; 4HW4; X-ray; 1.53 A; A/B=172-327.
PDB; 4OQ5; X-ray; 2.86 A; A/B/C/D/E/F=174-326.
PDB; 4OQ6; X-ray; 1.81 A; A/B=174-326.
PDB; 4WGI; X-ray; 1.85 A; A=173-321.
PDB; 4WMR; X-ray; 1.70 A; A=173-321.
PDB; 4WMS; X-ray; 1.90 A; A=174-321.
PDB; 4WMT; X-ray; 2.35 A; A=174-321.
PDB; 4WMU; X-ray; 1.55 A; A=174-321.
PDB; 4WMV; X-ray; 2.40 A; A=174-321.
PDB; 4WMW; X-ray; 1.90 A; A=174-321.
PDB; 4WMX; X-ray; 2.00 A; A=174-321.
PDB; 4ZBF; X-ray; 2.20 A; A/B/C/D/E/F/G/H/I/J/K/L=172-327.
PDB; 4ZBI; X-ray; 2.50 A; A/B/C/D/E/F/G/H/I/J/K/L=172-327.
PDB; 5C3F; X-ray; 1.43 A; A=173-327.
PDB; 5C6H; X-ray; 2.05 A; A/C/E/G/I/K/M/O/Q/S/U/W=171-327.
PDB; 5FC4; X-ray; 1.50 A; A=172-320.
PDB; 5FDO; X-ray; 2.80 A; A/B/C/D=172-320.
PDB; 5FDR; X-ray; 2.60 A; A/B/C/D=172-327.
PDB; 5IEZ; X-ray; 2.60 A; A/B/C/D=172-327.
PDB; 5IF4; X-ray; 2.39 A; A/B=172-327.
PDB; 5JSB; X-ray; 2.74 A; A/C/E/G/I/K=172-350.
PDB; 5KU9; X-ray; 2.20 A; A/B=174-219, A/B=258-327.
PDB; 5LOF; X-ray; 2.20 A; A=173-321.
PDB; 5MES; X-ray; 2.24 A; A=241-327.
PDB; 5MEV; X-ray; 2.94 A; A=241-327.
PDB; 5UUM; X-ray; 2.35 A; A/B=172-325.
PDB; 5VKC; X-ray; 2.31 A; A/B=174-326.
PDB; 5VX2; X-ray; 1.85 A; A/C=241-327.
PDB; 5W89; X-ray; 1.42 A; A=172-321.
PDB; 5W8F; X-ray; 1.85 A; A=172-320.
PDB; 6B4L; X-ray; 2.25 A; A/B=174-326.
PDB; 6B4U; X-ray; 1.95 A; A=174-326.
PDB; 6BW2; X-ray; 2.75 A; A/B/C/D=172-327.
PDB; 6BW8; X-ray; 2.90 A; A/B/C/D=172-327.
PDB; 6FS0; X-ray; 2.25 A; A=174-324.
PDB; 6FS1; X-ray; 1.60 A; A/B=174-321.
PDB; 6FS2; X-ray; 2.55 A; A=174-325, B=174-324.
PDB; 6MBD; X-ray; 1.95 A; A/B=172-324.
PDB; 6MBE; X-ray; 2.25 A; A=172-323.
PDB; 6NE5; X-ray; 1.85 A; A/B/C/D=172-328.
PDB; 6O6F; X-ray; 1.60 A; A/B=172-327.
PDB; 6O6G; X-ray; 2.40 A; A=172-327.
PDB; 6OQB; X-ray; 1.60 A; A=171-327.
PDB; 6OQC; X-ray; 1.80 A; A/B=171-327.
PDB; 6OQD; X-ray; 1.48 A; A=171-327.
PDB; 6OQN; X-ray; 1.70 A; A/B=171-327.
PDB; 6OVC; NMR; -; A=171-327.
PDBsum; 2KBW; -.
PDBsum; 2MHS; -.
PDBsum; 2NL9; -.
PDBsum; 2NLA; -.
PDBsum; 2PQK; -.
PDBsum; 3D7V; -.
PDBsum; 3IO9; -.
PDBsum; 3KJ0; -.
PDBsum; 3KJ1; -.
PDBsum; 3KJ2; -.
PDBsum; 3KZ0; -.
PDBsum; 3MK8; -.
PDBsum; 3PK1; -.
PDBsum; 3TWU; -.
PDBsum; 3WIX; -.
PDBsum; 3WIY; -.
PDBsum; 4BPI; -.
PDBsum; 4BPJ; -.
PDBsum; 4HW2; -.
PDBsum; 4HW3; -.
PDBsum; 4HW4; -.
PDBsum; 4OQ5; -.
PDBsum; 4OQ6; -.
PDBsum; 4WGI; -.
PDBsum; 4WMR; -.
PDBsum; 4WMS; -.
PDBsum; 4WMT; -.
PDBsum; 4WMU; -.
PDBsum; 4WMV; -.
PDBsum; 4WMW; -.
PDBsum; 4WMX; -.
PDBsum; 4ZBF; -.
PDBsum; 4ZBI; -.
PDBsum; 5C3F; -.
PDBsum; 5C6H; -.
PDBsum; 5FC4; -.
PDBsum; 5FDO; -.
PDBsum; 5FDR; -.
PDBsum; 5IEZ; -.
PDBsum; 5IF4; -.
PDBsum; 5JSB; -.
PDBsum; 5KU9; -.
PDBsum; 5LOF; -.
PDBsum; 5MES; -.
PDBsum; 5MEV; -.
PDBsum; 5UUM; -.
PDBsum; 5VKC; -.
PDBsum; 5VX2; -.
PDBsum; 5W89; -.
PDBsum; 5W8F; -.
PDBsum; 6B4L; -.
PDBsum; 6B4U; -.
PDBsum; 6BW2; -.
PDBsum; 6BW8; -.
PDBsum; 6FS0; -.
PDBsum; 6FS1; -.
PDBsum; 6FS2; -.
PDBsum; 6MBD; -.
PDBsum; 6MBE; -.
PDBsum; 6NE5; -.
PDBsum; 6O6F; -.
PDBsum; 6O6G; -.
PDBsum; 6OQB; -.
PDBsum; 6OQC; -.
PDBsum; 6OQD; -.
PDBsum; 6OQN; -.
PDBsum; 6OVC; -.
SMR; Q07820; -.
BioGrid; 110338; 86.
ComplexPortal; CPX-304; MCL1:PMAIP1 complex.
ComplexPortal; CPX-481; MCL-1-BIM complex. [Q07820-1]
CORUM; Q07820; -.
DIP; DIP-231N; -.
ELM; Q07820; -.
IntAct; Q07820; 37.
MINT; Q07820; -.
STRING; 9606.ENSP00000358022; -.
BindingDB; Q07820; -.
ChEMBL; CHEMBL4361; -.
GuidetoPHARMACOLOGY; 2847; -.
iPTMnet; Q07820; -.
PhosphoSitePlus; Q07820; -.
BioMuta; MCL1; -.
DMDM; 83304396; -.
EPD; Q07820; -.
jPOST; Q07820; -.
MaxQB; Q07820; -.
PaxDb; Q07820; -.
PeptideAtlas; Q07820; -.
PRIDE; Q07820; -.
ProteomicsDB; 58540; -. [Q07820-1]
ProteomicsDB; 58541; -. [Q07820-2]
ABCD; Q07820; -.
DNASU; 4170; -.
Ensembl; ENST00000307940; ENSP00000309973; ENSG00000143384. [Q07820-2]
Ensembl; ENST00000369026; ENSP00000358022; ENSG00000143384. [Q07820-1]
GeneID; 4170; -.
KEGG; hsa:4170; -.
UCSC; uc001euz.4; human. [Q07820-1]
CTD; 4170; -.
DisGeNET; 4170; -.
GeneCards; MCL1; -.
HGNC; HGNC:6943; MCL1.
HPA; CAB002781; -.
HPA; CAB068195; -.
HPA; HPA008455; -.
HPA; HPA031125; -.
MIM; 159552; gene.
neXtProt; NX_Q07820; -.
OpenTargets; ENSG00000143384; -.
PharmGKB; PA30688; -.
eggNOG; KOG4728; Eukaryota.
eggNOG; ENOG41123S0; LUCA.
GeneTree; ENSGT00950000182651; -.
InParanoid; Q07820; -.
KO; K02539; -.
OMA; KQKGWEG; -.
OrthoDB; 1218929at2759; -.
PhylomeDB; Q07820; -.
TreeFam; TF315834; -.
Reactome; R-HSA-6785807; Interleukin-4 and Interleukin-13 signaling.
SIGNOR; Q07820; -.
ChiTaRS; MCL1; human.
EvolutionaryTrace; Q07820; -.
GeneWiki; MCL1; -.
GenomeRNAi; 4170; -.
PMAP-CutDB; Q07820; -.
PRO; PR:Q07820; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000143384; Expressed in 233 organ(s), highest expression level in epithelium of mammary gland.
ExpressionAtlas; Q07820; baseline and differential.
Genevisible; Q07820; HS.
GO; GO:0097136; C:Bcl-2 family protein complex; IDA:UniProtKB.
GO; GO:0005737; C:cytoplasm; TAS:UniProtKB.
GO; GO:0005829; C:cytosol; ISS:UniProtKB.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0016020; C:membrane; IDA:MGI.
GO; GO:0005741; C:mitochondrial outer membrane; IBA:GO_Central.
GO; GO:0005739; C:mitochondrion; IDA:HPA.
GO; GO:0005654; C:nucleoplasm; IEA:UniProtKB-SubCell.
GO; GO:0005634; C:nucleus; IDA:MGI.
GO; GO:0051434; F:BH3 domain binding; IPI:BHF-UCL.
GO; GO:0046982; F:protein heterodimerization activity; IPI:UniProtKB.
GO; GO:0042803; F:protein homodimerization activity; IBA:GO_Central.
GO; GO:0008320; F:protein transmembrane transporter activity; TAS:UniProtKB.
GO; GO:0001709; P:cell fate determination; NAS:UniProtKB.
GO; GO:0019725; P:cellular homeostasis; NAS:UniProtKB.
GO; GO:0019221; P:cytokine-mediated signaling pathway; TAS:Reactome.
GO; GO:0097192; P:extrinsic apoptotic signaling pathway in absence of ligand; IMP:UniProtKB.
GO; GO:0008630; P:intrinsic apoptotic signaling pathway in response to DNA damage; IBA:GO_Central.
GO; GO:0007275; P:multicellular organism development; IEA:UniProtKB-KW.
GO; GO:2000811; P:negative regulation of anoikis; IMP:UniProtKB.
GO; GO:0043066; P:negative regulation of apoptotic process; IDA:BHF-UCL.
GO; GO:0010507; P:negative regulation of autophagy; IMP:UniProtKB.
GO; GO:2001240; P:negative regulation of extrinsic apoptotic signaling pathway in absence of ligand; IMP:UniProtKB.
GO; GO:2001243; P:negative regulation of intrinsic apoptotic signaling pathway; IBA:GO_Central.
GO; GO:1903378; P:positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway; IGI:ParkinsonsUK-UCL.
GO; GO:2001020; P:regulation of response to DNA damage stimulus; IMP:MGI.
GO; GO:0034097; P:response to cytokine; IDA:MGI.
Gene3D; 1.10.437.10; -; 1.
InterPro; IPR013281; Apop_reg_Mc1.
InterPro; IPR002475; Bcl2-like.
InterPro; IPR020717; Bcl2_BH1_motif_CS.
InterPro; IPR020726; Bcl2_BH2_motif_CS.
InterPro; IPR020728; Bcl2_BH3_motif_CS.
InterPro; IPR036834; Blc2-like_sf.
InterPro; IPR026298; Blc2_fam.
PANTHER; PTHR11256; PTHR11256; 1.
PANTHER; PTHR11256:SF46; PTHR11256:SF46; 1.
Pfam; PF00452; Bcl-2; 1.
PRINTS; PR01866; APOPREGMCL1.
PRINTS; PR01862; BCL2FAMILY.
SUPFAM; SSF56854; SSF56854; 1.
PROSITE; PS50062; BCL2_FAMILY; 1.
PROSITE; PS01080; BH1; 1.
PROSITE; PS01258; BH2; 1.
PROSITE; PS01259; BH3; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Apoptosis; Complete proteome;
Cytoplasm; Developmental protein; Differentiation;
Direct protein sequencing; Isopeptide bond; Membrane; Mitochondrion;
Nucleus; Phosphoprotein; Polymorphism; Reference proteome;
Transmembrane; Transmembrane helix; Ubl conjugation.
CHAIN 1 350 Induced myeloid leukemia cell
differentiation protein Mcl-1.
/FTId=PRO_0000143080.
TRANSMEM 328 348 Helical. {ECO:0000255}.
REGION 104 175 PEST-like.
MOTIF 209 223 BH3.
MOTIF 252 272 BH1.
MOTIF 304 319 BH2.
SITE 127 128 Cleavage; by caspase-3.
SITE 157 158 Cleavage; by caspase-3.
MOD_RES 121 121 Phosphoserine.
{ECO:0000269|PubMed:12223490}.
MOD_RES 159 159 Phosphoserine; by GSK3-alpha and GSK3-
beta. {ECO:0000269|PubMed:16543145}.
MOD_RES 162 162 Phosphoserine.
{ECO:0000269|PubMed:23024798}.
MOD_RES 163 163 Phosphothreonine; by MAPK.
{ECO:0000269|PubMed:12223490,
ECO:0000269|PubMed:15241487,
ECO:0000269|PubMed:23024798}.
CROSSLNK 5 5 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in ubiquitin).
CROSSLNK 40 40 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in ubiquitin).
CROSSLNK 136 136 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in ubiquitin).
CROSSLNK 194 194 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in ubiquitin).
CROSSLNK 197 197 Glycyl lysine isopeptide (Lys-Gly)
(interchain with G-Cter in ubiquitin).
VAR_SEQ 231 271 MLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFG
-> WVCGVLPCRGPRRWHQECAAGFCRCCWSRSWFGISNKI
ALL (in isoform 2).
{ECO:0000303|PubMed:10837489}.
/FTId=VSP_000532.
VAR_SEQ 272 350 Missing (in isoform 2).
{ECO:0000303|PubMed:10837489}.
/FTId=VSP_000533.
VARIANT 173 173 E -> D (in dbSNP:rs2737820).
{ECO:0000269|PubMed:10766760,
ECO:0000269|PubMed:7682708}.
/FTId=VAR_024021.
VARIANT 227 227 A -> V (in dbSNP:rs11580946).
{ECO:0000269|PubMed:10634649,
ECO:0000269|PubMed:14702039,
ECO:0000269|Ref.8}.
/FTId=VAR_024022.
VARIANT 231 231 M -> L (in dbSNP:rs140449444).
{ECO:0000269|PubMed:18987736}.
/FTId=VAR_054157.
MUTAGEN 5 5 K->R: Reduced ubiquitination.
{ECO:0000269|PubMed:15989957}.
MUTAGEN 40 40 K->R: Reduced ubiquitination.
{ECO:0000269|PubMed:15989957}.
MUTAGEN 127 127 D->A: Abolishes formation of 28 and 17
kDa cleavage products by CASP3. Abolishes
cleavage by caspase-3; when associated
with A-157.
{ECO:0000269|PubMed:15122313}.
MUTAGEN 136 136 K->R: Reduced ubiquitination.
{ECO:0000269|PubMed:15989957}.
MUTAGEN 157 157 D->A: Abolishes formation of 23 and 21
kDa cleavage products by CASP3. Abolishes
cleavage by caspase-3; when associated
with A-127.
{ECO:0000269|PubMed:15122313}.
MUTAGEN 159 159 S->A: Loss of phosphorylation by GSK3 and
loss of ubiquitination increasing protein
stability. {ECO:0000269|PubMed:16543145}.
MUTAGEN 162 162 S->A: Abolishes mitochondrial
localization and decreases stability.
{ECO:0000269|PubMed:15241487,
ECO:0000269|PubMed:23024798}.
MUTAGEN 162 162 S->A: No effect.
{ECO:0000269|PubMed:15241487,
ECO:0000269|PubMed:23024798}.
MUTAGEN 163 163 T->A,E: No effect on mitochondrial
localization.
{ECO:0000269|PubMed:15241487}.
MUTAGEN 163 163 T->A: Abolishes phosphorylation by MAPK.
No effect on phosphorylation induced by
okadaic acid or taxol.
{ECO:0000269|PubMed:15241487}.
MUTAGEN 194 194 K->R: Reduced ubiquitination.
{ECO:0000269|PubMed:15989957}.
MUTAGEN 197 197 K->R: Reduced ubiquitination.
{ECO:0000269|PubMed:15989957}.
MUTAGEN 208 208 K->R: No effect on ubiquitination.
{ECO:0000269|PubMed:15989957}.
MUTAGEN 234 234 K->R: No effect on ubiquitination.
{ECO:0000269|PubMed:15989957}.
HELIX 173 187 {ECO:0000244|PDB:5W89}.
TURN 189 191 {ECO:0000244|PDB:3MK8}.
STRAND 200 202 {ECO:0000244|PDB:6FS1}.
HELIX 204 223 {ECO:0000244|PDB:5W89}.
HELIX 225 235 {ECO:0000244|PDB:5W89}.
HELIX 240 255 {ECO:0000244|PDB:5W89}.
HELIX 261 280 {ECO:0000244|PDB:5W89}.
HELIX 284 286 {ECO:0000244|PDB:5W89}.
HELIX 287 308 {ECO:0000244|PDB:5W89}.
HELIX 311 318 {ECO:0000244|PDB:5W89}.
HELIX 323 325 {ECO:0000244|PDB:6OVC}.
SEQUENCE 350 AA; 37337 MW; D85821AC59275F1F CRC64;
MFGLKRNAVI GLNLYCGGAG LGAGSGGATR PGGRLLATEK EASARREIGG GEAGAVIGGS
AGASPPSTLT PDSRRVARPP PIGAEVPDVT ATPARLLFFA PTRRAAPLEE MEAPAADAIM
SPEEELDGYE PEPLGKRPAV LPLLELVGES GNNTSTDGSL PSTPPPAEEE EDELYRQSLE
IISRYLREQA TGAKDTKPMG RSGATSRKAL ETLRRVGDGV QRNHETAFQG MLRKLDIKNE
DDVKSLSRVM IHVFSDGVTN WGRIVTLISF GAFVAKHLKT INQESCIEPL AESITDVLVR
TKRDWLVKQR GWDGFVEFFH VEDLEGGIRN VLLAFAGVAG VGAGLAYLIR


Related products :

Catalog number Product name Quantity
E2097h ELISA kit BCL2L3,Bcl2-L-3,Bcl-2-like protein 3,Bcl-2-related protein EAT_mcl1,Homo sapiens,Human,Induced myeloid leukemia cell differentiation protein Mcl-1,MCL1,mcl1_EAT 96T
E2097h ELISA BCL2L3,Bcl2-L-3,Bcl-2-like protein 3,Bcl-2-related protein EAT_mcl1,Homo sapiens,Human,Induced myeloid leukemia cell differentiation protein Mcl-1,MCL1,mcl1_EAT 96T
U2097h CLIA kit BCL2L3,Bcl2-L-3,Bcl-2-like protein 3,Bcl-2-related protein EAT_mcl1,Homo sapiens,Human,Induced myeloid leukemia cell differentiation protein Mcl-1,MCL1,mcl1_EAT 96T
U2097h CLIA BCL2L3,Bcl2-L-3,Bcl-2-like protein 3,Bcl-2-related protein EAT_mcl1,Homo sapiens,Human,Induced myeloid leukemia cell differentiation protein Mcl-1,MCL1,mcl1_EAT 96T
U2097m CLIA Bcl-2-related protein EAT_mcl1,Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Mcl1,Mouse,Mus musculus 96T
U2097m CLIA kit Bcl-2-related protein EAT_mcl1,Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Mcl1,Mouse,Mus musculus 96T
E2097m ELISA kit Bcl-2-related protein EAT_mcl1,Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Mcl1,Mouse,Mus musculus 96T
E2097m ELISA Bcl-2-related protein EAT_mcl1,Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Mcl1,Mouse,Mus musculus 96T
DL-MCL1-Mu Mouse Myeloid Cell Leukemia Sequence 1, Bcl2 Related (MCL1) ELISA Kit 96T
DL-MCL1-Hu Human Myeloid Cell Leukemia Sequence 1, Bcl2 Related (MCL1) ELISA Kit 96T
E1389026 Cat Induced Myeloid Leukemia Cell Differentiation Protein Mcl-1 (MCL1) ELISA Kit
CSB-EL013588CA Cat Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1) ELISA kit 96T
CSB-EL013588RA Rat Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1) ELISA kit 96T
CSB-EL013588DO Dog Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1) ELISA kit 96T
CSB-EL013588MO Mouse Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1) ELISA kit 96T
CSB-EL013588DO Dog Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1) ELISA kit SpeciesDog 96T
CSB-EL013588HU Human Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1) ELISA kit 96T
CSB-EL013588CA Cat Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1) ELISA kit SpeciesCat 96T
CSB-EL013588RA Rat Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1) ELISA kit SpeciesRat 96T
CSB-EL013588HU Human Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1) ELISA kit SpeciesHuman 96T
CSB-EL013588MO Mouse Induced myeloid leukemia cell differentiation protein Mcl-1(MCL1) ELISA kit SpeciesMouse 96T
U2097r CLIA kit Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Mcl1,Rat,Rattus norvegicus 96T
E2097r ELISA Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Mcl1,Rat,Rattus norvegicus 96T
U2097r CLIA Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Mcl1,Rat,Rattus norvegicus 96T
E2097r ELISA kit Induced myeloid leukemia cell differentiation protein Mcl-1 homolog,Mcl1,Rat,Rattus norvegicus 96T
Pathways :
WP731: Sterol regulatory element binding protein related
WP1438: Influenza A virus infection
WP2199: Seed Development
WP2272: Pathogenic Escherichia coli infection
WP1676: Non-homologous end-joining
WP1566: Citrate cycle (TCA cycle)
WP1624: Bacterial secretion system
WP1371: G Protein Signaling Pathways
WP1689: Porphyrin and chlorophyll metabolism
WP2003: Leukocyte TarBase
WP1693: Purine metabolism
WP1254: Apoptosis
WP1650: Fluorobenzoate degradation
WP1290: Apoptosis
WP1659: Glycine, serine and threonine metabolism
WP2218: sGC
WP346: Protein Modifications
WP787: Apoptosis
WP1713: Two-component system
WP901: Apoptosis
WP1665: Limonene and pinene degradation
WP1351: Apoptosis
WP1675: Nitrogen metabolism
WP1909: Signal regulatory protein (SIRP) family interactions
WP2292: Chemokine signaling pathway

Related Genes :
[MCL1 BCL2L3] Induced myeloid leukemia cell differentiation protein Mcl-1 (Bcl-2-like protein 3) (Bcl2-L-3) (Bcl-2-related protein EAT/mcl1) (mcl1/EAT)
[Mcl1] Induced myeloid leukemia cell differentiation protein Mcl-1 homolog (Bcl-2-related protein EAT/mcl1)
[Mcl1] Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
[MCL1] Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
[MCL1] Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
[Bcl2l11 Bim Bod] Bcl-2-like protein 11 (Bcl2-L-11) (Bcl-2-related ovarian death protein) (Bcl2-interacting mediator of cell death)
[BAX BCL2L4] Apoptosis regulator BAX (Bcl-2-like protein 4) (Bcl2-L-4)
[BCL2L11 BIM] Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)
[Bcl2l11 Bim] Bcl-2-like protein 11 (Bcl2-L-11) (Bcl2-interacting mediator of cell death)
[BOK BCL2L9] Bcl-2-related ovarian killer protein (hBOK) (Bcl-2-like protein 9) (Bcl2-L-9)
[BAK1 BAK BCL2L7 CDN1] Bcl-2 homologous antagonist/killer (Apoptosis regulator BAK) (Bcl-2-like protein 7) (Bcl2-L-7)
[mcl1 RHOS4_03500 RSP_1771] L-malyl-CoA/beta-methylmalyl-CoA lyase (EC 4.1.3.24) ((3S)-malyl-CoA/beta-methylmalyl-CoA lyase) ((S)-citramalyl-CoA lyase) (EC 4.1.3.25)
[Bok Mtd] Bcl-2-related ovarian killer protein (Apoptosis activator Mtd) (Protein matador)
[HUWE1 KIAA0312 KIAA1578 UREB1 HSPC272] E3 ubiquitin-protein ligase HUWE1 (EC 2.3.2.26) (ARF-binding protein 1) (ARF-BP1) (HECT, UBA and WWE domain-containing protein 1) (HECT-type E3 ubiquitin transferase HUWE1) (Homologous to E6AP carboxyl terminus homologous protein 9) (HectH9) (Large structure of UREB1) (LASU1) (Mcl-1 ubiquitin ligase E3) (Mule) (Upstream regulatory element-binding protein 1) (URE-B1) (URE-binding protein 1)
[Bok] Bcl-2-related ovarian killer protein
[BAD BBC6 BCL2L8] Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-2-like protein 8) (Bcl2-L-8) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)
[BECN1 GT197] Beclin-1 (Coiled-coil myosin-like BCL2-interacting protein) (Protein GT197) [Cleaved into: Beclin-1-C 35 kDa; Beclin-1-C 37 kDa]
[BCL2A1 BCL2L5 BFL1 GRS HBPA1] Bcl-2-related protein A1 (Bcl-2-like protein 5) (Bcl2-L-5) (Hemopoietic-specific early response protein) (Protein BFL-1) (Protein GRS)
[mcl1] L-malyl-CoA/beta-methylmalyl-CoA lyase (EC 4.1.3.24) ((3S)-malyl-CoA/beta-methylmalyl-CoA lyase)
[Bcl2l1 Bcl2l Bclx] Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)
[BNIP3L BNIP3A BNIP3H NIX] BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like (Adenovirus E1B19K-binding protein B5) (BCL2/adenovirus E1B 19 kDa protein-interacting protein 3A) (NIP3-like protein X) (NIP3L)
[BCL2] Apoptosis regulator Bcl-2
[BCL2L1 BCL2L BCLX] Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)
[BCL2L2 BCLW KIAA0271] Bcl-2-like protein 2 (Bcl2-L-2) (Apoptosis regulator Bcl-W)
[Bad Bbc6] Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)
[BAG3 BIS] BAG family molecular chaperone regulator 3 (BAG-3) (Bcl-2-associated athanogene 3) (Bcl-2-binding protein Bis) (Docking protein CAIR-1)
[Bad] Bcl2-associated agonist of cell death (BAD) (Bcl-2-binding component 6) (Bcl-xL/Bcl-2-associated death promoter) (Bcl2 antagonist of cell death)
[Bcl2 Bcl-2] Apoptosis regulator Bcl-2
[Bcl2l1 Bclx Blc2l] Bcl-2-like protein 1 (Bcl2-L-1) (Apoptosis regulator Bcl-X)
[BCL2L13 MIL1 CD003] Bcl-2-like protein 13 (Bcl2-L-13) (Bcl-rambo) (Protein Mil1)

Bibliography :