GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]

 I15RA_HUMAN             Reviewed;         267 AA.
Q13261; B4E2C2; Q3B769; Q5JVA1; Q5JVA2; Q5JVA4; Q6B0J2; Q7LDR4; Q7Z609;
01-FEB-2005, integrated into UniProtKB/Swiss-Prot.
01-NOV-1996, sequence version 1.
07-OCT-2020, entry version 172.
RecName: Full=Interleukin-15 receptor subunit alpha;
Short=IL-15 receptor subunit alpha;
Short=IL-15R-alpha;
Short=IL-15RA;
AltName: CD_antigen=CD215;
Contains:
RecName: Full=Soluble interleukin-15 receptor subunit alpha;
Short=sIL-15 receptor subunit alpha;
Short=sIL-15R-alpha;
Short=sIL-15RA;
Flags: Precursor;
Name=IL15RA;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, TISSUE
SPECIFICITY, AND VARIANT THR-182.
TISSUE=Bone marrow stroma;
PubMed=8530383; DOI=10.1074/jbc.270.50.29862;
Anderson D.M., Kumaki S., Ahdieh M., Bertles J., Tometsko M., Loomis A.,
Giri J., Copeland N.G., Gilbert D.J., Jenkins N.A., Valentine V.,
Shapiro D.N., Morris S.W., Park L.S., Cosman D.;
"Functional characterization of the human interleukin-15 receptor alpha
chain and close linkage of IL15RA and IL2RA genes.";
J. Biol. Chem. 270:29862-29869(1995).
[2]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.;
"Cloning of human full open reading frames in Gateway(TM) system entry
vector (pDONR201).";
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases.
[3]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANT THR-182.
SeattleSNPs variation discovery resource;
Submitted (JUN-2003) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
TISSUE=Trachea;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=15164054; DOI=10.1038/nature02462;
Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L.,
Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K.,
Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L.,
Taylor A., Battles J., Bird C.P., Ainscough R., Almeida J.P.,
Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J.,
Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y.,
Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P.,
Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N.,
Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A.,
Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C.,
Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D.,
Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C.,
Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K.,
Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A.,
Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S.,
McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S.,
Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V.,
Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A.,
Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M.,
Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A.,
Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P.,
Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y.,
Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D.,
Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.;
"The DNA sequence and comparative analysis of human chromosome 10.";
Nature 429:375-381(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M.,
Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J.,
Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S.,
Turner R., Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H.,
Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K.,
Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D.,
Hunkapiller M.W., Myers E.W., Venter J.C.;
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases.
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 9), AND VARIANT
THR-182.
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 30-267 (ISOFORM 1).
TISSUE=Brain;
PubMed=9110174; DOI=10.1101/gr.7.4.353;
Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W.,
Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.;
"Large-scale concatenation cDNA sequencing.";
Genome Res. 7:353-358(1997).
[9]
ALTERNATIVE SPLICING (ISOFORMS 1; 2; 3; 4; 5; 6; 7 AND 8), FUNCTION,
SUBCELLULAR LOCATION, TISSUE SPECIFICITY, AND GLYCOSYLATION.
PubMed=10480910; DOI=10.1074/jbc.274.38.26978;
Dubois S., Magrangeas F., Lehours P., Raher S., Bernard J., Boisteau O.,
Leroy S., Minvielle S., Godard A., Jacques Y.;
"Natural splicing of exon 2 of human interleukin-15 receptor alpha-chain
mRNA results in a shortened form with a distinct pattern of expression.";
J. Biol. Chem. 274:26978-26984(1999).
[10]
RETRACTED PAPER.
PubMed=11714793; DOI=10.4049/jimmunol.167.11.6292;
Bulanova E., Budagian V., Pohl T., Krause H., Durkop H., Paus R.,
Bulfone-Paus S.;
"The IL-15R alpha chain signals through association with Syk in human B
cells.";
J. Immunol. 167:6292-6302(2001).
[11]
RETRACTION NOTICE OF PUBMED:11714793.
PubMed=21289315; DOI=10.4049/jimmunol.1090142;
Pohl T., Krause H., Duerkop H., Paus R., Bulfone-Paus S.;
"The IL-15R alpha chain signals through association with Syk in human B
cells.";
J. Immunol. 186:2681-2681(2011).
[12]
TISSUE SPECIFICITY.
PubMed=12114302; DOI=10.1111/j.1749-6632.2002.tb04245.x;
Kurowska M., Rudnicka W., Maslinska D., Maslinski W.;
"Expression of IL-15 and IL-15 receptor isoforms in select structures of
human fetal brain.";
Ann. N. Y. Acad. Sci. 966:441-445(2002).
[13]
LIGAND-BINDING.
PubMed=15039446; DOI=10.1074/jbc.m312458200;
Bernard J., Harb C., Mortier E., Quemener A., Meloen R.H.,
Vermot-Desroches C., Wijdeness J., van Dijken P., Grotzinger J.,
Slootstra J.W., Plet A., Jacques Y.;
"Identification of an interleukin-15alpha receptor-binding site on human
interleukin-15.";
J. Biol. Chem. 279:24313-24322(2004).
[14]
SUBCELLULAR LOCATION (SOLUBLE INTERLEUKIN-15 RECEPTOR SUBUNIT ALPHA),
PROTEOLYTIC PROCESSING, AND LIGAND-BINDING.
PubMed=15265897; DOI=10.4049/jimmunol.173.3.1681;
Mortier E., Bernard J., Plet A., Jacques Y.;
"Natural, proteolytic release of a soluble form of human IL-15 receptor
alpha-chain that behaves as a specific, high affinity IL-15 antagonist.";
J. Immunol. 173:1681-1688(2004).
[15]
FUNCTION, INTERACTION WITH SYK, SUBCELLULAR LOCATION, AND TISSUE
SPECIFICITY.
PubMed=15123770; DOI=10.1189/jlb.0605298;
Ratthe C., Girard D.;
"Interleukin-15 enhances human neutrophil phagocytosis by a Syk-dependent
mechanism: importance of the IL-15Ralpha chain.";
J. Leukoc. Biol. 76:162-168(2004).
[16]
STRUCTURE BY NMR OF 31-96, AND DISULFIDE BONDS.
PubMed=16377614; DOI=10.1074/jbc.m513118200;
Lorenzen I., Dingley A.J., Jacques Y., Grotzinger J.;
"The structure of the interleukin-15 alpha receptor and its implications
for ligand binding.";
J. Biol. Chem. 281:6642-6647(2006).
[17]
X-RAY CRYSTALLOGRAPHY (1.85 ANGSTROMS) OF 31-132 IN COMPLEX WITH IL15, AND
DISULFIDE BONDS.
PubMed=17643103; DOI=10.1038/ni1492;
Chirifu M., Hayashi C., Nakamura T., Toma S., Shuto T., Kai H.,
Yamagata Y., Davis S.J., Ikemizu S.;
"Crystal structure of the IL-15-IL-15Ralpha complex, a cytokine-receptor
unit presented in trans.";
Nat. Immunol. 8:1001-1007(2007).
-!- FUNCTION: High-affinity receptor for interleukin-15 (PubMed:8530383).
Can signal both in cis and trans where IL15R from one subset of cells
presents IL15 to neighboring IL2RG-expressing cells (By similarity). In
neutrophils, binds and activates kinase SYK in response to IL15
stimulation (PubMed:15123770). In neutrophils, required for IL15-
induced phagocytosis in a SYK-dependent manner (PubMed:15123770).
Expression of different isoforms may alter or interfere with signal
transduction (PubMed:10480910). {ECO:0000250|UniProtKB:Q60819,
ECO:0000269|PubMed:10480910, ECO:0000269|PubMed:15123770,
ECO:0000269|PubMed:8530383}.
-!- FUNCTION: [Isoform 5]: Does not bind IL15.
{ECO:0000269|PubMed:10480910}.
-!- FUNCTION: [Isoform 6]: Does not bind IL15.
{ECO:0000269|PubMed:10480910}.
-!- FUNCTION: [Isoform 7]: Does not bind IL15.
{ECO:0000269|PubMed:10480910}.
-!- FUNCTION: [Isoform 8]: Does not bind IL15.
{ECO:0000269|PubMed:10480910}.
-!- SUBUNIT: The interleukin-15 receptor IL15R is a heterotrimer of IL15RA,
IL2RB and IL2RG. IL15RA also self-associates (PubMed:17643103).
Interacts with SYK (PubMed:15123770). {ECO:0000269|PubMed:15123770,
ECO:0000269|PubMed:17643103}.
-!- INTERACTION:
Q13261; P40933: IL15; NbExp=5; IntAct=EBI-980354, EBI-980274;
-!- SUBCELLULAR LOCATION: Membrane {ECO:0000269|PubMed:10480910}; Single-
pass type I membrane protein {ECO:0000269|PubMed:10480910}. Nucleus
membrane {ECO:0000269|PubMed:10480910}; Single-pass type I membrane
protein {ECO:0000269|PubMed:10480910}. Cell surface
{ECO:0000269|PubMed:15123770}. Note=Mainly found associated with the
nuclear membrane.
-!- SUBCELLULAR LOCATION: [Isoform 5]: Endoplasmic reticulum membrane;
Single-pass type I membrane protein. Golgi apparatus membrane; Single-
pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass
type I membrane protein. Membrane; Single-pass type I membrane protein.
Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with
endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the
nuclear membrane.
-!- SUBCELLULAR LOCATION: [Isoform 6]: Endoplasmic reticulum membrane;
Single-pass type I membrane protein. Golgi apparatus membrane; Single-
pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass
type I membrane protein. Membrane; Single-pass type I membrane protein.
Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with
endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the
nuclear membrane.
-!- SUBCELLULAR LOCATION: [Isoform 7]: Endoplasmic reticulum membrane;
Single-pass type I membrane protein. Golgi apparatus membrane; Single-
pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass
type I membrane protein. Membrane; Single-pass type I membrane protein.
Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with
endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the
nuclear membrane.
-!- SUBCELLULAR LOCATION: [Isoform 8]: Endoplasmic reticulum membrane;
Single-pass type I membrane protein. Golgi apparatus membrane; Single-
pass type I membrane protein. Cytoplasmic vesicle membrane; Single-pass
type I membrane protein. Membrane; Single-pass type I membrane protein.
Note=Isoform 5, isoform 6, isoform 7 and isoform 8 are associated with
endoplasmic reticulum, Golgi and cytoplasmic vesicles, but not with the
nuclear membrane.
-!- SUBCELLULAR LOCATION: [Soluble interleukin-15 receptor subunit alpha]:
Secreted, extracellular space {ECO:0000269|PubMed:15265897}.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=9;
Name=1;
IsoId=Q13261-1; Sequence=Displayed;
Name=2; Synonyms=delta3E1E7Il-15RA;
IsoId=Q13261-3; Sequence=VSP_012625;
Name=3; Synonyms=E1E7'Il-15RA;
IsoId=Q13261-4; Sequence=VSP_012626;
Name=4; Synonyms=delta3E1E7'Il-15RA;
IsoId=Q13261-5; Sequence=VSP_012625, VSP_012626;
Name=5; Synonyms=delta2E1E7Il-15RA;
IsoId=Q13261-6; Sequence=VSP_012624;
Name=6; Synonyms=delta2E1E7'Il-15RA;
IsoId=Q13261-7; Sequence=VSP_012624, VSP_012626;
Name=7; Synonyms=delta2deltaE1E73Il-15RA;
IsoId=Q13261-8; Sequence=VSP_012623;
Name=8; Synonyms=delta2delta3E1E7'Il-15RA;
IsoId=Q13261-9; Sequence=VSP_012623, VSP_012626;
Name=9;
IsoId=Q13261-10; Sequence=VSP_055406;
-!- TISSUE SPECIFICITY: Expressed in neutrophils (at protein level)
(PubMed:15123770). Expressed in fetal brain with higher expression in
the hippocampus and cerebellum than in cortex and thalamus
(PubMed:12114302). Higher levels of soluble sIL-15RA form in comparison
with membrane-bound forms is present in all brain structures
(PubMed:12114302). Isoforms 1, 3, 4, 5, 6, 7, 8 and 9: Widely expressed
(PubMed:10480910, PubMed:8530383). {ECO:0000269|PubMed:10480910,
ECO:0000269|PubMed:12114302, ECO:0000269|PubMed:15123770,
ECO:0000269|PubMed:8530383}.
-!- PTM: N-glycosylated and O-glycosylated. {ECO:0000269|PubMed:10480910}.
-!- PTM: A soluble form (sIL-15RA) arises from proteolytic shedding of the
membrane-anchored receptor (PubMed:15265897). It also binds IL-15 and
thus interferes with IL-15 binding to the membrane receptor
(PubMed:15265897). {ECO:0000269|PubMed:15265897}.
-!- SEQUENCE CAUTION:
Sequence=AAB88175.1; Type=Erroneous initiation; Note=Truncated N-terminus.; Evidence={ECO:0000305};
Sequence=EAW86419.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il15ra/";
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; U31628; AAC50312.1; -; mRNA.
EMBL; CR457064; CAG33345.1; -; mRNA.
EMBL; CR542023; CAG46820.1; -; mRNA.
EMBL; AY316538; AAP69528.1; -; Genomic_DNA.
EMBL; AK304211; BAG65084.1; -; mRNA.
EMBL; AL137186; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; CH471072; EAW86417.1; -; Genomic_DNA.
EMBL; CH471072; EAW86418.1; -; Genomic_DNA.
EMBL; CH471072; EAW86419.1; ALT_SEQ; Genomic_DNA.
EMBL; BC074726; AAH74726.1; -; mRNA.
EMBL; BC107777; AAI07778.1; -; mRNA.
EMBL; BC121140; AAI21141.1; -; mRNA.
EMBL; BC121141; AAI21142.1; -; mRNA.
EMBL; AF035279; AAB88175.1; ALT_INIT; mRNA.
CCDS; CCDS58069.1; -. [Q13261-10]
CCDS; CCDS7074.1; -. [Q13261-1]
CCDS; CCDS7075.2; -. [Q13261-3]
RefSeq; NP_001230468.1; NM_001243539.1. [Q13261-10]
RefSeq; NP_001243694.1; NM_001256765.1.
RefSeq; NP_002180.1; NM_002189.3. [Q13261-1]
RefSeq; NP_751950.2; NM_172200.2. [Q13261-3]
PDB; 2ERS; NMR; -; A=31-96.
PDB; 2Z3Q; X-ray; 1.85 A; B/D=31-132.
PDB; 2Z3R; X-ray; 2.00 A; B/D/F/H/J/L/N/P=31-132.
PDB; 4GS7; X-ray; 2.35 A; D=30-97.
PDBsum; 2ERS; -.
PDBsum; 2Z3Q; -.
PDBsum; 2Z3R; -.
PDBsum; 4GS7; -.
BMRB; Q13261; -.
SMR; Q13261; -.
BioGRID; 109814; 8.
IntAct; Q13261; 9.
GuidetoPHARMACOLOGY; 1702; -.
GlyGen; Q13261; 1 site.
iPTMnet; Q13261; -.
BioMuta; IL15RA; -.
DMDM; 59799763; -.
MassIVE; Q13261; -.
MaxQB; Q13261; -.
PaxDb; Q13261; -.
PeptideAtlas; Q13261; -.
PRIDE; Q13261; -.
ProteomicsDB; 59258; -. [Q13261-1]
ProteomicsDB; 59259; -. [Q13261-3]
ProteomicsDB; 59260; -. [Q13261-4]
ProteomicsDB; 59261; -. [Q13261-5]
ProteomicsDB; 59262; -. [Q13261-6]
ProteomicsDB; 59263; -. [Q13261-7]
ProteomicsDB; 59264; -. [Q13261-8]
ProteomicsDB; 59265; -. [Q13261-9]
Antibodypedia; 24259; 462 antibodies.
Ensembl; ENST00000379971; ENSP00000369306; ENSG00000134470. [Q13261-9]
Ensembl; ENST00000379977; ENSP00000369312; ENSG00000134470. [Q13261-1]
Ensembl; ENST00000397250; ENSP00000380422; ENSG00000134470. [Q13261-8]
Ensembl; ENST00000397255; ENSP00000380426; ENSG00000134470. [Q13261-4]
Ensembl; ENST00000525219; ENSP00000431529; ENSG00000134470. [Q13261-10]
Ensembl; ENST00000528354; ENSP00000435454; ENSG00000134470. [Q13261-3]
Ensembl; ENST00000530685; ENSP00000435995; ENSG00000134470. [Q13261-5]
GeneID; 3601; -.
KEGG; hsa:3601; -.
UCSC; uc001iiv.4; human. [Q13261-1]
CTD; 3601; -.
DisGeNET; 3601; -.
EuPathDB; HostDB:ENSG00000134470.19; -.
GeneCards; IL15RA; -.
HGNC; HGNC:5978; IL15RA.
HPA; ENSG00000134470; Low tissue specificity.
MIM; 601070; gene.
neXtProt; NX_Q13261; -.
OpenTargets; ENSG00000134470; -.
PharmGKB; PA29791; -.
GeneTree; ENSGT00390000000121; -.
HOGENOM; CLU_063804_1_0_1; -.
InParanoid; Q13261; -.
KO; K05074; -.
OrthoDB; 1326471at2759; -.
PhylomeDB; Q13261; -.
TreeFam; TF338443; -.
PathwayCommons; Q13261; -.
Reactome; R-HSA-8983432; Interleukin-15 signaling.
SignaLink; Q13261; -.
SIGNOR; Q13261; -.
BioGRID-ORCS; 3601; 6 hits in 878 CRISPR screens.
EvolutionaryTrace; Q13261; -.
GeneWiki; Interleukin_15_receptor,_alpha_subunit; -.
GenomeRNAi; 3601; -.
Pharos; Q13261; Tbio.
PRO; PR:Q13261; -.
Proteomes; UP000005640; Chromosome 10.
RNAct; Q13261; protein.
Bgee; ENSG00000134470; Expressed in ectocervix and 172 other tissues.
ExpressionAtlas; Q13261; baseline and differential.
Genevisible; Q13261; HS.
GO; GO:0009986; C:cell surface; IDA:UniProtKB.
GO; GO:0030659; C:cytoplasmic vesicle membrane; IEA:UniProtKB-SubCell.
GO; GO:0005789; C:endoplasmic reticulum membrane; IEA:UniProtKB-SubCell.
GO; GO:0005768; C:endosome; TAS:Reactome.
GO; GO:0005615; C:extracellular space; IEA:UniProtKB-SubCell.
GO; GO:0000139; C:Golgi membrane; IEA:UniProtKB-SubCell.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0031965; C:nuclear membrane; IEA:UniProtKB-SubCell.
GO; GO:0005886; C:plasma membrane; IBA:GO_Central.
GO; GO:0004896; F:cytokine receptor activity; TAS:UniProtKB.
GO; GO:0042010; F:interleukin-15 receptor activity; IDA:UniProtKB.
GO; GO:0019901; F:protein kinase binding; IPI:UniProtKB.
GO; GO:0035723; P:interleukin-15-mediated signaling pathway; IMP:UniProtKB.
GO; GO:0050766; P:positive regulation of phagocytosis; IMP:UniProtKB.
CDD; cd00033; CCP; 1.
InterPro; IPR042372; IL15RA.
InterPro; IPR035976; Sushi/SCR/CCP_sf.
InterPro; IPR000436; Sushi_SCR_CCP_dom.
PANTHER; PTHR15060; PTHR15060; 1.
SMART; SM00032; CCP; 1.
SUPFAM; SSF57535; SSF57535; 1.
PROSITE; PS50923; SUSHI; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cytoplasmic vesicle; Disulfide bond;
Endoplasmic reticulum; Glycoprotein; Golgi apparatus; Membrane; Nucleus;
Phosphoprotein; Polymorphism; Receptor; Reference proteome; Secreted;
Signal; Sushi; Transmembrane; Transmembrane helix.
SIGNAL 1..30
/evidence="ECO:0000255"
CHAIN 31..267
/note="Interleukin-15 receptor subunit alpha"
/id="PRO_0000011044"
CHAIN 31..?
/note="Soluble interleukin-15 receptor subunit alpha"
/id="PRO_0000333855"
TOPO_DOM 31..205
/note="Extracellular"
/evidence="ECO:0000255"
TRANSMEM 206..228
/note="Helical"
/evidence="ECO:0000255"
TOPO_DOM 229..267
/note="Cytoplasmic"
/evidence="ECO:0000255"
DOMAIN 31..95
/note="Sushi"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00302"
CARBOHYD 137
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
DISULFID 33..75
DISULFID 59..93
VAR_SEQ 1..36
/note="Missing (in isoform 9)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_055406"
VAR_SEQ 30..127
/note="Missing (in isoform 7 and isoform 8)"
/evidence="ECO:0000305"
/id="VSP_012623"
VAR_SEQ 31..95
/note="Missing (in isoform 5 and isoform 6)"
/evidence="ECO:0000305"
/id="VSP_012624"
VAR_SEQ 95..128
/note="RDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKE -> K (in isoform
2 and isoform 4)"
/evidence="ECO:0000303|PubMed:14702039,
ECO:0000303|PubMed:8530383"
/id="VSP_012625"
VAR_SEQ 232..267
/note="QTPPLASVEMEAMEALPVTWGTSSRDEDLENCSHHL -> ASVCSCHPRSAG
HTCSVGSVC (in isoform 3, isoform 4, isoform 6 and isoform
8)"
/evidence="ECO:0000303|PubMed:8530383"
/id="VSP_012626"
VARIANT 182
/note="N -> T (in dbSNP:rs2228059)"
/evidence="ECO:0000269|PubMed:15489334,
ECO:0000269|PubMed:8530383, ECO:0000269|Ref.3"
/id="VAR_020967"
CONFLICT 200
/note="G -> D (in Ref. 8; AAH74726)"
/evidence="ECO:0000305"
STRAND 42..44
/evidence="ECO:0000244|PDB:2Z3Q"
STRAND 54..59
/evidence="ECO:0000244|PDB:2Z3Q"
STRAND 63..65
/evidence="ECO:0000244|PDB:2Z3Q"
STRAND 72..77
/evidence="ECO:0000244|PDB:2Z3Q"
TURN 79..81
/evidence="ECO:0000244|PDB:2Z3Q"
STRAND 84..86
/evidence="ECO:0000244|PDB:2Z3Q"
STRAND 93..95
/evidence="ECO:0000244|PDB:2Z3Q"
HELIX 97..102
/evidence="ECO:0000244|PDB:2Z3Q"
SEQUENCE 267 AA; 28233 MW; A9CFC885189E96BE CRC64;
MAPRRARGCR TLGLPALLLL LLLRPPATRG ITCPPPMSVE HADIWVKSYS LYSRERYICN
SGFKRKAGTS SLTECVLNKA TNVAHWTTPS LKCIRDPALV HQRPAPPSTV TTAGVTPQPE
SLSPSGKEPA ASSPSSNNTA ATTAAIVPGS QLMPSKSPST GTTEISSHES SHGTPSQTTA
KNWELTASAS HQPPGVYPQG HSDTTVAIST STVLLCGLSA VSLLACYLKS RQTPPLASVE
MEAMEALPVT WGTSSRDEDL ENCSHHL


Related products :

Catalog number Product name Quantity
U1815h CLIA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
U1815h CLIA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E2031h ELISA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
U2031h CLIA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E2031h ELISA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
U2031h CLIA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E0229h ELISA kit Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U0229h CLIA Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229h ELISA Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229b ELISA kit Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U0229b CLIA Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229b ELISA Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E1815r ELISA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
U1815r CLIA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
U1815m CLIA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
U1815r CLIA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
E2031r ELISA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
E2031m ELISA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
U2031r CLIA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
U2031m CLIA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
E2031r ELISA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
E2031m ELISA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
U2031r CLIA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
Pathways :
WP1963: The effect of Glucocorticoids on target gene expression
WP1566: Citrate cycle (TCA cycle)
WP1614: 1- and 2-Methylnaphthalene degradation
WP566: canonical wnt - zebrafish
WP1655: Geraniol degradation
WP2292: Chemokine signaling pathway
WP2272: Pathogenic Escherichia coli infection
WP1003: Ovarian Infertility Genes
WP773: Ovarian Infertility Genes
WP1618: alpha-Linolenic acid metabolism
WP215: noncanonical wnt pathway
WP2199: Seed Development
WP1369: TNF-alpha NF-kB Signaling Pathway
WP273: Ovarian Infertility Genes
WP296: TCA Cycle - biocyc
WP1225: estrogen signalling
WP622: Long-Day Flowering Time Pathway
WP32: Translation Factors
WP210: Cytoplasmic Ribosomal Proteins
WP244: Alpha 6 Beta 4 signaling pathway
WP1835: Interferon alpha/beta signaling
WP433: tRNA Synthetases
WP929: TNF-alpha NF-kB Signaling Pathway
WP263: Ovarian Infertility Genes
WP1224: EBV LMP1 signaling

Related Genes :
[IL15RA] Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]
[IL6R] Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126) [Cleaved into: Soluble interleukin-6 receptor subunit alpha (sIL6R)]
[IL4R IL4RA 582J2.1] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[IL1R1 IL1R IL1RA IL1RT1] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[Il11ra1 Etl2 Il11ra] Interleukin-11 receptor subunit alpha-1 (IL-11 receptor subunit alpha-1) (IL-11R subunit alpha-1) (IL-11R-alpha-1) (IL-11RA1) (Enhancer trap locus homolog 2) (Etl-2) (Novel cytokine receptor 1) (NR-1) (NR1) [Cleaved into: Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)]
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[IL11RA] Interleukin-11 receptor subunit alpha (IL-11 receptor subunit alpha) (IL-11R subunit alpha) (IL-11R-alpha) (IL-11RA) [Cleaved into: Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)]
[Il1r1 Il-1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[Il1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[Il11ra1] Interleukin-11 receptor subunit alpha (IL-11 receptor subunit alpha) (IL-11R subunit alpha) (IL-11R-alpha) (IL-11RA) [Cleaved into: Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)]
[IL6ST] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (CDw130) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124)
[IL10RA IL10R] Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)
[IL2RB IL15RB] Interleukin-2 receptor subunit beta (IL-2 receptor subunit beta) (IL-2R subunit beta) (IL-2RB) (High affinity IL-2 receptor subunit beta) (Interleukin-15 receptor subunit beta) (p70-75) (p75) (CD antigen CD122)
[IL31RA CRL3 GPL UNQ6368/PRO21073/PRO21384] Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)
[IL7R] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CDw127) (CD antigen CD127)
[IL13RA1 IL13R IL13RA] Interleukin-13 receptor subunit alpha-1 (IL-13 receptor subunit alpha-1) (IL-13R subunit alpha-1) (IL-13R-alpha-1) (IL-13RA1) (Cancer/testis antigen 19) (CT19) (CD antigen CD213a1)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[IL5RA IL5R] Interleukin-5 receptor subunit alpha (IL-5 receptor subunit alpha) (IL-5R subunit alpha) (IL-5R-alpha) (IL-5RA) (CDw125) (CD antigen CD125)
[Il3ra Sut-1] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (Interleukin-3 receptor class II alpha chain) (CD antigen CD123)
[Il7r] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CD antigen CD127)
[IL27RA CRL1 TCCR WSX1 UNQ296/PRO336] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Cytokine receptor WSX-1) (Cytokine receptor-like 1) (Type I T-cell cytokine receptor) (TCCR) (ZcytoR1)
[IL13RA2 IL13R] Interleukin-13 receptor subunit alpha-2 (IL-13 receptor subunit alpha-2) (IL-13R subunit alpha-2) (IL-13R-alpha-2) (IL-13RA2) (Interleukin-13-binding protein) (CD antigen CD213a2)
[IL3RA IL3R] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (CD antigen CD123)
[IFNLR1 IL28RA LICR2] Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[IL18R1 IL1RRP] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[Il18r1] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[Il27ra Tccr Wsx1] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Type I T-cell cytokine receptor) (TCCR) (WSX-1)
[IL2RG] Cytokine receptor common subunit gamma (Interleukin-2 receptor subunit gamma) (IL-2 receptor subunit gamma) (IL-2R subunit gamma) (IL-2RG) (gammaC) (p64) (CD antigen CD132)

Bibliography :
No related Items