GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)

 INLR1_HUMAN             Reviewed;         520 AA.
Q8IU57; Q5VTX5; Q5VTX7; Q5VTX8; Q6ZML8; Q8IV66; Q8IZI7; Q8IZI8;
23-NOV-2004, integrated into UniProtKB/Swiss-Prot.
01-MAR-2003, sequence version 1.
12-AUG-2020, entry version 154.
RecName: Full=Interferon lambda receptor 1;
Short=IFN-lambda receptor 1;
Short=IFN-lambda-R1;
AltName: Full=Cytokine receptor class-II member 12;
AltName: Full=Cytokine receptor family 2 member 12;
Short=CRF2-12;
AltName: Full=Interleukin-28 receptor subunit alpha;
Short=IL-28 receptor subunit alpha;
Short=IL-28R-alpha;
Short=IL-28RA;
AltName: Full=Likely interleukin or cytokine receptor 2;
Short=LICR2;
Flags: Precursor;
Name=IFNLR1; Synonyms=IL28RA, LICR2;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 4), AND FUNCTION.
PubMed=12521379; DOI=10.1042/bj20021935;
Dumoutier L., Lejeune D., Hor S., Fickenscher H., Renauld J.-C.;
"Cloning of a new type II cytokine receptor activating signal transducer
and activator of transcription (STAT)1, STAT2 and STAT3.";
Biochem. J. 370:391-396(2003).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, TISSUE
SPECIFICITY, AND SUBUNIT.
PubMed=12469119; DOI=10.1038/ni873;
Sheppard P., Kindsvogel W., Xu W., Henderson K., Schlutsmeyer S.,
Whitmore T.E., Kuestner R., Garrigues U., Birks C., Roraback J.,
Ostrander C., Dong D., Shin J., Presnell S., Fox B., Haldeman B.,
Cooper E., Taft D., Gilbert T., Grant F.J., Tackett M., Krivan W.,
McKnight G., Clegg C., Foster D., Klucher K.M.;
"IL-28, IL-29 and their class II cytokine receptor IL-28R.";
Nat. Immunol. 4:63-68(2003).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, AND
SUBUNIT.
PubMed=12483210; DOI=10.1038/ni875;
Kotenko S.V., Gallagher G., Baurin V.V., Lewis-Antes A., Shen M.,
Shah N.K., Langer J.A., Sheikh F., Dickensheets H., Donnelly R.P.;
"IFN-lambdas mediate antiviral protection through a distinct class II
cytokine receptor complex.";
Nat. Immunol. 4:69-77(2003).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Spleen;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16710414; DOI=10.1038/nature04727;
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A.,
Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C.,
Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.,
Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C.,
Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W.,
Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J.,
Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J.,
Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y.,
Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J.,
Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H.,
Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L.,
Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J.,
Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S.,
Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K.,
Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R.,
Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M.,
Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S.,
Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J.,
Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W.,
McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N.,
Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V.,
Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J.,
Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E.,
Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S.,
Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M.,
White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H.,
Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E.,
Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G.,
Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.;
"The DNA sequence and biological annotation of human chromosome 1.";
Nature 441:315-321(2006).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
Hunkapiller M.W., Myers E.W., Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
X-RAY CRYSTALLOGRAPHY (2.10 ANGSTROMS) OF 19-226 IN COMPLEX WITH IFNL1,
GLYCOSYLATION AT ASN-29; ASN-36 AND ASN-142, AND DISULFIDE BONDS.
PubMed=20934432; DOI=10.1016/j.jmb.2010.09.068;
Miknis Z.J., Magracheva E., Li W., Zdanov A., Kotenko S.V., Wlodawer A.;
"Crystal structure of human interferon-lambda1 in complex with its high-
affinity receptor interferon-lambdaR1.";
J. Mol. Biol. 404:650-664(2010).
-!- FUNCTION: The IFNLR1/IL10RB dimer is a receptor for the cytokine
ligands IFNL2 and IFNL3 and mediates their antiviral activity. The
ligand/receptor complex stimulate the activation of the JAK/STAT
signaling pathway leading to the expression of IFN-stimulated genes
(ISG), which contribute to the antiviral state. Determines the cell
type specificity of the lambda interferon action. Shows a more
restricted pattern of expression in the epithelial tissues thereby
limiting responses to lambda interferons primarily to epithelial cells
of the respiratory, gastrointestinal, and reproductive tracts. Seems
not to be essential for early virus-activated host defense in vaginal
infection, but plays an important role in Toll-like receptor (TLR)-
induced antiviral defense. Plays a significant role in the antiviral
immune defense in the intestinal epithelium.
{ECO:0000269|PubMed:12469119, ECO:0000269|PubMed:12483210,
ECO:0000269|PubMed:12521379}.
-!- SUBUNIT: Heterodimer with IL10RB. {ECO:0000269|PubMed:12469119,
ECO:0000269|PubMed:12483210, ECO:0000269|PubMed:20934432}.
-!- INTERACTION:
Q8IU57; Q86W74-2: ANKRD46; NbExp=3; IntAct=EBI-373215, EBI-12109402;
Q8IU57; Q6PL45-2: BRICD5; NbExp=3; IntAct=EBI-373215, EBI-12244618;
Q8IU57; Q4LDR2: CTXN3; NbExp=3; IntAct=EBI-373215, EBI-12019274;
Q8IU57; P09466: PAEP; NbExp=3; IntAct=EBI-373215, EBI-465167;
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000250}; Single-pass type I
membrane protein {ECO:0000250}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=4;
Name=1; Synonyms=IL-28R-alpha-v1;
IsoId=Q8IU57-1; Sequence=Displayed;
Name=2; Synonyms=IL-28R-alpha-v2;
IsoId=Q8IU57-2; Sequence=VSP_011890;
Name=3; Synonyms=IL-28R-alpha-v3;
IsoId=Q8IU57-3; Sequence=VSP_011888, VSP_011889, VSP_011892;
Name=4; Synonyms=Secreted;
IsoId=Q8IU57-4; Sequence=VSP_011891, VSP_011892;
-!- TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:12469119,
ECO:0000269|PubMed:12483210}.
-!- SIMILARITY: Belongs to the type II cytokine receptor family.
{ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAD18707.1; Type=Erroneous initiation; Note=Extended N-terminus.; Evidence={ECO:0000305};
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; AJ534330; CAD58829.1; -; mRNA.
EMBL; AJ534331; CAD58830.1; -; mRNA.
EMBL; AY129151; AAN28266.1; -; mRNA.
EMBL; AY129152; AAN28267.1; -; mRNA.
EMBL; AY129153; AAN28268.1; -; mRNA.
EMBL; AF439325; AAN63632.1; -; mRNA.
EMBL; AK160364; BAD18707.1; ALT_INIT; mRNA.
EMBL; AL590683; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471134; EAW95114.1; -; Genomic_DNA.
EMBL; CH471134; EAW95115.1; -; Genomic_DNA.
EMBL; CH471134; EAW95117.1; -; Genomic_DNA.
EMBL; CH471134; EAW95118.1; -; Genomic_DNA.
EMBL; BC140872; AAI40873.1; -; mRNA.
CCDS; CCDS248.1; -. [Q8IU57-1]
CCDS; CCDS249.1; -. [Q8IU57-2]
CCDS; CCDS250.1; -. [Q8IU57-4]
RefSeq; NP_734464.1; NM_170743.3. [Q8IU57-1]
RefSeq; NP_775087.1; NM_173064.2. [Q8IU57-2]
RefSeq; NP_775088.1; NM_173065.2. [Q8IU57-4]
PDB; 3OG4; X-ray; 2.16 A; B=19-226.
PDB; 3OG6; X-ray; 2.10 A; B=19-226.
PDB; 5IXD; X-ray; 2.85 A; B=250-299.
PDB; 5IXI; X-ray; 2.57 A; B=250-259.
PDB; 5L04; X-ray; 2.10 A; B=260-307.
PDB; 5T5W; X-ray; 2.85 A; B=21-226.
PDBsum; 3OG4; -.
PDBsum; 3OG6; -.
PDBsum; 5IXD; -.
PDBsum; 5IXI; -.
PDBsum; 5L04; -.
PDBsum; 5T5W; -.
SMR; Q8IU57; -.
BioGRID; 127873; 33.
DIP; DIP-31197N; -.
IntAct; Q8IU57; 6.
STRING; 9606.ENSP00000327824; -.
ChEMBL; CHEMBL3831284; -.
GlyGen; Q8IU57; 4 sites.
iPTMnet; Q8IU57; -.
PhosphoSitePlus; Q8IU57; -.
BioMuta; IFNLR1; -.
DMDM; 55976528; -.
PaxDb; Q8IU57; -.
PeptideAtlas; Q8IU57; -.
PRIDE; Q8IU57; -.
ProteomicsDB; 70505; -. [Q8IU57-1]
ProteomicsDB; 70506; -. [Q8IU57-2]
ProteomicsDB; 70507; -. [Q8IU57-3]
ProteomicsDB; 70508; -. [Q8IU57-4]
ABCD; Q8IU57; 4 sequenced antibodies.
Antibodypedia; 2700; 257 antibodies.
Ensembl; ENST00000327535; ENSP00000327824; ENSG00000185436. [Q8IU57-1]
Ensembl; ENST00000327575; ENSP00000328994; ENSG00000185436. [Q8IU57-4]
Ensembl; ENST00000374418; ENSP00000363539; ENSG00000185436. [Q8IU57-3]
Ensembl; ENST00000374421; ENSP00000363542; ENSG00000185436. [Q8IU57-2]
GeneID; 163702; -.
KEGG; hsa:163702; -.
UCSC; uc001bir.4; human. [Q8IU57-1]
CTD; 163702; -.
DisGeNET; 163702; -.
EuPathDB; HostDB:ENSG00000185436.11; -.
GeneCards; IFNLR1; -.
HGNC; HGNC:18584; IFNLR1.
HPA; ENSG00000185436; Low tissue specificity.
MIM; 607404; gene.
neXtProt; NX_Q8IU57; -.
OpenTargets; ENSG00000185436; -.
PharmGKB; PA134984880; -.
eggNOG; ENOG502S4B0; Eukaryota.
GeneTree; ENSGT00510000048978; -.
HOGENOM; CLU_043104_1_0_1; -.
InParanoid; Q8IU57; -.
KO; K05140; -.
OMA; PEANWAF; -.
OrthoDB; 577004at2759; -.
PhylomeDB; Q8IU57; -.
TreeFam; TF336003; -.
PathwayCommons; Q8IU57; -.
Reactome; R-HSA-449836; Other interleukin signaling.
Reactome; R-HSA-8854691; Interleukin-20 family signaling.
SignaLink; Q8IU57; -.
SIGNOR; Q8IU57; -.
BioGRID-ORCS; 163702; 66 hits in 869 CRISPR screens.
ChiTaRS; IFNLR1; human.
GeneWiki; Interleukin_28_receptor,_alpha_subunit; -.
GenomeRNAi; 163702; -.
Pharos; Q8IU57; Tbio.
PRO; PR:Q8IU57; -.
Proteomes; UP000005640; Chromosome 1.
RNAct; Q8IU57; protein.
Bgee; ENSG00000185436; Expressed in cerebellar vermis and 158 other tissues.
ExpressionAtlas; Q8IU57; baseline and differential.
Genevisible; Q8IU57; HS.
GO; GO:0016021; C:integral component of membrane; IBA:GO_Central.
GO; GO:0032002; C:interleukin-28 receptor complex; IDA:UniProtKB.
GO; GO:0005886; C:plasma membrane; IBA:GO_Central.
GO; GO:0004896; F:cytokine receptor activity; IBA:GO_Central.
GO; GO:0019221; P:cytokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0051607; P:defense response to virus; ISS:UniProtKB.
GO; GO:0002385; P:mucosal immune response; ISS:UniProtKB.
GO; GO:0008285; P:negative regulation of cell population proliferation; NAS:UniProtKB.
GO; GO:0050691; P:regulation of defense response to virus by host; IDA:UniProtKB.
GO; GO:0034342; P:response to type III interferon; ISS:UniProtKB.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR003961; FN3_dom.
InterPro; IPR036116; FN3_sf.
InterPro; IPR013783; Ig-like_fold.
Pfam; PF01108; Tissue_fac; 1.
SUPFAM; SSF49265; SSF49265; 2.
PROSITE; PS50853; FN3; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Antiviral defense; Disulfide bond;
Glycoprotein; Membrane; Receptor; Reference proteome; Signal;
Transmembrane; Transmembrane helix.
SIGNAL 1..20
/evidence="ECO:0000255"
CHAIN 21..520
/note="Interferon lambda receptor 1"
/id="PRO_0000011019"
TOPO_DOM 21..228
/note="Extracellular"
/evidence="ECO:0000255"
TRANSMEM 229..249
/note="Helical"
/evidence="ECO:0000255"
TOPO_DOM 250..520
/note="Cytoplasmic"
/evidence="ECO:0000255"
DOMAIN 26..126
/note="Fibronectin type-III"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
CARBOHYD 29
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:20934432"
CARBOHYD 36
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:20934432"
CARBOHYD 142
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000269|PubMed:20934432"
CARBOHYD 169
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
DISULFID 74..82
/evidence="ECO:0000269|PubMed:20934432"
DISULFID 86..150
/evidence="ECO:0000269|PubMed:20934432"
DISULFID 195..217
/evidence="ECO:0000269|PubMed:20934432"
VAR_SEQ 171..211
/note="TLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSK -> VGSSFPA
PRLGPLLHPFLLRFFSPSQPAPAPLLQEVFPVHS (in isoform 3)"
/evidence="ECO:0000303|PubMed:12469119"
/id="VSP_011888"
VAR_SEQ 212..244
/note="Missing (in isoform 3)"
/evidence="ECO:0000303|PubMed:12469119"
/id="VSP_011889"
VAR_SEQ 224..244
/note="EANWAFLVLPSLLILLLVIAA -> GLFWTHTPCGNLSAQQTRVRE (in
isoform 4)"
/evidence="ECO:0000303|PubMed:12521379"
/id="VSP_011891"
VAR_SEQ 245..520
/note="Missing (in isoform 3 and isoform 4)"
/evidence="ECO:0000303|PubMed:12469119,
ECO:0000303|PubMed:12521379"
/id="VSP_011892"
VAR_SEQ 268..296
/note="Missing (in isoform 2)"
/evidence="ECO:0000303|PubMed:12469119"
/id="VSP_011890"
STRAND 28..35
/evidence="ECO:0000244|PDB:3OG6"
STRAND 38..44
/evidence="ECO:0000244|PDB:3OG6"
STRAND 54..60
/evidence="ECO:0000244|PDB:3OG6"
HELIX 63..65
/evidence="ECO:0000244|PDB:3OG4"
STRAND 68..70
/evidence="ECO:0000244|PDB:3OG6"
HELIX 72..74
/evidence="ECO:0000244|PDB:3OG6"
STRAND 75..77
/evidence="ECO:0000244|PDB:5T5W"
STRAND 79..83
/evidence="ECO:0000244|PDB:3OG6"
STRAND 98..104
/evidence="ECO:0000244|PDB:3OG6"
HELIX 119..122
/evidence="ECO:0000244|PDB:3OG6"
STRAND 129..135
/evidence="ECO:0000244|PDB:3OG6"
STRAND 138..144
/evidence="ECO:0000244|PDB:3OG6"
STRAND 156..164
/evidence="ECO:0000244|PDB:3OG6"
STRAND 170..172
/evidence="ECO:0000244|PDB:3OG4"
STRAND 180..185
/evidence="ECO:0000244|PDB:3OG6"
STRAND 192..209
/evidence="ECO:0000244|PDB:3OG6"
STRAND 216..219
/evidence="ECO:0000244|PDB:3OG6"
HELIX 256..258
/evidence="ECO:0000244|PDB:5IXI"
HELIX 265..267
/evidence="ECO:0000244|PDB:5L04"
STRAND 277..279
/evidence="ECO:0000244|PDB:5L04"
STRAND 291..294
/evidence="ECO:0000244|PDB:5L04"
SEQUENCE 520 AA; 57653 MW; CEDAEE57F85D69AC CRC64;
MAGPERWGPL LLCLLQAAPG RPRLAPPQNV TLLSQNFSVY LTWLPGLGNP QDVTYFVAYQ
SSPTRRRWRE VEECAGTKEL LCSMMCLKKQ DLYNKFKGRV RTVSPSSKSP WVESEYLDYL
FEVEPAPPVL VLTQTEEILS ANATYQLPPC MPPLDLKYEV AFWKEGAGNK TLFPVTPHGQ
PVQITLQPAA SEHHCLSART IYTFSVPKYS KFSKPTCFLL EVPEANWAFL VLPSLLILLL
VIAAGGVIWK TLMGNPWFQR AKMPRALDFS GHTHPVATFQ PSRPESVNDL FLCPQKELTR
GVRPTPRVRA PATQQTRWKK DLAEDEEEED EEDTEDGVSF QPYIEPPSFL GQEHQAPGHS
EAGGVDSGRP RAPLVPSEGS SAWDSSDRSW ASTVDSSWDR AGSSGYLAEK GPGQGPGGDG
HQESLPPPEF SKDSGFLEEL PEDNLSSWAT WGTLPPEPNL VPGGPPVSLQ TLTFCWESSP
EEEEEARESE IEDSDAGSWG AESTQRTEDR GRTLGHYMAR


Related products :

Catalog number Product name Quantity
E1425h ELISA kit CRF2-1,Cytokine receptor class-II member 1,Cytokine receptor family 2 member 1,Homo sapiens,Human,IFN-alpha_beta receptor 1,IFNAR,IFNAR1,IFN-R-1,Interferon alpha_beta receptor 1,Type I inte 96T
E1425h ELISA CRF2-1,Cytokine receptor class-II member 1,Cytokine receptor family 2 member 1,Homo sapiens,Human,IFN-alpha_beta receptor 1,IFNAR,IFNAR1,IFN-R-1,Interferon alpha_beta receptor 1,Type I interfero 96T
U1425h CLIA CRF2-1,Cytokine receptor class-II member 1,Cytokine receptor family 2 member 1,Homo sapiens,Human,IFN-alpha_beta receptor 1,IFNAR,IFNAR1,IFN-R-1,Interferon alpha_beta receptor 1,Type I interferon 96T
EIAAB09420 Crlf2,Crlm2,CRLM-2,Cytokine receptor-like factor 2,Cytokine receptor-like molecule 2,Mouse,Mus musculus,Thymic stromal lymphopoietin protein receptor,Tpte2,TSLP receptor,Tslpr,Type I cytokine receptor
orb82616 Human IL29 protein IL28A, IL28B, and IL29, also named interferon lambda2 (IFN lambda 2), IFN lambda 3, and IFN lambda 1, respectively, are newly identified class II cytokine receptor ligands that are 5
IL2RA IL28RA Gene interleukin 28 receptor, alpha (interferon, lambda receptor)
ARP48069_P050 IL28RA(interleukin 28 receptor, alpha (interferon, lambda receptor)) 50 µg
EIAAB09422 CREME9,CREME-9,CRLF3,Cytokine receptor-like factor 3,Cytokine receptor-like molecule 9,Cytokine receptor-related protein 4,CYTOR4,Homo sapiens,Human,P48,Type I cytokine receptor-like factor p48
U0065r CLIA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norvegi 96T
E0065r ELISA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norveg 96T
U0065m CLIA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus muscu 96T
E0065m ELISA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus musc 96T
E0065m ELISA kit CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus 96T
E0065r ELISA kit CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus n 96T
18-661-15120 Interleukin-27 receptor alpha chain - IL-27R-alpha; WSX-1; Type I T-cell cytokine receptor; TCCR; Protein CRL1 Polyclonal 0.1 mg
18-661-15121 Interleukin-27 receptor alpha chain - IL-27R-alpha; WSX-1; Type I T-cell cytokine receptor; TCCR; Protein CRL1 Polyclonal 0.1 mg
EIAAB09419 CRL2,CRLF2,Cytokine receptor-like 2,Cytokine receptor-like factor 2,Homo sapiens,Human,ILXR,IL-XR,Thymic stromal lymphopoietin protein receptor,TSLP receptor,TSLPR
CSB-EL011647MO Mouse interleukin 28 receptor, alpha (interferon, lambda receptor) (IL28RA) ELISA kit, Species Mouse, Sample Type serum, plasma 96T
CSB-EL011647HU Human interleukin 28 receptor, alpha (interferon, lambda receptor) (IL28RA) ELISA kit, Species Human, Sample Type serum, plasma 96T
E0065h ELISA kit CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 r 96T
U0065h CLIA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recepto 96T
E0065h ELISA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recept 96T
EIAAB09417 CLF-1,Crlf1,Crlm3,CRLM-3,Cytokine receptor-like factor 1,Cytokine receptor-like molecule 3,Cytokine-like factor 1,Mouse,Mus musculus,Novel cytokine receptor 6,NR6
U1815h CLIA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T