GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Intercellular adhesion molecule 1 (ICAM-1) (MALA-2) (MyD10) (CD antigen CD54)

 ICAM1_MOUSE             Reviewed;         537 AA.
P13597; Q61828;
01-JAN-1990, integrated into UniProtKB/Swiss-Prot.
01-JAN-1990, sequence version 1.
17-JUN-2020, entry version 203.
RecName: Full=Intercellular adhesion molecule 1;
Short=ICAM-1;
AltName: Full=MALA-2;
AltName: Full=MyD10;
AltName: CD_antigen=CD54;
Flags: Precursor;
Name=Icam1; Synonyms=Icam-1;
Mus musculus (Mouse).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
Murinae; Mus; Mus.
NCBI_TaxID=10090;
[1]
NUCLEOTIDE SEQUENCE [MRNA], AND PARTIAL PROTEIN SEQUENCE.
STRAIN=BALB/cJ; TISSUE=Myeloma;
PubMed=2573511; DOI=10.1002/j.1460-2075.1989.tb08437.x;
Horley K.J., Carpenito C., Baker B., Takei F.;
"Molecular cloning of murine intercellular adhesion molecule (ICAM-1).";
EMBO J. 8:2889-2896(1989).
[2]
SEQUENCE REVISION.
Takei F.;
Submitted (APR-1990) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [MRNA].
PubMed=2479693;
Siu G., Hedrick S.M., Brian A.A.;
"Isolation of the murine intercellular adhesion molecule 1 (ICAM-1) gene.
ICAM-1 enhances antigen-specific T cell activation.";
J. Immunol. 143:3813-3820(1989).
[4]
NUCLEOTIDE SEQUENCE [MRNA].
STRAIN=C57BL/6 X CBA; TISSUE=Thymus;
PubMed=2762164; DOI=10.1093/nar/17.14.5853;
Ballantyne C.M., O'Brien W.E., Beaudet A.L.;
"Nucleotide sequence of the cDNA for murine intercellular adhesion
molecule-1 (ICAM-1).";
Nucleic Acids Res. 17:5853-5853(1989).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
STRAIN=NIH Swiss;
PubMed=1362180; DOI=10.1016/s0888-7543(05)80132-6;
Ballantyne C.M., Sligh J.E., Dai X.Y., Beaudet A.L.;
"Characterization of the murine Icam-1 gene.";
Genomics 14:1076-1080(1992).
[6]
NUCLEOTIDE SEQUENCE [MRNA] OF 4-131.
PubMed=1690380;
Lord K.A., Hoffman-Liebermann B., Liebermann D.A.;
"Complexity of the immediate early response of myeloid cells to terminal
differentiation and growth arrest includes ICAM-1, Jun-B and histone
variants.";
Oncogene 5:387-396(1990).
[7]
DISRUPTION PHENOTYPE.
PubMed=9207125; DOI=10.1073/pnas.94.14.7526;
Dong Z.M., Gutierrez-Ramos J.C., Coxon A., Mayadas T.N., Wagner D.D.;
"A new class of obesity genes encodes leukocyte adhesion receptors.";
Proc. Natl. Acad. Sci. U.S.A. 94:7526-7530(1997).
[8]
GLYCOSYLATION AT ASN-47; ASN-185; ASN-204; ASN-267; ASN-311; ASN-362;
ASN-388; ASN-409 AND ASN-456, LACK OF GLYCOSYLATION AT ASN-469 AND ASN-485,
AND IDENTIFICATION BY MASS SPECTROMETRY.
PubMed=16877748; DOI=10.1093/glycob/cwl032;
Otto V.I., Damoc E., Cueni L.N., Schurpf T., Frei R., Ali S.,
Callewaert N., Moise A., Leary J.A., Folkers G., Przybylski M.;
"N-glycan structures and N-glycosylation sites of mouse soluble
intercellular adhesion molecule-1 revealed by MALDI-TOF and FTICR mass
spectrometry.";
Glycobiology 16:1033-1044(2006).
[9]
GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-185; ASN-204; ASN-362; ASN-388;
ASN-409 AND ASN-469.
PubMed=19349973; DOI=10.1038/nbt.1532;
Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M.,
Schiess R., Aebersold R., Watts J.D.;
"Mass-spectrometric identification and relative quantification of N-linked
cell surface glycoproteins.";
Nat. Biotechnol. 27:378-386(2009).
[10]
IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
TISSUE=Heart, Kidney, Liver, Lung, Spleen, and Testis;
PubMed=21183079; DOI=10.1016/j.cell.2010.12.001;
Huttlin E.L., Jedrychowski M.P., Elias J.E., Goswami T., Rad R.,
Beausoleil S.A., Villen J., Haas W., Sowa M.E., Gygi S.P.;
"A tissue-specific atlas of mouse protein phosphorylation and expression.";
Cell 143:1174-1189(2010).
-!- FUNCTION: ICAM proteins are ligands for the leukocyte adhesion protein
LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial
migration, ICAM1 engagement promotes the assembly of endothelial apical
cups through ARHGEF26/SGEF and RHOG activation (By similarity).
{ECO:0000250}.
-!- SUBUNIT: Homodimer. Interacts with MUC1 and promotes cell aggregation
in epithelial cells. Interacts with ARHGEF26/SGEF. Interacts (on T cell
side) with CD81, CD247 and CD9 at immunological synapses between
antigen-presenting cells and T cells. {ECO:0000250|UniProtKB:P05362}.
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1;
IsoId=P13597-1; Sequence=Displayed;
Name=2;
IsoId=P13597-2; Sequence=VSP_002518;
-!- TISSUE SPECIFICITY: Expressed at low level on a subpopulation of
lymphocytes, macrophages, and endothelial cells, but is strongly
induced on these cells, and on fibroblasts and epithelial cells.
-!- PTM: Monoubiquitinated, which is promoted by MARCH9 and leads to
endocytosis. {ECO:0000250}.
-!- DISRUPTION PHENOTYPE: Spontaneous onset of obesity in 16-week old mice
with higher levels of white and brown fat and a slightly heavier liver.
Enhanced susceptibility to high fat diet-induced obesity characterized
by a weight increase and higher levels of white and brown fat.
{ECO:0000269|PubMed:9207125}.
-!- SIMILARITY: Belongs to the immunoglobulin superfamily. ICAM family.
{ECO:0000305}.
-!- WEB RESOURCE: Name=Functional Glycomics Gateway - Glycan Binding;
Note=ICAM-1;
URL="http://www.functionalglycomics.org/glycomics/GBPServlet?&operationType=view&cbpId=cbp_mou_Itlect_288";
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; X16624; CAA34621.1; -; mRNA.
EMBL; X16625; CAA34622.1; -; mRNA.
EMBL; M31585; AAA37876.1; -; mRNA.
EMBL; X52264; CAA36507.1; -; mRNA.
EMBL; M90551; AAA37875.1; -; Genomic_DNA.
EMBL; M90546; AAA37875.1; JOINED; Genomic_DNA.
EMBL; M90547; AAA37875.1; JOINED; Genomic_DNA.
EMBL; M90548; AAA37875.1; JOINED; Genomic_DNA.
EMBL; M90549; AAA37875.1; JOINED; Genomic_DNA.
EMBL; M90550; AAA37875.1; JOINED; Genomic_DNA.
EMBL; X54331; -; NOT_ANNOTATED_CDS; mRNA.
CCDS; CCDS22889.1; -. [P13597-1]
PIR; A45815; A45815.
PIR; I49769; I49769.
PIR; S06016; S06016.
RefSeq; NP_034623.1; NM_010493.3. [P13597-1]
SMR; P13597; -.
DIP; DIP-29096N; -.
IntAct; P13597; 2.
MINT; P13597; -.
STRING; 10090.ENSMUSP00000083587; -.
iPTMnet; P13597; -.
PhosphoSitePlus; P13597; -.
CPTAC; non-CPTAC-3362; -.
jPOST; P13597; -.
PaxDb; P13597; -.
PeptideAtlas; P13597; -.
PRIDE; P13597; -.
Antibodypedia; 795; 2888 antibodies.
Ensembl; ENSMUST00000086399; ENSMUSP00000083587; ENSMUSG00000037405. [P13597-1]
GeneID; 15894; -.
KEGG; mmu:15894; -.
UCSC; uc009ojx.1; mouse. [P13597-1]
CTD; 3383; -.
MGI; MGI:96392; Icam1.
eggNOG; ENOG410IPHM; Eukaryota.
eggNOG; ENOG410YQ1Q; LUCA.
GeneTree; ENSGT00940000162311; -.
HOGENOM; CLU_036160_1_1_1; -.
InParanoid; P13597; -.
KO; K06490; -.
OMA; TFLTVYW; -.
PhylomeDB; P13597; -.
TreeFam; TF333745; -.
Reactome; R-MMU-198933; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell.
Reactome; R-MMU-216083; Integrin cell surface interactions.
BioGRID-ORCS; 15894; 2 hits in 12 CRISPR screens.
ChiTaRS; Icam1; mouse.
PRO; PR:P13597; -.
Proteomes; UP000000589; Chromosome 9.
RNAct; P13597; protein.
Bgee; ENSMUSG00000037405; Expressed in lung and 211 other tissues.
ExpressionAtlas; P13597; baseline and differential.
Genevisible; P13597; MM.
GO; GO:0005623; C:cell; IEA:GOC.
GO; GO:0009986; C:cell surface; ISO:MGI.
GO; GO:0009897; C:external side of plasma membrane; IDA:MGI.
GO; GO:0070062; C:extracellular exosome; ISO:MGI.
GO; GO:0005615; C:extracellular space; ISO:MGI.
GO; GO:0001772; C:immunological synapse; IDA:MGI.
GO; GO:0005887; C:integral component of plasma membrane; IBA:GO_Central.
GO; GO:0005886; C:plasma membrane; ISO:MGI.
GO; GO:0005178; F:integrin binding; ISO:MGI.
GO; GO:0044877; F:protein-containing complex binding; ISO:MGI.
GO; GO:0002438; P:acute inflammatory response to antigenic stimulus; ISO:MGI.
GO; GO:0044406; P:adhesion of symbiont to host; ISO:MGI.
GO; GO:0007155; P:cell adhesion; IDA:MGI.
GO; GO:0033627; P:cell adhesion mediated by integrin; IDA:MGI.
GO; GO:0098609; P:cell-cell adhesion; ISO:MGI.
GO; GO:1904646; P:cellular response to amyloid-beta; ISO:MGI.
GO; GO:0071333; P:cellular response to glucose stimulus; IDA:MGI.
GO; GO:1990830; P:cellular response to leukemia inhibitory factor; IEP:MGI.
GO; GO:0061028; P:establishment of endothelial barrier; ISO:MGI.
GO; GO:0090557; P:establishment of endothelial intestinal barrier; ISO:MGI.
GO; GO:0097368; P:establishment of Sertoli cell barrier; ISO:MGI.
GO; GO:0007159; P:leukocyte cell-cell adhesion; IMP:MGI.
GO; GO:0022614; P:membrane to membrane docking; IEA:Ensembl.
GO; GO:0051926; P:negative regulation of calcium ion transport; ISO:MGI.
GO; GO:2000352; P:negative regulation of endothelial cell apoptotic process; ISO:MGI.
GO; GO:1902042; P:negative regulation of extrinsic apoptotic signaling pathway via death domain receptors; ISO:MGI.
GO; GO:0030838; P:positive regulation of actin filament polymerization; ISO:MGI.
GO; GO:0002693; P:positive regulation of cellular extravasation; ISO:MGI.
GO; GO:0070374; P:positive regulation of ERK1 and ERK2 cascade; ISO:MGI.
GO; GO:0043547; P:positive regulation of GTPase activity; ISO:MGI.
GO; GO:1904996; P:positive regulation of leukocyte adhesion to vascular endothelial cell; ISO:MGI.
GO; GO:0051092; P:positive regulation of NF-kappaB transcription factor activity; ISO:MGI.
GO; GO:0045429; P:positive regulation of nitric oxide biosynthetic process; ISO:MGI.
GO; GO:0050731; P:positive regulation of peptidyl-tyrosine phosphorylation; ISO:MGI.
GO; GO:0045907; P:positive regulation of vasoconstriction; ISO:MGI.
GO; GO:0046813; P:receptor-mediated virion attachment to host cell; ISO:MGI.
GO; GO:0008360; P:regulation of cell shape; ISO:MGI.
GO; GO:1900027; P:regulation of ruffle assembly; IDA:MGI.
GO; GO:0007605; P:sensory perception of sound; ISO:MGI.
GO; GO:0002291; P:T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell; ISO:MGI.
GO; GO:0002457; P:T cell antigen processing and presentation; IDA:MGI.
GO; GO:0072683; P:T cell extravasation; IMP:MGI.
Gene3D; 2.60.40.10; -; 5.
InterPro; IPR003988; ICAM.
InterPro; IPR013768; ICAM_N.
InterPro; IPR003987; ICAM_VCAM_N.
InterPro; IPR007110; Ig-like_dom.
InterPro; IPR036179; Ig-like_dom_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR003599; Ig_sub.
Pfam; PF03921; ICAM_N; 1.
Pfam; PF13895; Ig_2; 1.
PRINTS; PR01473; ICAM.
PRINTS; PR01472; ICAMVCAM1.
SMART; SM00409; IG; 4.
SUPFAM; SSF48726; SSF48726; 5.
PROSITE; PS50835; IG_LIKE; 1.
1: Evidence at protein level;
Alternative splicing; Cell adhesion; Direct protein sequencing;
Disulfide bond; Glycoprotein; Immunoglobulin domain; Membrane;
Reference proteome; Repeat; Signal; Transmembrane; Transmembrane helix;
Ubl conjugation.
SIGNAL 1..27
/evidence="ECO:0000250"
CHAIN 28..537
/note="Intercellular adhesion molecule 1"
/id="PRO_0000014785"
TOPO_DOM 28..485
/note="Extracellular"
/evidence="ECO:0000255"
TRANSMEM 486..509
/note="Helical"
/evidence="ECO:0000255"
TOPO_DOM 510..537
/note="Cytoplasmic"
/evidence="ECO:0000255"
DOMAIN 41..102
/note="Ig-like C2-type 1"
DOMAIN 127..195
/note="Ig-like C2-type 2"
DOMAIN 232..299
/note="Ig-like C2-type 3"
DOMAIN 327..381
/note="Ig-like C2-type 4"
DOMAIN 415..468
/note="Ig-like C2-type 5"
MOTIF 151..153
/note="Cell attachment site; atypical"
/evidence="ECO:0000255"
MOTIF 179..181
/note="Cell attachment site"
/evidence="ECO:0000255"
SITE 469
/note="Not glycosylated"
/evidence="ECO:0000269|PubMed:16877748"
SITE 485
/note="Not glycosylated"
/evidence="ECO:0000269|PubMed:16877748"
CARBOHYD 47
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:16877748"
CARBOHYD 185
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:16877748,
ECO:0000269|PubMed:19349973"
CARBOHYD 204
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:16877748,
ECO:0000269|PubMed:19349973"
CARBOHYD 267
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:16877748"
CARBOHYD 311
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:16877748"
CARBOHYD 362
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:16877748,
ECO:0000269|PubMed:19349973"
CARBOHYD 388
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:16877748,
ECO:0000269|PubMed:19349973"
CARBOHYD 409
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:16877748,
ECO:0000269|PubMed:19349973"
CARBOHYD 456
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:16877748"
CARBOHYD 469
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:19349973"
DISULFID 48..91
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
DISULFID 52..95
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
DISULFID 134..188
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
DISULFID 239..292
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
DISULFID 334..374
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
DISULFID 406..422
/evidence="ECO:0000250|UniProtKB:P05362"
DISULFID 422..461
/evidence="ECO:0000255|PROSITE-ProRule:PRU00114"
DISULFID 434..461
/evidence="ECO:0000250|UniProtKB:P05362"
VAR_SEQ 1..34
/note="MASTRAKPTLPLLLALVTVVIPGPGDAQVSIHPR -> MITHRHPVREKSIN
SYQFIKEKQFPAEN (in isoform 2)"
/evidence="ECO:0000305"
/id="VSP_002518"
CONFLICT 243
/note="G -> A (in Ref. 3; AAA37876)"
/evidence="ECO:0000305"
CONFLICT 370
/note="R -> A (in Ref. 1; CAA34621)"
/evidence="ECO:0000305"
SEQUENCE 537 AA; 58844 MW; 6124167753774555 CRC64;
MASTRAKPTL PLLLALVTVV IPGPGDAQVS IHPREAFLPQ GGSVQVNCSS SCKEDLSLGL
ETQWLKDELE SGPNWKLFEL SEIGEDSSPL CFENCGTVQS SASATITVYS FPESVELRPL
PAWQQVGKDL TLRCHVDGGA PRTQLSAVLL RGEEILSRQP VGGHPKDPKE ITFTVLASRG
DHGANFSCRT ELDLRPQGLA LFSNVSEARS LRTFDLPATI PKLDTPDLLE VGTQQKLFCS
LEGLFPASEA RIYLELGGQM PTQESTNSSD SVSATALVEV TEEFDRTLPL RCVLELADQI
LETQRTLTVY NFSAPVLTLS QLEVSEGSQV TVKCEAHSGS KVVLLSGVEP RPPTPQVQFT
LNASSEDHKR SFFCSAALEV AGKFLFKNQT LELHVLYGPR LDETDCLGNW TWQEGSQQTL
KCQAWGNPSP KMTCRRKADG ALLPIGVVKS VKQEMNGTYV CHAFSSHGNV TRNVYLTVLY
HSQNNWTIII LVPVLLVIVG LVMAASYVYN RQRKIRIYKL QKAQEEAIKL KGQAPPP


Related products :

Catalog number Product name Quantity
U0048m CLIA Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,MALA-2,Mouse,Mus musculus,MyD10 96T
E0048m ELISA kit Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,MALA-2,Mouse,Mus musculus,MyD10 96T
E0048m ELISA Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,MALA-2,Mouse,Mus musculus,MyD10 96T
10-663-45658 Intercellular Adhesion Molecule-1 (ICAM-1) Human - ICAM-1; Major group rhinovirus receptor; CD54 antigen N_A 0.002 mg
10-663-45658 Intercellular Adhesion Molecule-1 (ICAM-1) Human - ICAM-1; Major group rhinovirus receptor; CD54 antigen N_A 0.01 mg
10-663-45658 Intercellular Adhesion Molecule-1 (ICAM-1) Human - ICAM-1; Major group rhinovirus receptor; CD54 antigen N_A 1 mg
CSB-E08898c Dog intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
CSB-E06974Rb rabbit intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
UB-E70147 Canine intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
UB-E70049 Canine intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
UB-E80012 Chicken intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
228-10812-1 Recombinant Human Intercellular Adhesion Molecule-1 (ICAM-1) _ CD54 2
228-10812-2 Recombinant Human Intercellular Adhesion Molecule-1 (ICAM-1) _ CD54 10
UB-E30194 rabbit intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96T
UB-C80012 Chicken Intercellular Adhesion Molecule 1,ICAM-1 CD54 ELISA Kit 96T
KN0117Rb Rabbit intercellular adhesion molecule 1,ICAM-1 per CD54 ELISA Kit 96 WELLS
SL0103Rb Rabbit intercellular adhesion molecule 1,ICAM-1 CD54 ELISA Kit 96T
MD-11-0091 Mouse Anti-Human Intercellular Adhesion Molecule-1 (ICAM-1) _ CD54 200
20-321-175250 CD54. INTRACELLULAR ADHESION MOLECULE-1 (ICAM-1) - BIOTINYLATED MONOCLONAL ANTIBODY TO HUMAN CD54. INTRACELLULAR ADHESION MOLECULE-1 (ICAM-1) Monoclonal 0.05 mg
20-321-175249 CD54. INTRACELLULAR ADHESION MOLECULE-1 (ICAM-1) - MONOCLONAL ANTIBODY TO HUMAN CD54. INTRACELLULAR ADHESION MOLECULE-1 (ICAM-1) Monoclonal 0.1 mg
E0048r ELISA kit Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,Rat,Rattus norvegicus 96T
E0048r ELISA Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,Rat,Rattus norvegicus 96T
U0048r CLIA Icam1,ICAM-1,Icam-1,Intercellular adhesion molecule 1,Rat,Rattus norvegicus 96T
E0533h ELISA CDw50,Homo sapiens,Human,ICAM3,ICAM-3,ICAM-R,Intercellular adhesion molecule 3 96T
E0533h ELISA kit CDw50,Homo sapiens,Human,ICAM3,ICAM-3,ICAM-R,Intercellular adhesion molecule 3 96T
Pathways :
WP2328: Allograft rejection
WP1069: Integrin-mediated cell adhesion
WP1424: Globo Sphingolipid Metabolism
WP188: Focal Adhesion
WP74: Integrin-mediated cell adhesion
WP951: Integrin-mediated cell adhesion
WP1386: Integrin-mediated cell adhesion
WP185: Integrin-mediated cell adhesion
WP1963: The effect of Glucocorticoids on target gene expression
WP6: Integrin-mediated cell adhesion
WP85: Focal Adhesion
WP1185: Integrin-mediated cell adhesion
WP1491: PI3K_AKT_NFKB pathway
WP1883: Platelet Adhesion to exposed collagen
WP306: Focal Adhesion
WP832: Integrin-mediated cell adhesion

Related Genes :
[Ceacam1 Bgp Bgp1] Carcinoembryonic antigen-related cell adhesion molecule 1 (Biliary glycoprotein 1) (BGP-1) (Biliary glycoprotein D) (MHVR1) (Murine hepatitis virus receptor) (MHV-R) (CD antigen CD66a)
[CLEC4M CD209L CD209L1 CD299] C-type lectin domain family 4 member M (CD209 antigen-like protein 1) (DC-SIGN-related protein) (DC-SIGNR) (Dendritic cell-specific ICAM-3-grabbing non-integrin 2) (DC-SIGN2) (Liver/lymph node-specific ICAM-3-grabbing non-integrin) (L-SIGN) (CD antigen CD299)
[ITGAL CD11A] Integrin alpha-L (CD11 antigen-like family member A) (Leukocyte adhesion glycoprotein LFA-1 alpha chain) (LFA-1A) (Leukocyte function-associated molecule 1 alpha chain) (CD antigen CD11a)
[CD209 CLEC4L] CD209 antigen (C-type lectin domain family 4 member L) (Dendritic cell-specific ICAM-3-grabbing non-integrin 1) (DC-SIGN) (DC-SIGN1) (CD antigen CD209)
[Ceacam1] Carcinoembryonic antigen-related cell adhesion molecule 1 (ATP-dependent taurocolate-carrier protein) (Cell-CAM 105) (C-CAM 105) (Ecto-ATPase) (GP110) (pp120) (CD antigen CD66a)
[EPCAM GA733-2 M1S2 M4S1 MIC18 TACSTD1 TROP1] Epithelial cell adhesion molecule (Ep-CAM) (Adenocarcinoma-associated antigen) (Cell surface glycoprotein Trop-1) (Epithelial cell surface antigen) (Epithelial glycoprotein) (EGP) (Epithelial glycoprotein 314) (EGP314) (hEGP314) (KS 1/4 antigen) (KSA) (Major gastrointestinal tumor-associated protein GA733-2) (Tumor-associated calcium signal transducer 1) (CD antigen CD326)
[Cd44 Ly-24] CD44 antigen (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Hermes antigen) (Hyaluronate receptor) (Lymphocyte antigen 24) (Ly-24) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44)
[SELE ELAM1] E-selectin (CD62 antigen-like family member E) (Endothelial leukocyte adhesion molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD antigen CD62E)
[Sele Elam-1] E-selectin (CD62 antigen-like family member E) (Endothelial leukocyte adhesion molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD antigen CD62E)
[Sele Elam-1] E-selectin (CD62 antigen-like family member E) (Endothelial leukocyte adhesion molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD antigen CD62E)
[Sell Lnhr Ly-22] L-selectin (CD62 antigen-like family member L) (Leukocyte adhesion molecule 1) (LAM-1) (Leukocyte-endothelial cell adhesion molecule 1) (LECAM1) (Lymph node homing receptor) (Lymphocyte antigen 22) (Ly-22) (Lymphocyte surface MEL-14 antigen) (CD antigen CD62L)
[SELL LNHR LYAM1] L-selectin (CD62 antigen-like family member L) (Leukocyte adhesion molecule 1) (LAM-1) (Leukocyte surface antigen Leu-8) (Leukocyte-endothelial cell adhesion molecule 1) (LECAM1) (Lymph node homing receptor) (TQ1) (gp90-MEL) (CD antigen CD62L)
[CEACAM1 BGP BGP1] Carcinoembryonic antigen-related cell adhesion molecule 1 (Biliary glycoprotein 1) (BGP-1) (CD antigen CD66a)
[Sell Lnhr Ly-22 Ly22] L-selectin (CD62 antigen-like family member L) (Leukocyte adhesion molecule 1) (LAM-1) (Leukocyte-endothelial cell adhesion molecule 1) (LECAM1) (Lymph node homing receptor) (Lymphocyte antigen 22) (Ly-22) (Lymphocyte surface MEL-14 antigen) (CD antigen CD62L)
[SELE] E-selectin (CD62 antigen-like family member E) (Endothelial leukocyte adhesion molecule 1) (ELAM-1) (Leukocyte-endothelial cell adhesion molecule 2) (LECAM2) (CD antigen CD62E)
[Alcam] CD166 antigen (Activated leukocyte cell adhesion molecule) (HB2) (KG-CAM) (Protein MEMD) (SB-10 antigen) (CD antigen CD166)
[PECAM1] Platelet endothelial cell adhesion molecule (PECAM-1) (EndoCAM) (GPIIA') (PECA1) (CD antigen CD31)
[Alcam] CD166 antigen (Activated leukocyte cell adhesion molecule) (BEN) (Protein DM-GRASP) (CD antigen CD166)
[BCAM LU MSK19] Basal cell adhesion molecule (Auberger B antigen) (B-CAM cell surface glycoprotein) (F8/G253 antigen) (Lutheran antigen) (Lutheran blood group glycoprotein) (CD antigen CD239)
[ALCAM MEMD] CD166 antigen (Activated leukocyte cell adhesion molecule) (CD antigen CD166)
[CD44 LHR MDU2 MDU3 MIC4] CD44 antigen (CDw44) (Epican) (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Heparan sulfate proteoglycan) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44)
[Pecam1 Pecam Pecam-1] Platelet endothelial cell adhesion molecule (PECAM-1) (CD antigen CD31)
[SIRPA BIT MFR MYD1 PTPNS1 SHPS1 SIRP] Tyrosine-protein phosphatase non-receptor type substrate 1 (SHP substrate 1) (SHPS-1) (Brain Ig-like molecule with tyrosine-based activation motifs) (Bit) (CD172 antigen-like family member A) (Inhibitory receptor SHPS-1) (Macrophage fusion receptor) (MyD-1 antigen) (Signal-regulatory protein alpha-1) (Sirp-alpha-1) (Signal-regulatory protein alpha-2) (Sirp-alpha-2) (Signal-regulatory protein alpha-3) (Sirp-alpha-3) (p84) (CD antigen CD172a)
[ITGAM CD11B CR3A] Integrin alpha-M (CD11 antigen-like family member B) (CR-3 alpha chain) (Cell surface glycoprotein MAC-1 subunit alpha) (Leukocyte adhesion receptor MO1) (Neutrophil adherence receptor) (CD antigen CD11b)
[Jam2 Vejam] Junctional adhesion molecule B (JAM-B) (Junctional adhesion molecule 2) (JAM-2) (Vascular endothelial junction-associated molecule) (VE-JAM) (CD antigen CD322)
[JAM2 C21orf43 VEJAM UNQ219/PRO245] Junctional adhesion molecule B (JAM-B) (Junctional adhesion molecule 2) (JAM-2) (Vascular endothelial junction-associated molecule) (VE-JAM) (CD antigen CD322)
[Sirpa Bit Myd1 Ptpns1 Shps1 Sirp] Tyrosine-protein phosphatase non-receptor type substrate 1 (SHP substrate 1) (SHPS-1) (Brain Ig-like molecule with tyrosine-based activation motifs) (Bit) (CD172 antigen-like family member A) (Inhibitory receptor SHPS-1) (MyD-1 antigen) (Signal-regulatory protein alpha-1) (Sirp-alpha-1) (mSIRP-alpha1) (p84) (CD antigen CD172a)
[CD44] CD44 antigen (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HAM1 antigen) (HUTCH-I) (Heparan sulfate proteoglycan) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44)
[Cd44] CD44 antigen (Extracellular matrix receptor III) (ECMR-III) (GP90 lymphocyte homing/adhesion receptor) (HUTCH-I) (Hermes antigen) (Hyaluronate receptor) (Phagocytic glycoprotein 1) (PGP-1) (Phagocytic glycoprotein I) (PGP-I) (CD antigen CD44)
[Itgb2] Integrin beta-2 (Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta) (Complement receptor C3 subunit beta) (CD antigen CD18)

Bibliography :