GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)

 INLR1_HUMAN             Reviewed;         520 AA.
Q8IU57; Q5VTX5; Q5VTX7; Q5VTX8; Q6ZML8; Q8IV66; Q8IZI7; Q8IZI8;
23-NOV-2004, integrated into UniProtKB/Swiss-Prot.
01-MAR-2003, sequence version 1.
13-FEB-2019, entry version 144.
RecName: Full=Interferon lambda receptor 1;
Short=IFN-lambda receptor 1;
Short=IFN-lambda-R1;
AltName: Full=Cytokine receptor class-II member 12;
AltName: Full=Cytokine receptor family 2 member 12;
Short=CRF2-12;
AltName: Full=Interleukin-28 receptor subunit alpha;
Short=IL-28 receptor subunit alpha;
Short=IL-28R-alpha;
Short=IL-28RA;
AltName: Full=Likely interleukin or cytokine receptor 2;
Short=LICR2;
Flags: Precursor;
Name=IFNLR1; Synonyms=IL28RA, LICR2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
Catarrhini; Hominidae; Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), AND FUNCTION.
PubMed=12521379; DOI=10.1042/BJ20021935;
Dumoutier L., Lejeune D., Hor S., Fickenscher H., Renauld J.-C.;
"Cloning of a new type II cytokine receptor activating signal
transducer and activator of transcription (STAT)1, STAT2 and STAT3.";
Biochem. J. 370:391-396(2003).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, TISSUE
SPECIFICITY, AND SUBUNIT.
PubMed=12469119; DOI=10.1038/ni873;
Sheppard P., Kindsvogel W., Xu W., Henderson K., Schlutsmeyer S.,
Whitmore T.E., Kuestner R., Garrigues U., Birks C., Roraback J.,
Ostrander C., Dong D., Shin J., Presnell S., Fox B., Haldeman B.,
Cooper E., Taft D., Gilbert T., Grant F.J., Tackett M., Krivan W.,
McKnight G., Clegg C., Foster D., Klucher K.M.;
"IL-28, IL-29 and their class II cytokine receptor IL-28R.";
Nat. Immunol. 4:63-68(2003).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY,
AND SUBUNIT.
PubMed=12483210; DOI=10.1038/ni875;
Kotenko S.V., Gallagher G., Baurin V.V., Lewis-Antes A., Shen M.,
Shah N.K., Langer J.A., Sheikh F., Dickensheets H., Donnelly R.P.;
"IFN-lambdas mediate antiviral protection through a distinct class II
cytokine receptor complex.";
Nat. Immunol. 4:69-77(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Spleen;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A.,
Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M.,
Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y.,
Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M.,
Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K.,
Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S.,
Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J.,
Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y.,
Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N.,
Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S.,
Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y.,
Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T.,
Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y.,
Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S.,
Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T.,
Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M.,
Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T.,
Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K.,
Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R.,
Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D.,
Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A.,
Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F.,
McDonald L., Evans R., Phillips K., Atkinson A., Cooper R., Jones C.,
Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P.,
Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K.,
Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G.,
Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D.,
Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G.,
Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J.,
Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R.,
Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D.,
Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G.,
Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M.,
Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J.,
Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M.,
Loveland J., Lovell J., Lush M.J., Lyne R., Martin S.,
Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S.,
Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C.,
Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z.,
Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E.,
Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A.,
Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R.,
Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V.,
Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L.,
Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R.,
Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V.,
Hannenhalli S., Turner R., Yooseph S., Lu F., Nusskern D.R.,
Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H.,
Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G.,
Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W.,
Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA
project: the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 19-226 IN COMPLEX WITH
IFNL1, GLYCOSYLATION AT ASN-29; ASN-36 AND ASN-142, AND DISULFIDE
BONDS.
PubMed=20934432; DOI=10.1016/j.jmb.2010.09.068;
Miknis Z.J., Magracheva E., Li W., Zdanov A., Kotenko S.V.,
Wlodawer A.;
"Crystal structure of human interferon-lambda1 in complex with its
high-affinity receptor interferon-lambdaR1.";
J. Mol. Biol. 404:650-664(2010).
-!- FUNCTION: The IFNLR1/IL10RB dimer is a receptor for the cytokine
ligands IFNL2 and IFNL3 and mediates their antiviral activity. The
ligand/receptor complex stimulate the activation of the JAK/STAT
signaling pathway leading to the expression of IFN-stimulated
genes (ISG), which contribute to the antiviral state. Determines
the cell type specificity of the lambda interferon action. Shows a
more restricted pattern of expression in the epithelial tissues
thereby limiting responses to lambda interferons primarily to
epithelial cells of the respiratory, gastrointestinal, and
reproductive tracts. Seems not to be essential for early virus-
activated host defense in vaginal infection, but plays an
important role in Toll-like receptor (TLR)-induced antiviral
defense. Plays a significant role in the antiviral immune defense
in the intestinal epithelium. {ECO:0000269|PubMed:12469119,
ECO:0000269|PubMed:12483210, ECO:0000269|PubMed:12521379}.
-!- SUBUNIT: Heterodimer with IL10RB. {ECO:0000269|PubMed:12469119,
ECO:0000269|PubMed:12483210, ECO:0000269|PubMed:20934432}.
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000250}; Single-pass type I
membrane protein {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1; Synonyms=IL-28R-alpha-v1;
IsoId=Q8IU57-1; Sequence=Displayed;
Name=2; Synonyms=IL-28R-alpha-v2;
IsoId=Q8IU57-2; Sequence=VSP_011890;
Name=3; Synonyms=IL-28R-alpha-v3;
IsoId=Q8IU57-3; Sequence=VSP_011888, VSP_011889, VSP_011892;
Name=4; Synonyms=Secreted;
IsoId=Q8IU57-4; Sequence=VSP_011891, VSP_011892;
-!- TISSUE SPECIFICITY: Widely expressed.
{ECO:0000269|PubMed:12469119, ECO:0000269|PubMed:12483210}.
-!- SIMILARITY: Belongs to the type II cytokine receptor family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAD18707.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
-----------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
-----------------------------------------------------------------------
EMBL; AJ534330; CAD58829.1; -; mRNA.
EMBL; AJ534331; CAD58830.1; -; mRNA.
EMBL; AY129151; AAN28266.1; -; mRNA.
EMBL; AY129152; AAN28267.1; -; mRNA.
EMBL; AY129153; AAN28268.1; -; mRNA.
EMBL; AF439325; AAN63632.1; -; mRNA.
EMBL; AK160364; BAD18707.1; ALT_INIT; mRNA.
EMBL; AL590683; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471134; EAW95114.1; -; Genomic_DNA.
EMBL; CH471134; EAW95115.1; -; Genomic_DNA.
EMBL; CH471134; EAW95117.1; -; Genomic_DNA.
EMBL; CH471134; EAW95118.1; -; Genomic_DNA.
EMBL; BC140872; AAI40873.1; -; mRNA.
CCDS; CCDS248.1; -. [Q8IU57-1]
CCDS; CCDS249.1; -. [Q8IU57-2]
CCDS; CCDS250.1; -. [Q8IU57-4]
RefSeq; NP_734464.1; NM_170743.3. [Q8IU57-1]
RefSeq; NP_775087.1; NM_173064.2. [Q8IU57-2]
RefSeq; NP_775088.1; NM_173065.2. [Q8IU57-4]
UniGene; Hs.221375; -.
PDB; 3OG4; X-ray; 2.16 A; B=19-226.
PDB; 3OG6; X-ray; 2.10 A; B=19-226.
PDB; 5IXD; X-ray; 2.85 A; B=250-299.
PDB; 5IXI; X-ray; 2.57 A; B=250-259.
PDB; 5L04; X-ray; 2.10 A; B=260-307.
PDB; 5T5W; X-ray; 2.85 A; B=21-226.
PDBsum; 3OG4; -.
PDBsum; 3OG6; -.
PDBsum; 5IXD; -.
PDBsum; 5IXI; -.
PDBsum; 5L04; -.
PDBsum; 5T5W; -.
ProteinModelPortal; Q8IU57; -.
SMR; Q8IU57; -.
BioGrid; 127873; 31.
DIP; DIP-31197N; -.
IntAct; Q8IU57; 4.
STRING; 9606.ENSP00000327824; -.
ChEMBL; CHEMBL3831284; -.
iPTMnet; Q8IU57; -.
PhosphoSitePlus; Q8IU57; -.
BioMuta; IFNLR1; -.
DMDM; 55976528; -.
PaxDb; Q8IU57; -.
PeptideAtlas; Q8IU57; -.
PRIDE; Q8IU57; -.
ProteomicsDB; 70505; -.
ProteomicsDB; 70506; -. [Q8IU57-2]
ProteomicsDB; 70507; -. [Q8IU57-3]
ProteomicsDB; 70508; -. [Q8IU57-4]
Ensembl; ENST00000327535; ENSP00000327824; ENSG00000185436. [Q8IU57-1]
Ensembl; ENST00000327575; ENSP00000328994; ENSG00000185436. [Q8IU57-4]
Ensembl; ENST00000374418; ENSP00000363539; ENSG00000185436. [Q8IU57-3]
Ensembl; ENST00000374421; ENSP00000363542; ENSG00000185436. [Q8IU57-2]
GeneID; 163702; -.
KEGG; hsa:163702; -.
UCSC; uc001bir.4; human. [Q8IU57-1]
CTD; 163702; -.
DisGeNET; 163702; -.
EuPathDB; HostDB:ENSG00000185436.11; -.
GeneCards; IFNLR1; -.
HGNC; HGNC:18584; IFNLR1.
HPA; HPA017319; -.
MIM; 607404; gene.
neXtProt; NX_Q8IU57; -.
OpenTargets; ENSG00000185436; -.
PharmGKB; PA134984880; -.
eggNOG; ENOG410IJDQ; Eukaryota.
eggNOG; ENOG410YYBX; LUCA.
GeneTree; ENSGT00510000048978; -.
HOGENOM; HOG000148579; -.
HOVERGEN; HBG052069; -.
InParanoid; Q8IU57; -.
KO; K05140; -.
OMA; LTFCWDS; -.
OrthoDB; 577004at2759; -.
PhylomeDB; Q8IU57; -.
TreeFam; TF336003; -.
Reactome; R-HSA-449836; Other interleukin signaling.
Reactome; R-HSA-8854691; Interleukin-20 family signaling.
SignaLink; Q8IU57; -.
SIGNOR; Q8IU57; -.
ChiTaRS; IFNLR1; human.
GeneWiki; Interleukin_28_receptor,_alpha_subunit; -.
GenomeRNAi; 163702; -.
PRO; PR:Q8IU57; -.
Proteomes; UP000005640; Chromosome 1.
Bgee; ENSG00000185436; Expressed in 135 organ(s), highest expression level in vagina.
ExpressionAtlas; Q8IU57; baseline and differential.
Genevisible; Q8IU57; HS.
GO; GO:0016021; C:integral component of membrane; NAS:UniProtKB.
GO; GO:0032002; C:interleukin-28 receptor complex; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; IBA:GO_Central.
GO; GO:0004896; F:cytokine receptor activity; IBA:GO_Central.
GO; GO:0019221; P:cytokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0051607; P:defense response to virus; ISS:UniProtKB.
GO; GO:0002385; P:mucosal immune response; ISS:UniProtKB.
GO; GO:0008285; P:negative regulation of cell population proliferation; NAS:UniProtKB.
GO; GO:0050691; P:regulation of defense response to virus by host; IDA:UniProtKB.
GO; GO:0034342; P:response to type III interferon; ISS:UniProtKB.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR003961; FN3_dom.
InterPro; IPR036116; FN3_sf.
InterPro; IPR013783; Ig-like_fold.
Pfam; PF01108; Tissue_fac; 1.
SUPFAM; SSF49265; SSF49265; 2.
PROSITE; PS50853; FN3; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Antiviral defense;
Complete proteome; Disulfide bond; Glycoprotein; Membrane; Receptor;
Reference proteome; Signal; Transmembrane; Transmembrane helix.
SIGNAL 1 20 {ECO:0000255}.
CHAIN 21 520 Interferon lambda receptor 1.
/FTId=PRO_0000011019.
TOPO_DOM 21 228 Extracellular. {ECO:0000255}.
TRANSMEM 229 249 Helical. {ECO:0000255}.
TOPO_DOM 250 520 Cytoplasmic. {ECO:0000255}.
DOMAIN 26 126 Fibronectin type-III.
{ECO:0000255|PROSITE-ProRule:PRU00316}.
CARBOHYD 29 29 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:20934432}.
CARBOHYD 36 36 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:20934432}.
CARBOHYD 142 142 N-linked (GlcNAc...) asparagine.
{ECO:0000269|PubMed:20934432}.
CARBOHYD 169 169 N-linked (GlcNAc...) asparagine.
{ECO:0000255}.
DISULFID 74 82 {ECO:0000269|PubMed:20934432}.
DISULFID 86 150 {ECO:0000269|PubMed:20934432}.
DISULFID 195 217 {ECO:0000269|PubMed:20934432}.
VAR_SEQ 171 211 TLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSK
-> VGSSFPAPRLGPLLHPFLLRFFSPSQPAPAPLLQEVFP
VHS (in isoform 3).
{ECO:0000303|PubMed:12469119}.
/FTId=VSP_011888.
VAR_SEQ 212 244 Missing (in isoform 3).
{ECO:0000303|PubMed:12469119}.
/FTId=VSP_011889.
VAR_SEQ 224 244 EANWAFLVLPSLLILLLVIAA -> GLFWTHTPCGNLSAQQ
TRVRE (in isoform 4).
{ECO:0000303|PubMed:12521379}.
/FTId=VSP_011891.
VAR_SEQ 245 520 Missing (in isoform 3 and isoform 4).
{ECO:0000303|PubMed:12469119,
ECO:0000303|PubMed:12521379}.
/FTId=VSP_011892.
VAR_SEQ 268 296 Missing (in isoform 2).
{ECO:0000303|PubMed:12469119}.
/FTId=VSP_011890.
STRAND 28 35 {ECO:0000244|PDB:3OG6}.
STRAND 38 44 {ECO:0000244|PDB:3OG6}.
STRAND 54 60 {ECO:0000244|PDB:3OG6}.
HELIX 63 65 {ECO:0000244|PDB:3OG4}.
STRAND 68 70 {ECO:0000244|PDB:3OG6}.
HELIX 72 74 {ECO:0000244|PDB:3OG6}.
STRAND 75 77 {ECO:0000244|PDB:5T5W}.
STRAND 79 83 {ECO:0000244|PDB:3OG6}.
STRAND 98 104 {ECO:0000244|PDB:3OG6}.
HELIX 119 122 {ECO:0000244|PDB:3OG6}.
STRAND 129 135 {ECO:0000244|PDB:3OG6}.
STRAND 138 144 {ECO:0000244|PDB:3OG6}.
STRAND 156 164 {ECO:0000244|PDB:3OG6}.
STRAND 170 172 {ECO:0000244|PDB:3OG4}.
STRAND 180 185 {ECO:0000244|PDB:3OG6}.
STRAND 192 209 {ECO:0000244|PDB:3OG6}.
STRAND 216 219 {ECO:0000244|PDB:3OG6}.
HELIX 256 258 {ECO:0000244|PDB:5IXI}.
HELIX 265 267 {ECO:0000244|PDB:5L04}.
STRAND 277 279 {ECO:0000244|PDB:5L04}.
STRAND 291 294 {ECO:0000244|PDB:5L04}.
SEQUENCE 520 AA; 57653 MW; CEDAEE57F85D69AC CRC64;
MAGPERWGPL LLCLLQAAPG RPRLAPPQNV TLLSQNFSVY LTWLPGLGNP QDVTYFVAYQ
SSPTRRRWRE VEECAGTKEL LCSMMCLKKQ DLYNKFKGRV RTVSPSSKSP WVESEYLDYL
FEVEPAPPVL VLTQTEEILS ANATYQLPPC MPPLDLKYEV AFWKEGAGNK TLFPVTPHGQ
PVQITLQPAA SEHHCLSART IYTFSVPKYS KFSKPTCFLL EVPEANWAFL VLPSLLILLL
VIAAGGVIWK TLMGNPWFQR AKMPRALDFS GHTHPVATFQ PSRPESVNDL FLCPQKELTR
GVRPTPRVRA PATQQTRWKK DLAEDEEEED EEDTEDGVSF QPYIEPPSFL GQEHQAPGHS
EAGGVDSGRP RAPLVPSEGS SAWDSSDRSW ASTVDSSWDR AGSSGYLAEK GPGQGPGGDG
HQESLPPPEF SKDSGFLEEL PEDNLSSWAT WGTLPPEPNL VPGGPPVSLQ TLTFCWESSP
EEEEEARESE IEDSDAGSWG AESTQRTEDR GRTLGHYMAR


Related products :

Catalog number Product name Quantity
E1425h ELISA kit CRF2-1,Cytokine receptor class-II member 1,Cytokine receptor family 2 member 1,Homo sapiens,Human,IFN-alpha_beta receptor 1,IFNAR,IFNAR1,IFN-R-1,Interferon alpha_beta receptor 1,Type I inte 96T
E1425h ELISA CRF2-1,Cytokine receptor class-II member 1,Cytokine receptor family 2 member 1,Homo sapiens,Human,IFN-alpha_beta receptor 1,IFNAR,IFNAR1,IFN-R-1,Interferon alpha_beta receptor 1,Type I interfero 96T
U1425h CLIA CRF2-1,Cytokine receptor class-II member 1,Cytokine receptor family 2 member 1,Homo sapiens,Human,IFN-alpha_beta receptor 1,IFNAR,IFNAR1,IFN-R-1,Interferon alpha_beta receptor 1,Type I interferon 96T
EIAAB09420 Crlf2,Crlm2,CRLM-2,Cytokine receptor-like factor 2,Cytokine receptor-like molecule 2,Mouse,Mus musculus,Thymic stromal lymphopoietin protein receptor,Tpte2,TSLP receptor,Tslpr,Type I cytokine receptor
orb82616 Human IL29 protein IL28A, IL28B, and IL29, also named interferon lambda2 (IFN lambda 2), IFN lambda 3, and IFN lambda 1, respectively, are newly identified class II cytokine receptor ligands that are 5
IL2RA IL28RA Gene interleukin 28 receptor, alpha (interferon, lambda receptor)
ARP48069_P050 IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) 50 µg
EIAAB09422 CREME9,CREME-9,CRLF3,Cytokine receptor-like factor 3,Cytokine receptor-like molecule 9,Cytokine receptor-related protein 4,CYTOR4,Homo sapiens,Human,P48,Type I cytokine receptor-like factor p48
U0065r CLIA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norvegi 96T
E0065r ELISA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norveg 96T
U0065m CLIA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus muscu 96T
E0065m ELISA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus musc 96T
E0065m ELISA kit CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus 96T
E0065r ELISA kit CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus n 96T
18-661-15120 Interleukin-27 receptor alpha chain - IL-27R-alpha; WSX-1; Type I T-cell cytokine receptor; TCCR; Protein CRL1 Polyclonal 0.1 mg
18-661-15121 Interleukin-27 receptor alpha chain - IL-27R-alpha; WSX-1; Type I T-cell cytokine receptor; TCCR; Protein CRL1 Polyclonal 0.1 mg
EIAAB09419 CRL2,CRLF2,Cytokine receptor-like 2,Cytokine receptor-like factor 2,Homo sapiens,Human,ILXR,IL-XR,Thymic stromal lymphopoietin protein receptor,TSLP receptor,TSLPR
CSB-EL011647MO Mouse interleukin 28 receptor, alpha (interferon, lambda receptor) (IL28RA) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL011647HU Human interleukin 28 receptor, alpha (interferon, lambda receptor) (IL28RA) ELISA kit, Species Human, Sample Type serum, plasma 96T
E0065h ELISA kit CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 r 96T
U0065h CLIA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recepto 96T
E0065h ELISA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recept 96T
EIAAB09417 CLF-1,Crlf1,Crlm3,CRLM-3,Cytokine receptor-like factor 1,Cytokine receptor-like molecule 3,Cytokine-like factor 1,Mouse,Mus musculus,Novel cytokine receptor 6,NR6
U1815h CLIA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T

Kits Elisa; taq POLYMERASE

Search in Google:

google

Share this page:
share on twitter rss feedsfacebookgoogle gentaur



Quick order!
Enter catalog number :


Gentaur; yes we can

Pathways :
WP2292: Chemokine signaling pathway
WP1963: The effect of Glucocorticoids on target gene expression
WP566: canonical wnt - zebrafish
WP2272: Pathogenic Escherichia coli infection
WP2328: Allograft rejection
WP1004: Kit Receptor Signaling Pathway
WP1011: T Cell Receptor Signaling Pathway
WP1014: Androgen receptor signaling pathway
WP1025: B Cell Receptor Signaling Pathway
WP1045: TGF-beta Receptor Signaling Pathway
WP1046: Signaling of Hepatocyte Growth Factor Receptor
WP1067: Toll-like receptor signaling pathway
WP1112: EPO Receptor Signaling
WP1121: Kit Receptor Signaling Pathway
WP1130: T Cell Receptor Signaling Pathway
WP1133: Androgen receptor signaling pathway
WP1144: B Cell Receptor Signaling Pathway
WP1161: TGF-beta Receptor Signaling Pathway
WP1162: Signaling of Hepatocyte Growth Factor Receptor
WP1183: Toll-like receptor signaling pathway
WP1206: Signaling of Hepatocyte Growth Factor Receptor
WP1235: Signaling of Hepatocyte Growth Factor Receptor
WP1249: EPO Receptor Signaling
WP1271: Toll-like receptor signaling pathway
WP1284: EPO Receptor Signaling

Related Genes :
[IFNLR1 IL28RA LICR2] Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)
[IL10RB CRFB4 D21S58 D21S66] Interleukin-10 receptor subunit beta (IL-10 receptor subunit beta) (IL-10R subunit beta) (IL-10RB) (Cytokine receptor class-II member 4) (Cytokine receptor family 2 member 4) (CRF2-4) (Interleukin-10 receptor subunit 2) (IL-10R subunit 2) (IL-10R2) (CD antigen CDw210b)
[IL1R1 IL1R IL1RA IL1RT1] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[Il1r1 Il-1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL18R1 IL1RRP] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[Il1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[Il18r1] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (CD218 antigen-like family member A) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[IFNL3 IL28B IL28C ZCYTO22] Interferon lambda-3 (IFN-lambda-3) (Cytokine Zcyto22) (Interleukin-28B) (IL-28B) (Interleukin-28C) (IL-28C)
[IL10RA IL10R] Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)
[IL27RA CRL1 TCCR WSX1 UNQ296/PRO336] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Cytokine receptor WSX-1) (Cytokine receptor-like 1) (Type I T-cell cytokine receptor) (TCCR) (ZcytoR1)
[IFNL1 IL29 ZCYTO21] Interferon lambda-1 (IFN-lambda-1) (Cytokine Zcyto21) (Interleukin-29) (IL-29)
[IL6R] Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126)
[IL31RA CRL3 GPL UNQ6368/PRO21073/PRO21384] Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)
[Il11ra1 Etl2 Il11ra] Interleukin-11 receptor subunit alpha-1 (IL-11 receptor subunit alpha-1) (IL-11R subunit alpha-1) (IL-11R-alpha-1) (IL-11RA1) (Enhancer trap locus homolog 2) (Etl-2) (Novel cytokine receptor 1) (NR-1) (NR1)
[IL18RAP IL1R7] Interleukin-18 receptor accessory protein (IL-18 receptor accessory protein) (IL-18RAcP) (Accessory protein-like) (AcPL) (CD218 antigen-like family member B) (CDw218b) (IL-1R accessory protein-like) (IL-1RAcPL) (Interleukin-1 receptor 7) (IL-1R-7) (IL-1R7) (Interleukin-18 receptor accessory protein-like) (Interleukin-18 receptor beta) (IL-18R-beta) (IL-18Rbeta) (CD antigen CD218b)
[IL12RB1 IL12R IL12RB] Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12RB1) (IL-12 receptor beta component) (CD antigen CD212)
[IL2RG] Cytokine receptor common subunit gamma (Interleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132)
[IL12RB2] Interleukin-12 receptor subunit beta-2 (IL-12 receptor subunit beta-2) (IL-12R subunit beta-2) (IL-12R-beta-2) (IL-12RB2)
[IL4R IL4RA 582J2.1] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il27ra Tccr Wsx1] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Type I T-cell cytokine receptor) (TCCR) (WSX-1)
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il12rb2] Interleukin-12 receptor subunit beta-2 (IL-12 receptor subunit beta-2) (IL-12R subunit beta-2) (IL-12R-beta-2) (IL-12RB2)
[Il12rb1 Il12rb] Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12 receptor beta component) (CD antigen CD212)
[Il3ra Sut-1] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (Interleukin-3 receptor class II alpha chain) (CD antigen CD123)
[IL15RA] Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]
[Il2rg] Cytokine receptor common subunit gamma (Interleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132)
[IL13RA2 IL13R] Interleukin-13 receptor subunit alpha-2 (IL-13 receptor subunit alpha-2) (IL-13R subunit alpha-2) (IL-13R-alpha-2) (IL-13RA2) (Interleukin-13-binding protein) (CD antigen CD213a2)
[IFNGR1] Interferon gamma receptor 1 (IFN-gamma receptor 1) (IFN-gamma-R1) (CDw119) (Interferon gamma receptor alpha-chain) (IFN-gamma-R-alpha) (CD antigen CD119)
[IL13RA1 IL13R IL13RA] Interleukin-13 receptor subunit alpha-1 (IL-13 receptor subunit alpha-1) (IL-13R subunit alpha-1) (IL-13R-alpha-1) (IL-13RA1) (Cancer/testis antigen 19) (CT19) (CD antigen CD213a1)
[IL17RB CRL4 EVI27 IL17BR UNQ2501/PRO19612] Interleukin-17 receptor B (IL-17 receptor B) (IL-17RB) (Cytokine receptor-like 4) (IL-17 receptor homolog 1) (IL-17Rh1) (IL17Rh1) (Interleukin-17B receptor) (IL-17B receptor)

Bibliography :