GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12RB1) (IL-12 receptor beta component) (CD antigen CD212)

 I12R1_HUMAN             Reviewed;         662 AA.
P42701; A8K308; B2RPF1; B7ZKK3; Q8N6Q7;
01-NOV-1995, integrated into UniProtKB/Swiss-Prot.
01-NOV-1995, sequence version 1.
17-JUN-2020, entry version 192.
RecName: Full=Interleukin-12 receptor subunit beta-1;
Short=IL-12 receptor subunit beta-1;
Short=IL-12R subunit beta-1;
Short=IL-12R-beta-1;
Short=IL-12RB1;
AltName: Full=IL-12 receptor beta component;
AltName: CD_antigen=CD212;
Flags: Precursor;
Name=IL12RB1; Synonyms=IL12R, IL12RB;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2).
PubMed=7911493;
Chua A.O., Chizzonite R., Desai B.B., Truitt T.P., Nunes P., Minetti L.J.,
Warrier R.R., Presky D.H., Levine J.F., Gately M.K., Gubler U.;
"Expression cloning of a human IL-12 receptor component. A new member of
the cytokine receptor superfamily with strong homology to gp130.";
J. Immunol. 153:128-136(1994).
[2]
NUCLEOTIDE SEQUENCE [GENOMIC DNA].
Elloumi-Zghal H., Abdelhak S., Dellagi K.;
"Genomic structure of IL12RB1 gene.";
Submitted (SEP-2000) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS GLN-3; SER-47; HIS-156;
ARG-214; GLN-339; THR-365 AND ARG-378.
SeattleSNPs variation discovery resource;
Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
TISSUE=Umbilical cord blood;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15057824; DOI=10.1038/nature02399;
Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E.,
Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A.,
Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S.,
Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A.,
Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J.,
Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M.,
Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W.,
Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V.,
Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D.,
McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I.,
Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L.,
Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A.,
She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M.,
Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J.,
Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E.,
Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M.,
Rubin E.M., Lucas S.M.;
"The DNA sequence and biology of human chromosome 19.";
Nature 428:529-535(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
Hunkapiller M.W., Myers E.W., Venter J.C.;
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3), AND VARIANT
ARG-214.
TISSUE=Colon, and Testis;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
SUBUNIT.
PubMed=8943050; DOI=10.1073/pnas.93.24.14002;
Presky D.H., Yang H., Minetti L.J., Chua A.O., Nabavi N., Wu C.-Y.,
Gately M.K., Gubler U.;
"A functional interleukin 12 receptor complex is composed of two beta-type
cytokine receptor subunits.";
Proc. Natl. Acad. Sci. U.S.A. 93:14002-14007(1996).
[9]
FUNCTION, AND INTERACTION WITH IL23R.
PubMed=12023369; DOI=10.4049/jimmunol.168.11.5699;
Parham C., Chirica M., Timans J., Vaisberg E., Travis M., Cheung J.,
Pflanz S., Zhang R., Singh K.P., Vega F., To W., Wagner J.,
O'Farrell A.-M., McClanahan T.K., Zurawski S., Hannum C., Gorman D.,
Rennick D.M., Kastelein R.A., de Waal Malefyt R., Moore K.W.;
"A receptor for the heterodimeric cytokine IL-23 is composed of IL-12Rbeta1
and a novel cytokine receptor subunit, IL-23R.";
J. Immunol. 168:5699-5708(2002).
[10]
VARIANT IMD30 TRP-213.
PubMed=11424023; DOI=10.1086/321999;
Altare F., Ensser A., Breiman A., Reichenbach J., El Baghdadi J.,
Fischer A., Emile J.-F., Gaillard J.-L., Meinl E., Casanova J.-L.;
"Interleukin-12 receptor beta-1 deficiency in a patient with abdominal
tuberculosis.";
J. Infect. Dis. 184:231-236(2001).
-!- FUNCTION: Functions as an interleukin receptor which binds interleukin-
12 with low affinity and is involved in IL12 transduction. Associated
with IL12RB2 it forms a functional, high affinity receptor for IL12.
Associates also with IL23R to form the interleukin-23 receptor which
functions in IL23 signal transduction probably through activation of
the Jak-Stat signaling cascade. {ECO:0000269|PubMed:12023369}.
-!- SUBUNIT: Dimer or oligomer; disulfide-linked. Interacts with IL12RB2 to
form the high affinity IL12 receptor. Heterodimer with IL23R; in
presence of IL23. The heterodimer forms the IL23 receptor.
{ECO:0000269|PubMed:12023369, ECO:0000269|PubMed:8943050}.
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=3;
Name=1; Synonyms=Long;
IsoId=P42701-1; Sequence=Displayed;
Name=2; Synonyms=Short;
IsoId=P42701-2; Sequence=VSP_001715;
Name=3;
IsoId=P42701-3; Sequence=VSP_037043, VSP_037044;
-!- DOMAIN: The WSXWS motif appears to be necessary for proper protein
folding and thereby efficient intracellular transport and cell-surface
receptor binding.
-!- DOMAIN: The box 1 motif is required for JAK interaction and/or
activation.
-!- DISEASE: Immunodeficiency 30 (IMD30) [MIM:614891]: A form of Mendelian
susceptibility to mycobacterial disease, a rare condition caused by
impairment of interferon-gamma mediated immunity. It is characterized
by predisposition to illness caused by moderately virulent
mycobacterial species, such as Bacillus Calmette-Guerin (BCG) vaccine,
environmental non-tuberculous mycobacteria, and by the more virulent
Mycobacterium tuberculosis. Other microorganisms rarely cause severe
clinical disease in individuals with susceptibility to mycobacterial
infections, with the exception of Salmonella which infects less than
50% of these individuals. Clinical outcome severity depends on the
degree of impairment of interferon-gamma mediated immunity. Some
patients die of overwhelming mycobacterial disease with lepromatous-
like lesions in early childhood, whereas others develop, later in life,
disseminated but curable infections with tuberculoid granulomas. IMD30
has low penetrance, and affected individuals have relatively mild
disease and good prognosis. BCG disease and salmonellosis are the most
frequent infections in IMD30 patients. {ECO:0000269|PubMed:11424023}.
Note=The disease is caused by mutations affecting the gene represented
in this entry.
-!- SIMILARITY: Belongs to the type I cytokine receptor family. Type 2
subfamily. {ECO:0000305}.
-!- WEB RESOURCE: Name=IL12RB1base; Note=IL12RB1 mutation db;
URL="http://structure.bmc.lu.se/idbase/IL12RB1base/";
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il12rb1/";
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; U03187; AAA21340.1; -; mRNA.
EMBL; AJ297688; CAC10446.1; -; Genomic_DNA.
EMBL; AJ297689; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297690; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297691; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297692; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297693; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297694; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297695; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297696; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297697; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297698; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297699; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297700; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AJ297701; CAC10446.1; JOINED; Genomic_DNA.
EMBL; AY771996; AAV28734.1; -; Genomic_DNA.
EMBL; AK290423; BAF83112.1; -; mRNA.
EMBL; AC020904; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471106; EAW84656.1; -; Genomic_DNA.
EMBL; BC029121; AAH29121.1; -; mRNA.
EMBL; BC137404; AAI37405.1; -; mRNA.
EMBL; BC137406; AAI37407.1; -; mRNA.
CCDS; CCDS32957.1; -. [P42701-3]
CCDS; CCDS54232.1; -. [P42701-1]
PIR; I37892; I37892.
RefSeq; NP_001276952.1; NM_001290023.1. [P42701-2]
RefSeq; NP_005526.1; NM_005535.2. [P42701-1]
RefSeq; NP_714912.1; NM_153701.2. [P42701-3]
BioGRID; 109808; 19.
ComplexPortal; CPX-382; Interleukin-12-receptor complex.
ComplexPortal; CPX-383; Interleukin-23-receptor complex.
CORUM; P42701; -.
DIP; DIP-3773N; -.
IntAct; P42701; 16.
STRING; 9606.ENSP00000470788; -.
iPTMnet; P42701; -.
PhosphoSitePlus; P42701; -.
BioMuta; IL12RB1; -.
DMDM; 1170462; -.
MassIVE; P42701; -.
MaxQB; P42701; -.
PaxDb; P42701; -.
PeptideAtlas; P42701; -.
PRIDE; P42701; -.
ProteomicsDB; 55543; -. [P42701-1]
ProteomicsDB; 55544; -. [P42701-2]
ProteomicsDB; 55545; -. [P42701-3]
ABCD; P42701; 2 sequenced antibodies.
Antibodypedia; 14966; 459 antibodies.
DNASU; 3594; -.
Ensembl; ENST00000322153; ENSP00000314425; ENSG00000096996. [P42701-3]
Ensembl; ENST00000593993; ENSP00000472165; ENSG00000096996. [P42701-1]
Ensembl; ENST00000600835; ENSP00000470788; ENSG00000096996. [P42701-1]
GeneID; 3594; -.
KEGG; hsa:3594; -.
UCSC; uc002nhw.2; human. [P42701-1]
CTD; 3594; -.
DisGeNET; 3594; -.
EuPathDB; HostDB:ENSG00000096996.15; -.
GeneCards; IL12RB1; -.
HGNC; HGNC:5971; IL12RB1.
HPA; ENSG00000096996; Tissue enhanced (blood, lymphoid tissue).
MalaCards; IL12RB1; -.
MIM; 601604; gene.
MIM; 614891; phenotype.
neXtProt; NX_P42701; -.
OpenTargets; ENSG00000096996; -.
Orphanet; 319552; Mendelian susceptibility to mycobacterial diseases due to complete IL12RB1 deficiency.
Orphanet; 186; Primary biliary cholangitis.
PharmGKB; PA29786; -.
eggNOG; ENOG410IJY4; Eukaryota.
eggNOG; ENOG410YV8S; LUCA.
GeneTree; ENSGT00390000012431; -.
HOGENOM; CLU_031440_0_0_1; -.
InParanoid; P42701; -.
KO; K05063; -.
OMA; QWTSPAD; -.
OrthoDB; 1260765at2759; -.
PhylomeDB; P42701; -.
TreeFam; TF338613; -.
Reactome; R-HSA-9020591; Interleukin-12 signaling.
Reactome; R-HSA-9020933; Interleukin-23 signaling.
SignaLink; P42701; -.
SIGNOR; P42701; -.
BioGRID-ORCS; 3594; 5 hits in 781 CRISPR screens.
ChiTaRS; IL12RB1; human.
GeneWiki; Interleukin_12_receptor,_beta_1_subunit; -.
GenomeRNAi; 3594; -.
Pharos; P42701; Tbio.
PRO; PR:P42701; -.
Proteomes; UP000005640; Chromosome 19.
RNAct; P42701; protein.
Bgee; ENSG00000096996; Expressed in blood and 130 other tissues.
ExpressionAtlas; P42701; baseline and differential.
Genevisible; P42701; HS.
GO; GO:0009897; C:external side of plasma membrane; IBA:GO_Central.
GO; GO:0042022; C:interleukin-12 receptor complex; IDA:BHF-UCL.
GO; GO:0072536; C:interleukin-23 receptor complex; IDA:BHF-UCL.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0043235; C:receptor complex; IBA:GO_Central.
GO; GO:0019955; F:cytokine binding; IBA:GO_Central.
GO; GO:0004896; F:cytokine receptor activity; IBA:GO_Central.
GO; GO:0071346; P:cellular response to interferon-gamma; IDA:BHF-UCL.
GO; GO:0019221; P:cytokine-mediated signaling pathway; TAS:BHF-UCL.
GO; GO:0035722; P:interleukin-12-mediated signaling pathway; TAS:Reactome.
GO; GO:0038155; P:interleukin-23-mediated signaling pathway; TAS:Reactome.
GO; GO:0042104; P:positive regulation of activated T cell proliferation; IDA:BHF-UCL.
GO; GO:0002230; P:positive regulation of defense response to virus by host; IDA:BHF-UCL.
GO; GO:0032729; P:positive regulation of interferon-gamma production; IDA:BHF-UCL.
GO; GO:0043382; P:positive regulation of memory T cell differentiation; ISS:BHF-UCL.
GO; GO:0001916; P:positive regulation of T cell mediated cytotoxicity; ISS:BHF-UCL.
GO; GO:0002827; P:positive regulation of T-helper 1 type immune response; IDA:BHF-UCL.
GO; GO:2000330; P:positive regulation of T-helper 17 cell lineage commitment; ISS:BHF-UCL.
GO; GO:2000318; P:positive regulation of T-helper 17 type immune response; ISS:BHF-UCL.
GO; GO:0007165; P:signal transduction; IC:BHF-UCL.
CDD; cd00063; FN3; 1.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR003961; FN3_dom.
InterPro; IPR036116; FN3_sf.
InterPro; IPR003529; Hematopoietin_rcpt_Gp130_CS.
InterPro; IPR013783; Ig-like_fold.
Pfam; PF00041; fn3; 1.
SMART; SM00060; FN3; 1.
SUPFAM; SSF49265; SSF49265; 1.
PROSITE; PS50853; FN3; 3.
PROSITE; PS01353; HEMATOPO_REC_L_F2; 1.
1: Evidence at protein level;
Alternative splicing; Disease mutation; Disulfide bond; Glycoprotein;
Membrane; Polymorphism; Receptor; Reference proteome; Repeat; Signal;
Transmembrane; Transmembrane helix.
SIGNAL 1..23
/evidence="ECO:0000255"
CHAIN 24..662
/note="Interleukin-12 receptor subunit beta-1"
/id="PRO_0000010917"
TOPO_DOM 24..545
/note="Extracellular"
/evidence="ECO:0000255"
TRANSMEM 546..570
/note="Helical"
/evidence="ECO:0000255"
TOPO_DOM 571..662
/note="Cytoplasmic"
/evidence="ECO:0000255"
DOMAIN 46..136
/note="Fibronectin type-III 1"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
DOMAIN 142..234
/note="Fibronectin type-III 2"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
DOMAIN 237..337
/note="Fibronectin type-III 3"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
DOMAIN 338..444
/note="Fibronectin type-III 4"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
DOMAIN 448..542
/note="Fibronectin type-III 5"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00316"
MOTIF 222..226
/note="WSXWS motif"
MOTIF 577..585
/note="Box 1 motif"
CARBOHYD 121
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 329
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 346
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 352
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 442
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 456
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
DISULFID 52..62
/evidence="ECO:0000250"
VAR_SEQ 341..422
/note="EPVALNISVGTNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPD
PAGMATYSWSRESGAMGQEKCYYITIFASA -> DGMISAHCNLRLPDSRDSPASASRV
AGITGICHHTRLILYF (in isoform 3)"
/evidence="ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334"
/id="VSP_037043"
VAR_SEQ 423..662
/note="Missing (in isoform 3)"
/evidence="ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:15489334"
/id="VSP_037044"
VAR_SEQ 659..662
/note="KAKM -> DR (in isoform 2)"
/evidence="ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:7911493"
/id="VSP_001715"
VARIANT 3
/note="P -> Q (in dbSNP:rs17884651)"
/evidence="ECO:0000269|Ref.3"
/id="VAR_021281"
VARIANT 47
/note="P -> S (in dbSNP:rs17887176)"
/evidence="ECO:0000269|Ref.3"
/id="VAR_021282"
VARIANT 156
/note="R -> H (in dbSNP:rs11575926)"
/evidence="ECO:0000269|Ref.3"
/id="VAR_021283"
VARIANT 213
/note="R -> W (in IMD30; dbSNP:rs121434494)"
/evidence="ECO:0000269|PubMed:11424023"
/id="VAR_015577"
VARIANT 214
/note="Q -> R (in dbSNP:rs11575934)"
/evidence="ECO:0000269|PubMed:15489334, ECO:0000269|Ref.3"
/id="VAR_021284"
VARIANT 339
/note="H -> Q (in dbSNP:rs17884957)"
/evidence="ECO:0000269|Ref.3"
/id="VAR_021285"
VARIANT 365
/note="M -> T (in dbSNP:rs375947)"
/evidence="ECO:0000269|Ref.3"
/id="VAR_011986"
VARIANT 378
/note="G -> R (in dbSNP:rs401502)"
/evidence="ECO:0000269|Ref.3"
/id="VAR_011987"
SEQUENCE 662 AA; 73109 MW; 541ADA60F62DA1EF CRC64;
MEPLVTWVVP LLFLFLLSRQ GAACRTSECC FQDPPYPDAD SGSASGPRDL RCYRISSDRY
ECSWQYEGPT AGVSHFLRCC LSSGRCCYFA AGSATRLQFS DQAGVSVLYT VTLWVESWAR
NQTEKSPEVT LQLYNSVKYE PPLGDIKVSK LAGQLRMEWE TPDNQVGAEV QFRHRTPSSP
WKLGDCGPQD DDTESCLCPL EMNVAQEFQL RRRQLGSQGS SWSKWSSPVC VPPENPPQPQ
VRFSVEQLGQ DGRRRLTLKE QPTQLELPEG CQGLAPGTEV TYRLQLHMLS CPCKAKATRT
LHLGKMPYLS GAAYNVAVIS SNQFGPGLNQ TWHIPADTHT EPVALNISVG TNGTTMYWPA
RAQSMTYCIE WQPVGQDGGL ATCSLTAPQD PDPAGMATYS WSRESGAMGQ EKCYYITIFA
SAHPEKLTLW STVLSTYHFG GNASAAGTPH HVSVKNHSLD SVSVDWAPSL LSTCPGVLKE
YVVRCRDEDS KQVSEHPVQP TETQVTLSGL RAGVAYTVQV RADTAWLRGV WSQPQRFSIE
VQVSDWLIFF ASLGSFLSIL LVGVLGYLGL NRAARHLCPP LPTPCASSAI EFPGGKETWQ
WINPVDFQEE ASLQEALVVE MSWDKGERTE PLEKTELPEG APELALDTEL SLEDGDRCKA
KM


Related products :

Catalog number Product name Quantity
E1761h ELISA kit Homo sapiens,Human,IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,OSMR,OSMRB 96T
E1761h ELISA Homo sapiens,Human,IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,OSMR,OSMRB 96T
U1761h CLIA Homo sapiens,Human,IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,OSMR,OSMRB 96T
U1761r CLIA IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb,Rat,Rattus norvegicus 96T
E1761r ELISA IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb,Rat,Rattus norvegicus 96T
E1761r ELISA kit IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb,Rat,Rattus norvegicus 96T
U1761m CLIA IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Mouse,Mus musculus,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb 96T
E1761m ELISA IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Mouse,Mus musculus,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb 96T
E1761m ELISA kit IL-31 receptor subunit beta,IL-31R subunit beta,IL-31RB,IL-31R-beta,Interleukin-31 receptor subunit beta,Mouse,Mus musculus,Oncostatin-M-specific receptor subunit beta,Osmr,Osmrb 96T
E1837h ELISA kit High affinity IL-2 receptor subunit beta,Homo sapiens,Human,IL-2 receptor subunit beta,IL-2R subunit beta,IL2RB,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,p75 96T
U1837h CLIA High affinity IL-2 receptor subunit beta,Homo sapiens,Human,IL-2 receptor subunit beta,IL-2R subunit beta,IL2RB,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,p75 96T
E1837h ELISA High affinity IL-2 receptor subunit beta,Homo sapiens,Human,IL-2 receptor subunit beta,IL-2R subunit beta,IL2RB,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,p75 96T
U1837h CLIA kit High affinity IL-2 receptor subunit beta,Homo sapiens,Human,IL-2 receptor subunit beta,IL-2R subunit beta,IL2RB,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,p75 96T
U1837m CLIA High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,Mouse,Mus musculus,p70-75 96T
E1837m ELISA kit High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,Mouse,Mus musculus,p70-75 96T
U1837r CLIA High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,Rat,Rattus norvegicus 96T
E1837m ELISA High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,Mouse,Mus musculus,p70-75 96T
U1837r CLIA kit High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,Rat,Rattus norvegicus 96T
E1837r ELISA High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,Rat,Rattus norvegicus 96T
E1837r ELISA kit High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,p70-75,Rat,Rattus norvegicus 96T
U1837m CLIA kit High affinity IL-2 receptor subunit beta,IL-2 receptor subunit beta,IL-2R subunit beta,Il2rb,IL-2RB,Interleukin-2 receptor subunit beta,Mouse,Mus musculus,p70-75 96T
U0046r CLIA gp130,IL-6 receptor subunit beta,IL-6R subunit beta,IL-6RB,IL-6R-beta,Il6st,Interleukin-6 receptor subunit beta,Interleukin-6 signal transducer,Membrane glycoprotein 130,Oncostatin-M receptor sub 96T
E0046r ELISA gp130,IL-6 receptor subunit beta,IL-6R subunit beta,IL-6RB,IL-6R-beta,Il6st,Interleukin-6 receptor subunit beta,Interleukin-6 signal transducer,Membrane glycoprotein 130,Oncostatin-M receptor su 96T
E0046h ELISA kit CDw130,gp130,Homo sapiens,Human,IL-6 receptor subunit beta,IL-6R subunit beta,IL-6RB,IL-6R-beta,IL6ST,Interleukin-6 receptor subunit beta,Interleukin-6 signal transducer,Membrane glycoprote 96T
U0046h CLIA CDw130,gp130,Homo sapiens,Human,IL-6 receptor subunit beta,IL-6R subunit beta,IL-6RB,IL-6R-beta,IL6ST,Interleukin-6 receptor subunit beta,Interleukin-6 signal transducer,Membrane glycoprotein 130 96T
Pathways :
WP258: TGF-beta Receptor Signaling Pathway
WP1161: TGF-beta Receptor Signaling Pathway
WP809: TGF-beta Receptor Signaling Pathway
WP926: TGF-beta Receptor Signaling Pathway
WP1566: Citrate cycle (TCA cycle)
WP362: TGF-beta Receptor Signaling Pathway
WP1367: TGF-beta Receptor Signaling Pathway
WP566: canonical wnt - zebrafish
WP1045: TGF-beta Receptor Signaling Pathway
WP1614: 1- and 2-Methylnaphthalene degradation
WP1655: Geraniol degradation
WP2292: Chemokine signaling pathway
WP2272: Pathogenic Escherichia coli infection
WP126: Fatty Acid Beta Oxidation 1
WP215: noncanonical wnt pathway
WP401: Mitochondrial LC-Fatty Acid Beta-Oxidation
WP763: Mitochondrial LC-Fatty Acid Beta-Oxidation
WP143: Fatty Acid Beta Oxidation
WP187: Fatty Acid Beta Oxidation 2
WP506: Fatty Acid Beta Oxidation 1
WP560: TGF Beta Signaling Pathway
WP2218: sGC
WP418: Beta Oxidation of Unsaturated Fatty Acids
WP443: Beta Oxidation Meta MAPP
WP1177: Fatty Acid Beta Oxidation

Related Genes :
[IL12RB1 IL12R IL12RB] Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12RB1) (IL-12 receptor beta component) (CD antigen CD212)
[Il12rb1 Il12rb] Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12 receptor beta component) (CD antigen CD212)
[Il12rb2] Interleukin-12 receptor subunit beta-2 (IL-12 receptor subunit beta-2) (IL-12R subunit beta-2) (IL-12R-beta-2) (IL-12RB2)
[IL12RB2] Interleukin-12 receptor subunit beta-2 (IL-12 receptor subunit beta-2) (IL-12R subunit beta-2) (IL-12R-beta-2) (IL-12RB2)
[IL12RB2] Interleukin-12 receptor subunit beta-2 (IL-12 receptor subunit beta-2) (IL-12R subunit beta-2) (IL-12R-beta-2) (IL-12RB2)
[IL18RAP IL1R7] Interleukin-18 receptor accessory protein (IL-18 receptor accessory protein) (IL-18RAcP) (EC 3.2.2.6) (Accessory protein-like) (AcPL) (CD218 antigen-like family member B) (CDw218b) (IL-1R accessory protein-like) (IL-1RAcPL) (Interleukin-1 receptor 7) (IL-1R-7) (IL-1R7) (Interleukin-18 receptor accessory protein-like) (Interleukin-18 receptor beta) (IL-18R-beta) (IL-18Rbeta) (CD antigen CD218b)
[IL2RB IL15RB] Interleukin-2 receptor subunit beta (IL-2 receptor subunit beta) (IL-2R subunit beta) (IL-2RB) (High affinity IL-2 receptor subunit beta) (Interleukin-15 receptor subunit beta) (p70-75) (p75) (CD antigen CD122)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[IL6ST] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (CDw130) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[IL10RB CRFB4 D21S58 D21S66] Interleukin-10 receptor subunit beta (IL-10 receptor subunit beta) (IL-10R subunit beta) (IL-10RB) (Cytokine receptor class-II member 4) (Cytokine receptor family 2 member 4) (CRF2-4) (Interleukin-10 receptor subunit 2) (IL-10R subunit 2) (IL-10R2) (CD antigen CDw210b)
[IL12RB2] Interleukin-12 receptor subunit beta-2 (IL-12 receptor subunit beta-2) (IL-12R subunit beta-2) (IL-12R-beta-2) (IL-12RB2)
[IFNLR1 IL28RA LICR2] Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)
[OSMR OSMRB] Oncostatin-M-specific receptor subunit beta (Interleukin-31 receptor subunit beta) (IL-31 receptor subunit beta) (IL-31R subunit beta) (IL-31R-beta) (IL-31RB)
[IL13RA1 IL13R IL13RA] Interleukin-13 receptor subunit alpha-1 (IL-13 receptor subunit alpha-1) (IL-13R subunit alpha-1) (IL-13R-alpha-1) (IL-13RA1) (Cancer/testis antigen 19) (CT19) (CD antigen CD213a1)
[Osmr Osmrb] Oncostatin-M-specific receptor subunit beta (Interleukin-31 receptor subunit beta) (IL-31 receptor subunit beta) (IL-31R subunit beta) (IL-31R-beta) (IL-31RB)
[CSF2RB IL3RB IL5RB] Cytokine receptor common subunit beta (CDw131) (GM-CSF/IL-3/IL-5 receptor common beta subunit) (CD antigen CD131)
[Csf2rb Aic2b Csf2rb1 Il3rb1] Cytokine receptor common subunit beta (GM-CSF/IL-3/IL-5 receptor common beta subunit) (CD antigen CD131)
[IL10RA IL10R] Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)
[IL1R1 IL1R IL1RA IL1RT1] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL4R IL4RA 582J2.1] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il1rap] Interleukin-1 receptor accessory protein (IL-1 receptor accessory protein) (IL-1RAcP) (EC 3.2.2.6) (Interleukin-33 receptot beta chain)
[IL18R1 IL1RRP] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[Il1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL6R] Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126)
[Il3ra Sut-1] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (Interleukin-3 receptor class II alpha chain) (CD antigen CD123)
[Il2rb] Interleukin-2 receptor subunit beta (IL-2 receptor subunit beta) (IL-2R subunit beta) (IL-2RB) (High affinity IL-2 receptor subunit beta) (p70-75) (CD antigen CD122)
[IL7R] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CDw127) (CD antigen CD127)
[Il2rb] Interleukin-2 receptor subunit beta (IL-2 receptor subunit beta) (IL-2R subunit beta) (IL-2RB) (High affinity IL-2 receptor subunit beta) (p70-75) (CD antigen CD122)
[IL2RG] Cytokine receptor common subunit gamma (Interleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132)

Bibliography :