GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Interleukin-17 receptor C (IL-17 receptor C) (IL-17RC) (Interleukin-17 receptor homolog) (IL17Rhom) (Interleukin-17 receptor-like protein) (IL-17RL) (ZcytoR14)

 I17RC_HUMAN             Reviewed;         791 AA.
Q8NAC3; A8BWC1; A8BWC9; A8BWD5; E9PHG1; E9PHJ6; Q6UVY3; Q6UWD4; Q8NFS1;
Q9BR97;
21-JUN-2005, integrated into UniProtKB/Swiss-Prot.
05-MAY-2009, sequence version 2.
17-JUN-2020, entry version 146.
RecName: Full=Interleukin-17 receptor C;
Short=IL-17 receptor C;
Short=IL-17RC;
AltName: Full=Interleukin-17 receptor homolog;
Short=IL17Rhom;
AltName: Full=Interleukin-17 receptor-like protein;
Short=IL-17RL;
AltName: Full=ZcytoR14;
Flags: Precursor;
Name=IL17RC; ORFNames=UNQ6118/PRO20040/PRO38901;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 5; 6 AND 7), FUNCTION, SUBCELLULAR
LOCATION, TISSUE SPECIFICITY, AND ALTERNATIVE SPLICING.
PubMed=17911633; DOI=10.4049/jimmunol.179.8.5462;
Kuestner R.E., Taft D.W., Haran A., Brandt C.S., Brender T., Lum K.,
Harder B., Okada S., Ostrander C.D., Kreindler J.L., Aujla S.J.,
Reardon B., Moore M., Shea P., Schreckhise R., Bukowski T.R., Presnell S.,
Guerra-Lewis P., Parrish-Novak J., Ellsworth J.L., Jaspers S., Lewis K.E.,
Appleby M., Kolls J.K., Rixon M., West J.W., Gao Z., Levin S.D.;
"Identification of the IL-17 receptor related molecule IL-17RC as the
receptor for IL-17F.";
J. Immunol. 179:5462-5473(2007).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8).
Presnell S.R., Burkhead S.K., Pownder S.L.;
Patent number JP2003504058, 04-FEB-2003.
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND VARIANT LEU-182.
Gilbert J.M., Gorman D.M.;
"Identification of novel IL-17 related receptors.";
Submitted (DEC-2001) to the EMBL/GenBank/DDBJ databases.
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
PubMed=12975309; DOI=10.1101/gr.1293003;
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J.,
Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P.,
Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E., Heldens S., Huang A.,
Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D.,
Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L.,
Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C.,
Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J.,
Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.;
"The secreted protein discovery initiative (SPDI), a large-scale effort to
identify novel human secreted and transmembrane proteins: a bioinformatics
assessment.";
Genome Res. 13:2265-2270(2003).
[5]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), AND VARIANT LEU-182.
TISSUE=Spleen;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
PubMed=16641997; DOI=10.1038/nature04728;
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J.,
Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P.,
Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A.,
Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L.,
Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G.,
Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W.,
Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M.,
Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P.,
Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H.,
Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J.,
Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W.,
Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B.,
Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O.,
Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B.,
Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H.,
Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J.,
Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X.,
Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R.,
Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.;
"The DNA sequence, annotation and analysis of human chromosome 3.";
Nature 440:1194-1198(2006).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
TISSUE=Uterus;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
[8]
PROTEIN SEQUENCE OF 21-35.
PubMed=15340161; DOI=10.1110/ps.04682504;
Zhang Z., Henzel W.J.;
"Signal peptide prediction based on analysis of experimentally verified
cleavage sites.";
Protein Sci. 13:2819-2824(2004).
[9]
ALTERNATIVE SPLICING, AND TISSUE SPECIFICITY.
PubMed=11706037; DOI=10.1074/jbc.m109372200;
Haudenschild D., Moseley T., Rose L., Reddi A.H.;
"Soluble and transmembrane isoforms of novel interleukin-17 receptor-like
protein by RNA splicing and expression in prostate cancer.";
J. Biol. Chem. 277:4309-4316(2002).
[10]
INDUCTION BY HGF AND VEGF.
PubMed=14504135; DOI=10.1038/sj.bjp.0705494;
Gerritsen M.E., Tomlinson J.E., Zlot C., Ziman M., Hwang S.;
"Using gene expression profiling to identify the molecular basis of the
synergistic actions of hepatocyte growth factor and vascular endothelial
growth factor in human endothelial cells.";
Br. J. Pharmacol. 140:595-610(2003).
[11]
FUNCTION, AND SUBUNIT.
PubMed=16785495; DOI=10.4049/jimmunol.177.1.36;
Toy D., Kugler D., Wolfson M., Vanden Bos T., Gurgel J., Derry J.,
Tocker J., Peschon J.;
"Interleukin 17 signals through a heteromeric receptor complex.";
J. Immunol. 177:36-39(2006).
[12]
FUNCTION, AND SUBUNIT.
PubMed=18684971; DOI=10.4049/jimmunol.181.4.2799;
Wright J.F., Bennett F., Li B., Brooks J., Luxenberg D.P., Whitters M.J.,
Tomkinson K.N., Fitz L.J., Wolfman N.M., Collins M.,
Dunussi-Joannopoulos K., Chatterjee-Kishore M., Carreno B.M.;
"The human IL-17F/IL-17A heterodimeric cytokine signals through the IL-
17RA/IL-17RC receptor complex.";
J. Immunol. 181:2799-2805(2008).
[13]
INVOLVEMENT IN CANDF9.
PubMed=25918342; DOI=10.1084/jem.20141065;
Ling Y., Cypowyj S., Aytekin C., Galicchio M., Camcioglu Y., Nepesov S.,
Ikinciogullari A., Dogu F., Belkadi A., Levy R., Migaud M., Boisson B.,
Bolze A., Itan Y., Goudin N., Cottineau J., Picard C., Abel L.,
Bustamante J., Casanova J.L., Puel A.;
"Inherited IL-17RC deficiency in patients with chronic mucocutaneous
candidiasis.";
J. Exp. Med. 212:619-631(2015).
-!- FUNCTION: Receptor for IL17A and IL17F homodimers as part of a
heterodimeric complex with IL17RA (PubMed:16785495). Receptor for the
heterodimer formed by IL17A and IL17B as part of a heterodimeric
complex with IL17RA (PubMed:18684971). Has also been shown to be the
cognate receptor for IL17F and to bind IL17A with high affinity without
the need for IL17RA (PubMed:17911633). Activation of IL17RC leads to
induction of expression of inflammatory chemokines and cytokines such
as CXCL1 (PubMed:16785495). {ECO:0000269|PubMed:16785495,
ECO:0000269|PubMed:17911633, ECO:0000269|PubMed:18684971}.
-!- FUNCTION: [Isoform 5]: Receptor for both IL17A and IL17F.
{ECO:0000269|PubMed:16785495}.
-!- FUNCTION: [Isoform 6]: Does not bind IL17A or IL17F.
{ECO:0000269|PubMed:16785495}.
-!- FUNCTION: [Isoform 7]: Does not bind IL17A or IL17F.
{ECO:0000269|PubMed:16785495}.
-!- FUNCTION: [Isoform 8]: Receptor for both IL17A and IL17F.
{ECO:0000269|PubMed:16785495}.
-!- SUBUNIT: Heterodimer with IL17RA (PubMed:16785495, PubMed:18684971).
Heterodimerization with IL17RA is independent of the cytoplasmic tail
(By similarity). Associates with non-glycosylated IL17RA constitutively
(By similarity). Binding of IL17A and IL17F induces association with
glycosylated IL17RA (By similarity). Interacts (via SEFIR domain and
extended downstream region) with TRAF3IP2/ACT1 (phosphorylated) (By
similarity). {ECO:0000250|UniProtKB:Q8K4C2,
ECO:0000269|PubMed:16785495, ECO:0000269|PubMed:18684971}.
-!- SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:17911633};
Single-pass type I membrane protein {ECO:0000255}. Note=Soluble
isoforms may be produced.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=8;
Comment=Additional isoforms seem to exist.;
Name=1;
IsoId=Q8NAC3-1; Sequence=Displayed;
Name=2;
IsoId=Q8NAC3-2; Sequence=VSP_014138;
Name=3;
IsoId=Q8NAC3-3; Sequence=VSP_014138, VSP_014139;
Name=4;
IsoId=Q8NAC3-4; Sequence=VSP_014138, VSP_014139, VSP_014140,
VSP_014141;
Name=5; Synonyms=IL17RC {ECO:0000303|PubMed:17911633};
IsoId=Q8NAC3-5; Sequence=VSP_014138, VSP_047292;
Name=6; Synonyms=IL17RC-delta7,12 {ECO:0000303|PubMed:17911633};
IsoId=Q8NAC3-6; Sequence=VSP_014138, VSP_014139, VSP_047291;
Name=7; Synonyms=IL17RC-delta12 {ECO:0000303|PubMed:17911633};
IsoId=Q8NAC3-7; Sequence=VSP_014138, VSP_047291, VSP_047292;
Name=8; Synonyms=IL17RC-delta7 {ECO:0000303|PubMed:17911633};
IsoId=Q8NAC3-8; Sequence=VSP_014138, VSP_014139, VSP_047292;
-!- TISSUE SPECIFICITY: Expressed in prostate, skeletal muscle, kidney and
placenta (at protein level) (PubMed:11706037). Expressed in brain,
cartilage, colon, heart, intestine, kidney, liver, lung, muscle,
placenta, and prostate (PubMed:11706037). Also detected in thyroid,
trachea and adrenal gland (PubMed:17911633). Low expression in thymus
and leukocytes (PubMed:11706037). {ECO:0000269|PubMed:11706037,
ECO:0000269|PubMed:17911633}.
-!- INDUCTION: By HGF and VEGF. {ECO:0000269|PubMed:14504135}.
-!- DISEASE: Candidiasis, familial, 9 (CANDF9) [MIM:616445]: A disorder
characterized by altered immune responses and impaired clearance of
fungal infections, selective against Candida. It is characterized by
persistent and/or recurrent infections of the skin, nails and mucous
membranes caused by organisms of the genus Candida, mainly Candida
albicans. {ECO:0000269|PubMed:25918342}. Note=The disease is caused by
mutations affecting the gene represented in this entry.
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; EF676032; ABV44615.1; -; mRNA.
EMBL; EF676033; ABV44616.1; -; mRNA.
EMBL; EF676034; ABV44617.1; -; mRNA.
EMBL; BD292072; -; NOT_ANNOTATED_CDS; mRNA.
EMBL; AF458065; AAM77569.1; -; mRNA.
EMBL; AY358840; AAQ89199.1; -; mRNA.
EMBL; AY359098; AAQ89456.1; -; mRNA.
EMBL; AK092907; BAC04001.1; -; mRNA.
EMBL; AC018809; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC006411; -; NOT_ANNOTATED_CDS; mRNA.
CCDS; CCDS2590.1; -. [Q8NAC3-1]
CCDS; CCDS2591.2; -. [Q8NAC3-3]
CCDS; CCDS46746.1; -. [Q8NAC3-2]
CCDS; CCDS56240.1; -. [Q8NAC3-5]
CCDS; CCDS56241.1; -. [Q8NAC3-6]
CCDS; CCDS74898.1; -. [Q8NAC3-7]
RefSeq; NP_001190192.1; NM_001203263.1. [Q8NAC3-5]
RefSeq; NP_001190193.1; NM_001203264.1.
RefSeq; NP_001190194.1; NM_001203265.1. [Q8NAC3-6]
RefSeq; NP_116121.2; NM_032732.5. [Q8NAC3-3]
RefSeq; NP_703190.1; NM_153460.3. [Q8NAC3-2]
RefSeq; NP_703191.1; NM_153461.3. [Q8NAC3-1]
RefSeq; XP_016862835.1; XM_017007346.1.
PDB; 6HG4; X-ray; 3.32 A; B=95-538.
PDB; 6HG9; X-ray; 3.62 A; B=95-538.
PDB; 6HGA; X-ray; 2.60 A; B=279-538.
PDBsum; 6HG4; -.
PDBsum; 6HG9; -.
PDBsum; 6HGA; -.
BioGRID; 124278; 53.
IntAct; Q8NAC3; 45.
STRING; 9606.ENSP00000295981; -.
DrugCentral; Q8NAC3; -.
iPTMnet; Q8NAC3; -.
PhosphoSitePlus; Q8NAC3; -.
BioMuta; IL17RC; -.
DMDM; 229462881; -.
jPOST; Q8NAC3; -.
PaxDb; Q8NAC3; -.
PeptideAtlas; Q8NAC3; -.
PRIDE; Q8NAC3; -.
ProteomicsDB; 20526; -.
ProteomicsDB; 20554; -.
ProteomicsDB; 72669; -. [Q8NAC3-1]
ProteomicsDB; 72670; -. [Q8NAC3-2]
ProteomicsDB; 72671; -. [Q8NAC3-3]
ProteomicsDB; 72672; -. [Q8NAC3-4]
Antibodypedia; 10412; 313 antibodies.
Ensembl; ENST00000295981; ENSP00000295981; ENSG00000163702. [Q8NAC3-1]
Ensembl; ENST00000383812; ENSP00000373323; ENSG00000163702. [Q8NAC3-3]
Ensembl; ENST00000403601; ENSP00000384969; ENSG00000163702. [Q8NAC3-2]
Ensembl; ENST00000413608; ENSP00000396064; ENSG00000163702. [Q8NAC3-5]
Ensembl; ENST00000416074; ENSP00000395315; ENSG00000163702. [Q8NAC3-7]
Ensembl; ENST00000455057; ENSP00000407894; ENSG00000163702. [Q8NAC3-6]
GeneID; 84818; -.
KEGG; hsa:84818; -.
UCSC; uc003btz.4; human. [Q8NAC3-1]
CTD; 84818; -.
DisGeNET; 84818; -.
EuPathDB; HostDB:ENSG00000163702.18; -.
GeneCards; IL17RC; -.
HGNC; HGNC:18358; IL17RC.
HPA; ENSG00000163702; Low tissue specificity.
MalaCards; IL17RC; -.
MIM; 610925; gene.
MIM; 616445; phenotype.
neXtProt; NX_Q8NAC3; -.
OpenTargets; ENSG00000163702; -.
Orphanet; 1334; Chronic mucocutaneous candidiasis.
PharmGKB; PA134986616; -.
eggNOG; ENOG410IES9; Eukaryota.
eggNOG; ENOG4111MUJ; LUCA.
GeneTree; ENSGT00730000111286; -.
HOGENOM; CLU_026893_1_0_1; -.
InParanoid; Q8NAC3; -.
KO; K05166; -.
OMA; CLWSDSL; -.
OrthoDB; 297610at2759; -.
PhylomeDB; Q8NAC3; -.
TreeFam; TF335852; -.
Reactome; R-HSA-448424; Interleukin-17 signaling.
BioGRID-ORCS; 84818; 4 hits in 786 CRISPR screens.
ChiTaRS; IL17RC; human.
GeneWiki; IL17RC; -.
GenomeRNAi; 84818; -.
Pharos; Q8NAC3; Tclin.
PRO; PR:Q8NAC3; -.
Proteomes; UP000005640; Chromosome 3.
RNAct; Q8NAC3; protein.
Bgee; ENSG00000163702; Expressed in adenohypophysis and 191 other tissues.
ExpressionAtlas; Q8NAC3; baseline and differential.
Genevisible; Q8NAC3; HS.
GO; GO:0009986; C:cell surface; IEA:Ensembl.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0030368; F:interleukin-17 receptor activity; IDA:MGI.
GO; GO:0005102; F:signaling receptor binding; IEA:Ensembl.
GO; GO:0050832; P:defense response to fungus; IEA:Ensembl.
GO; GO:0071621; P:granulocyte chemotaxis; IEA:Ensembl.
GO; GO:0097400; P:interleukin-17-mediated signaling pathway; TAS:Reactome.
GO; GO:1900017; P:positive regulation of cytokine production involved in inflammatory response; IEA:Ensembl.
GO; GO:2000778; P:positive regulation of interleukin-6 secretion; IEA:Ensembl.
InterPro; IPR039465; IL-17_rcpt-like.
InterPro; IPR027841; IL-17_rcpt_C/E_N.
InterPro; IPR013568; SEFIR_dom.
PANTHER; PTHR15583; PTHR15583; 1.
Pfam; PF15037; IL17_R_N; 1.
Pfam; PF08357; SEFIR; 1.
PROSITE; PS51534; SEFIR; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Cell membrane;
Direct protein sequencing; Glycoprotein; Membrane; Polymorphism; Receptor;
Reference proteome; Signal; Transmembrane; Transmembrane helix.
SIGNAL 1..20
/evidence="ECO:0000269|PubMed:15340161"
CHAIN 21..791
/note="Interleukin-17 receptor C"
/id="PRO_0000011034"
TOPO_DOM 21..538
/note="Extracellular"
/evidence="ECO:0000255"
TRANSMEM 539..559
/note="Helical"
/evidence="ECO:0000255"
TOPO_DOM 560..791
/note="Cytoplasmic"
/evidence="ECO:0000255"
DOMAIN 583..735
/note="SEFIR"
/evidence="ECO:0000255|PROSITE-ProRule:PRU00867"
CARBOHYD 189
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 257
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 284
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 297
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 324
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 334
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 420
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 443
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 477
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
VAR_SEQ 36..106
/note="Missing (in isoform 2, isoform 3, isoform 4, isoform
5, isoform 6, isoform 7 and isoform 8)"
/evidence="ECO:0000269|PubMed:17911633,
ECO:0000303|PubMed:12975309, ECO:0000303|PubMed:15489334,
ECO:0000303|PubMed:17911633"
/id="VSP_014138"
VAR_SEQ 264..278
/note="Missing (in isoform 3, isoform 4, isoform 6 and
isoform 8)"
/evidence="ECO:0000269|PubMed:17911633,
ECO:0000303|PubMed:12975309, ECO:0000303|PubMed:15489334"
/id="VSP_014139"
VAR_SEQ 425..441
/note="Missing (in isoform 6 and isoform 7)"
/evidence="ECO:0000269|PubMed:17911633, ECO:0000305"
/id="VSP_047291"
VAR_SEQ 566..578
/note="Missing (in isoform 5, isoform 7 and isoform 8)"
/evidence="ECO:0000269|PubMed:17911633, ECO:0000305"
/id="VSP_047292"
VAR_SEQ 579..624
/note="AAARGRAALLLYSADDSGFERLVGALASALCQLPLRVAVDLWSRRE -> GE
WEQALGGGPPPGSQACASSPLPSPSVFSGSGRQGPRGSAPLLSR (in isoform
4)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_014140"
VAR_SEQ 625..791
/note="Missing (in isoform 4)"
/evidence="ECO:0000303|PubMed:15489334"
/id="VSP_014141"
VARIANT 182
/note="S -> L (in dbSNP:rs708567)"
/evidence="ECO:0000269|PubMed:14702039,
ECO:0000269|PubMed:17911633"
/id="VAR_022680"
CONFLICT 241
/note="E -> G (in Ref. 4; AAQ89199)"
CONFLICT 378
/note="Q -> R (in Ref. 1; ABV44615/ABV44616/ABV44617, 2;
BD292072, 3; AAM77569, 4; AAQ89199/AAQ89456 and 5;
BAC04001)"
/evidence="ECO:0000305"
SEQUENCE 791 AA; 86240 MW; E9A4032C17ECD4AF CRC64;
MPVPWFLLSL ALGRSPVVLS LERLVGPQDA THCSPVSLEP WGDEERLRVQ FLAQQSLSLA
PVTAATARTA LSGLSGADGR REERGRGKSW VCLSLGGSGN TEPQKKGLSC RLWDSDILCL
PGDIVPAPGP VLAPTHLQTE LVLRCQKETD CDLCLRVAVH LAVHGHWEEP EDEEKFGGAA
DSGVEEPRNA SLQAQVVLSF QAYPTARCVL LEVQVPAALV QFGQSVGSVV YDCFEAALGS
EVRIWSYTQP RYEKELNHTQ QLPDCRGLEV WNSIPSCWAL PWLNVSADGD NVHLVLNVSE
EQHFGLSLYW NQVQGPPKPR WHKNLTGPQI ITLNHTDLVP CLCIQVWPLE PDSVRTNICP
FREDPRAHQN LWQAARLQLL TLQSWLLDAP CSLPAEAALC WRAPGGDPCQ PLVPPLSWEN
VTVDKVLEFP LLKGHPNLCV QVNSSEKLQL QECLWADSLG PLKDDVLLLE TRGPQDNRSL
CALEPSGCTS LPSKASTRAA RLGEYLLQDL QSGQCLQLWD DDLGALWACP MDKYIHKRWA
LVWLACLLFA AALSLILLLK KDHAKGWLRL LKQDVRSGAA ARGRAALLLY SADDSGFERL
VGALASALCQ LPLRVAVDLW SRRELSAQGP VAWFHAQRRQ TLQEGGVVVL LFSPGAVALC
SEWLQDGVSG PGAHGPHDAF RASLSCVLPD FLQGRAPGSY VGACFDRLLH PDAVPALFRT
VPVFTLPSQL PDFLGALQQP RAPRSGRLQE RAEQVSRALQ PALDSYFHPP GTPAPGRGVG
PGAGPGAGDG T


Related products :

Catalog number Product name Quantity
orb82731 Human IL4 protein Interleukin-4 (IL4) is a pleiotropic cytokine produced by activated T cells. IL4 is a ligandfor interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which maycontri 1 mg
E0066h ELISA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor typ 96T
U0066h CLIA CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type 96T
U0066r CLIA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus norve 96T
E0066m ELISA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus muscu 96T
E0065m ELISA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus musc 96T
U0066m CLIA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus muscul 96T
U0065m CLIA CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus muscu 96T
U0065r CLIA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norvegi 96T
E0066r ELISA CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus norv 96T
E0065r ELISA CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus norveg 96T
E0065r ELISA kit CD121 antigen-like family member A,Il1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,p80,Rat,Rattus n 96T
E0066m ELISA kit CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Mouse,Mus 96T
E0066r ELISA kit CD121 antigen-like family member B,Il1r2,Il-1r2,IL-1R-2,Il1rb,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 receptor type II,Rat,Rattus 96T
E0065m ELISA kit CD121 antigen-like family member A,Il1r1,Il-1r1,IL-1R-1,Il1ra,IL-1R-alpha,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 receptor type I,Mouse,Mus 96T
26-207 IL1RAPL2 is a member of the interleukin 1 receptor family. This protein is similar to the interleukin 1 accessory proteins, and is most closely related to interleukin 1 receptor accessory protein-like 0.05 mg
E0065h ELISA kit CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 r 96T
E0066h ELISA kit CD121 antigen-like family member B,CDw121b,Homo sapiens,Human,IL1R2,IL-1R-2,IL1RB,IL-1R-beta,IL-1RT2,IL-1RT-2,Interleukin-1 receptor beta,Interleukin-1 receptor type 2,Interleukin-1 recepto 96T
U0065h CLIA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recepto 96T
E0065h ELISA CD121 antigen-like family member A,Homo sapiens,Human,IL1R,IL1R1,IL-1R-1,IL1RA,IL-1R-alpha,IL1RT1,IL-1RT1,IL-1RT-1,Interleukin-1 receptor alpha,Interleukin-1 receptor type 1,Interleukin-1 recept 96T
orb82722 Human IL1 RN protein Recombinant Human Interleukin-1 Receptor Antagonist is a member of the Interleukin-1cytokine family. IL1RN inhibits the activities of Interleukin-1 alpha (IL1A) and Interleukin-1 1 mg
18-783-78379 GOAT ANTI IRAK4 (N-TERMINAL) - Interleukin-1 receptor-associated kinase 4 short form variant 4; Interleukin-1 receptor-associated kinase 4 short form variant 3; Interleukin-1 receptor-associated kinas 0.1 mg
U2006h CLIA kit CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
E2006h ELISA kit CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
E2006h ELISA CDw128b,C-X-C chemokine receptor type 2,CXCR2,CXC-R2,CXCR-2,GRO_MGSA receptor,High affinity interleukin-8 receptor B,Homo sapiens,Human,IL-8 receptor type 2,IL-8R B,IL8RB 96T
Pathways :
WP2272: Pathogenic Escherichia coli infection
WP2292: Chemokine signaling pathway
WP2079: Serotonin Receptor 2 and STAT3 Signaling
WP407: Kit Receptor Signaling Pathway
WP927: Signaling of Hepatocyte Growth Factor Receptor
WP1004: Kit Receptor Signaling Pathway
WP768: EPO Receptor Signaling
WP1183: Toll-like receptor signaling pathway
WP783: Androgen Receptor Signaling Pathway
WP1249: EPO Receptor Signaling
WP2118: Arrhythmogenic right ventricular cardiomyopathy
WP480: T Cell Receptor Signaling Pathway
WP949: Toll-like receptor signaling pathway
WP1025: B Cell Receptor Signaling Pathway
WP57: Signal Transduction of S1P Receptor
WP26: Signal Transduction of S1P Receptor
WP810: Signaling of Hepatocyte Growth Factor Receptor
WP1309: Toll-like receptor signaling pathway
WP304: Kit receptor signaling pathway
WP878: EPO Receptor Signaling
WP1345: T Cell Receptor Signaling Pathway
WP68: Androgen Receptor Signaling Pathway
WP1121: Kit Receptor Signaling Pathway
WP1913: Signaling by Insulin receptor
WP732: Serotonin Receptor 2 and ELK-SRF/GATA4 signaling

Related Genes :
[IL17RC UNQ6118/PRO20040/PRO38901] Interleukin-17 receptor C (IL-17 receptor C) (IL-17RC) (Interleukin-17 receptor homolog) (IL17Rhom) (Interleukin-17 receptor-like protein) (IL-17RL) (ZcytoR14)
[IL17RD IL17RLM SEF UNQ6115/PRO20026] Interleukin-17 receptor D (IL-17 receptor D) (IL-17RD) (IL17Rhom) (Interleukin-17 receptor-like protein) (Sef homolog) (hSef)
[IL17RB CRL4 EVI27 IL17BR UNQ2501/PRO19612] Interleukin-17 receptor B (IL-17 receptor B) (IL-17RB) (Cytokine receptor-like 4) (IL-17 receptor homolog 1) (IL-17Rh1) (IL17Rh1) (Interleukin-17B receptor) (IL-17B receptor)
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il17rb Evi27 Il17br] Interleukin-17 receptor B (IL-17 receptor B) (IL-17RB) (IL-17 receptor homolog 1) (IL-17ER) (IL-17Rh1) (IL17Rh1) (Interleukin-17B receptor) (IL-17B receptor)
[Il17re] Interleukin-17 receptor E (IL-17 receptor E) (IL-17RE)
[IL17RA IL17R] Interleukin-17 receptor A (IL-17 receptor A) (IL-17RA) (CDw217) (CD antigen CD217)
[IL36RN Fil1d Il1f5 Il1h3 Il1hy1] Interleukin-36 receptor antagonist protein (IL-36Ra) (Interleukin-1 HY1) (IL-1HY1) (Interleukin-1 delta) (IL-1 delta) (Interleukin-1 family member 5) (IL-1F5) (Interleukin-1 homolog 3) (IL-1H3) (Interleukin-1-like protein 1) (IL-1L1)
[IL36RN FIL1D IL1F5 IL1HY1 IL1L1 IL1RP3 UNQ1896/PRO4342] Interleukin-36 receptor antagonist protein (IL-36Ra) (FIL1 delta) (IL-1-related protein 3) (IL-1RP3) (Interleukin-1 HY1) (IL-1HY1) (Interleukin-1 delta) (IL-1 delta) (Interleukin-1 family member 5) (IL-1F5) (Interleukin-1 receptor antagonist homolog 1) (IL-1ra homolog 1) (Interleukin-1-like protein 1) (IL-1L1)
[IL31RA CRL3 GPL UNQ6368/PRO21073/PRO21384] Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)
[IL17RE UNQ3056/PRO9877] Interleukin-17 receptor E (IL-17 receptor E) (IL-17RE)
[Il11ra1 Etl2 Il11ra] Interleukin-11 receptor subunit alpha-1 (IL-11 receptor subunit alpha-1) (IL-11R subunit alpha-1) (IL-11R-alpha-1) (IL-11RA1) (Enhancer trap locus homolog 2) (Etl-2) (Novel cytokine receptor 1) (NR-1) (NR1)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[Il1rap] Interleukin-1 receptor accessory protein (IL-1 receptor accessory protein) (IL-1RAcP) (EC 3.2.2.6) (Interleukin-33 receptot beta chain)
[Il3ra Sut-1] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (Interleukin-3 receptor class II alpha chain) (CD antigen CD123)
[IL1RAP C3orf13 IL1R3] Interleukin-1 receptor accessory protein (IL-1 receptor accessory protein) (IL-1RAcP) (EC 3.2.2.6) (Interleukin-1 receptor 3) (IL-1R-3) (IL-1R3)
[IL1R1 IL1R IL1RA IL1RT1] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL18RAP IL1R7] Interleukin-18 receptor accessory protein (IL-18 receptor accessory protein) (IL-18RAcP) (EC 3.2.2.6) (Accessory protein-like) (AcPL) (CD218 antigen-like family member B) (CDw218b) (IL-1R accessory protein-like) (IL-1RAcPL) (Interleukin-1 receptor 7) (IL-1R-7) (IL-1R7) (Interleukin-18 receptor accessory protein-like) (Interleukin-18 receptor beta) (IL-18R-beta) (IL-18Rbeta) (CD antigen CD218b)
[Il1r1 Il-1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IFNLR1 IL28RA LICR2] Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)
[Il12rb1 Il12rb] Interleukin-12 receptor subunit beta-1 (IL-12 receptor subunit beta-1) (IL-12R subunit beta-1) (IL-12R-beta-1) (IL-12 receptor beta component) (CD antigen CD212)
[Il27ra Tccr Wsx1] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Type I T-cell cytokine receptor) (TCCR) (WSX-1)
[IL4R IL4RA 582J2.1] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il7r] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CD antigen CD127)
[Il12rb2] Interleukin-12 receptor subunit beta-2 (IL-12 receptor subunit beta-2) (IL-12R subunit beta-2) (IL-12R-beta-2) (IL-12RB2)
[IL18R1 IL1RRP] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[Il1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL10RB CRFB4 D21S58 D21S66] Interleukin-10 receptor subunit beta (IL-10 receptor subunit beta) (IL-10R subunit beta) (IL-10RB) (Cytokine receptor class-II member 4) (Cytokine receptor family 2 member 4) (CRF2-4) (Interleukin-10 receptor subunit 2) (IL-10R subunit 2) (IL-10R2) (CD antigen CDw210b)
[IL2RB IL15RB] Interleukin-2 receptor subunit beta (IL-2 receptor subunit beta) (IL-2R subunit beta) (IL-2RB) (High affinity IL-2 receptor subunit beta) (Interleukin-15 receptor subunit beta) (p70-75) (p75) (CD antigen CD122)
[IL10RA IL10R] Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)

Bibliography :