GENTAUR Belgium BVBA BE0473327336 Voortstraat 49, 1910 Kampenhout BELGIUM Tel 0032 16 58 90 45
GENTAUR U.S.A Genprice Inc,Logistics 547 Yurok Circle, SanJose, CA 95123
Tel (408) 780-0908, Fax (408) 780-0908, [email protected]

Did you know ? If you order before Friday 14h we deliver 90PCT of the the time next Tuesday, Gentaur another in time delivery

Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (CD antigen CD123)

 IL3RA_HUMAN             Reviewed;         378 AA.
P26951; A8K3F3; B9VI81; Q5HYQ7; Q5HYQ8; Q9UEH7;
01-OCT-1993, integrated into UniProtKB/Swiss-Prot.
01-OCT-1993, sequence version 1.
12-AUG-2020, entry version 184.
RecName: Full=Interleukin-3 receptor subunit alpha;
Short=IL-3 receptor subunit alpha;
Short=IL-3R subunit alpha;
Short=IL-3R-alpha;
Short=IL-3RA;
AltName: CD_antigen=CD123;
Flags: Precursor;
Name=IL3RA; Synonyms=IL3R;
Homo sapiens (Human).
Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
Homo.
NCBI_TaxID=9606;
[1]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=1833064; DOI=10.1016/0092-8674(91)90039-2;
Kitamura T., Sato N., Arai K., Miyajima A.;
"Expression cloning of the human IL-3 receptor cDNA reveals a shared beta
subunit for the human IL-3 and GM-CSF receptors.";
Cell 66:1165-1174(1991).
[2]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
PubMed=7887951; DOI=10.1006/bbrc.1995.1346;
Kosugi H., Nakagawa Y., Hotta T., Saito H., Miyajima A., Arai K.,
Yokota T.;
"Structure of the gene encoding the alpha subunit of the human interleukin
3 receptor.";
Biochem. Biophys. Res. Commun. 208:360-367(1995).
[3]
NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), AND ALTERNATIVE SPLICING.
PubMed=19109256; DOI=10.1074/jbc.m808197200;
Chen J., Olsen J., Ford S., Mirza S., Walker A., Murphy J.M., Young I.G.;
"A new isoform of IL-3 receptor alpha with novel differentiation activity
and high affinity binding mode.";
J. Biol. Chem. 284:5763-5773(2009).
[4]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Lung;
PubMed=14702039; DOI=10.1038/ng1285;
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R.,
Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H.,
Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.,
Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K.,
Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H.,
Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M.,
Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K.,
Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T.,
Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M.,
Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S.,
Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H.,
Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K.,
Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N.,
Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S.,
Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O.,
Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H.,
Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B.,
Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y.,
Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K.,
Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T.,
Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T.,
Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y.,
Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H.,
Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y.,
Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H.,
Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O.,
Isogai T., Sugano S.;
"Complete sequencing and characterization of 21,243 full-length human
cDNAs.";
Nat. Genet. 36:40-45(2004).
[5]
NUCLEOTIDE SEQUENCE [GENOMIC DNA], AND VARIANTS THR-12; GLY-77; THR-123 AND
LEU-323.
SeattleSNPs variation discovery resource;
Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases.
[6]
NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], AND VARIANT THR-12.
PubMed=15772651; DOI=10.1038/nature03440;
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D.,
Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L.,
Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.,
Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A.,
Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P.,
Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D.,
Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D.,
Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L.,
Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P.,
Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G.,
Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J.,
Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D.,
Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L.,
Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z.,
Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S.,
Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S.,
Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O.,
Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H.,
Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T.,
Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L.,
Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R.,
Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y.,
Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K.,
Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J.,
Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L.,
Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S.,
Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A.,
Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L.,
Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D.,
Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H.,
McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S.,
Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C.,
Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S.,
Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V.,
Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K.,
Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K.,
Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D.,
Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R.,
Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B.,
Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C.,
d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q.,
Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N.,
Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A.,
Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J.,
Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A.,
Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F.,
Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L.,
Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S.,
Rogers J., Bentley D.R.;
"The DNA sequence of the human X chromosome.";
Nature 434:325-337(2005).
[7]
NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
TISSUE=Brain;
PubMed=15489334; DOI=10.1101/gr.2596504;
The MGC Project Team;
"The status, quality, and expansion of the NIH full-length cDNA project:
the Mammalian Gene Collection (MGC).";
Genome Res. 14:2121-2127(2004).
-!- FUNCTION: This is a receptor for interleukin-3.
-!- SUBUNIT: Heterodimer of an alpha and a beta subunit. The beta subunit
is common to the IL3, IL5 and GM-CSF receptors.
-!- INTERACTION:
P26951; O95393: BMP10; NbExp=3; IntAct=EBI-1757512, EBI-3922513;
P26951; O14523: C2CD2L; NbExp=3; IntAct=EBI-1757512, EBI-12822627;
P26951; Q8N6F1-2: CLDN19; NbExp=3; IntAct=EBI-1757512, EBI-12256978;
P26951; P54852: EMP3; NbExp=3; IntAct=EBI-1757512, EBI-3907816;
P26951; Q8WWP7: GIMAP1; NbExp=3; IntAct=EBI-1757512, EBI-11991950;
P26951; Q8N5M9: JAGN1; NbExp=3; IntAct=EBI-1757512, EBI-10266796;
P26951; Q9NZG7: NINJ2; NbExp=3; IntAct=EBI-1757512, EBI-10317425;
P26951; Q9NXK6: PAQR5; NbExp=3; IntAct=EBI-1757512, EBI-10316423;
P26951; Q9Y6X1: SERP1; NbExp=3; IntAct=EBI-1757512, EBI-10329948;
P26951; Q0VAQ4: SMAGP; NbExp=3; IntAct=EBI-1757512, EBI-10226799;
P26951; Q8N2H4: SYS1; NbExp=3; IntAct=EBI-1757512, EBI-13075176;
P26951; Q5BJH2-2: TMEM128; NbExp=3; IntAct=EBI-1757512, EBI-10694905;
P26951; Q9BVK8: TMEM147; NbExp=3; IntAct=EBI-1757512, EBI-348587;
P26951; Q8TBM7: TMEM254; NbExp=3; IntAct=EBI-1757512, EBI-11956809;
P26951; Q6PI78: TMEM65; NbExp=3; IntAct=EBI-1757512, EBI-6656213;
P26951; A5PKU2: TUSC5; NbExp=3; IntAct=EBI-1757512, EBI-11988865;
P26951; O95183: VAMP5; NbExp=3; IntAct=EBI-1757512, EBI-10191195;
-!- SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein.
-!- ALTERNATIVE PRODUCTS:
Event=Alternative splicing; Named isoforms=2;
Name=1; Synonyms=SP1;
IsoId=P26951-1; Sequence=Displayed;
Name=2; Synonyms=SP2;
IsoId=P26951-2; Sequence=VSP_040622;
-!- DOMAIN: The WSXWS motif appears to be necessary for proper protein
folding and thereby efficient intracellular transport and cell-surface
receptor binding.
-!- DOMAIN: The box 1 motif is required for JAK interaction and/or
activation.
-!- MISCELLANEOUS: The gene coding for this protein is located in the
pseudoautosomal region 1 (PAR1) of X and Y chromosomes.
-!- SIMILARITY: Belongs to the type I cytokine receptor family. Type 5
subfamily. {ECO:0000305}.
-!- SEQUENCE CAUTION:
Sequence=BAA08393.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305};
-!- WEB RESOURCE: Name=Atlas of Genetics and Cytogenetics in Oncology and
Haematology;
URL="http://atlasgeneticsoncology.org/Genes/IL3RAID40959chXp22Yp13.html";
-!- WEB RESOURCE: Name=SeattleSNPs;
URL="http://pga.gs.washington.edu/data/il3ra/";
---------------------------------------------------------------------------
Copyrighted by the UniProt Consortium, see https://www.uniprot.org/terms
Distributed under the Creative Commons Attribution (CC BY 4.0) License
---------------------------------------------------------------------------
EMBL; M74782; AAA59148.1; -; mRNA.
EMBL; D49410; BAA08393.1; ALT_SEQ; Genomic_DNA.
EMBL; FJ550347; ACM24116.1; -; mRNA.
EMBL; AK290568; BAF83257.1; -; mRNA.
EMBL; AY789109; AAV40832.1; -; Genomic_DNA.
EMBL; BX296563; CAI39694.1; -; Genomic_DNA.
EMBL; AL683870; CAI39694.1; JOINED; Genomic_DNA.
EMBL; BX119906; CAI39694.1; JOINED; Genomic_DNA.
EMBL; BX296563; CAI39695.1; -; Genomic_DNA.
EMBL; BX119906; CAI39695.1; JOINED; Genomic_DNA.
EMBL; BX901885; -; NOT_ANNOTATED_CDS; Genomic_DNA.
EMBL; BC035407; AAH35407.1; -; mRNA.
CCDS; CCDS14113.1; -. [P26951-1]
CCDS; CCDS59158.1; -. [P26951-2]
PIR; A40266; A40266.
RefSeq; NP_001254642.1; NM_001267713.1. [P26951-2]
RefSeq; NP_002174.1; NM_002183.3. [P26951-1]
RefSeq; XP_005274488.1; XM_005274431.4. [P26951-1]
RefSeq; XP_005274837.1; XM_005274780.4. [P26951-1]
PDB; 4JZJ; X-ray; 2.80 A; C/D=20-307.
PDB; 5UV8; X-ray; 2.70 A; A/G=20-307.
PDB; 5UWC; X-ray; 2.40 A; G=20-307.
PDB; 6NMY; X-ray; 3.30 A; F/M=20-307.
PDBsum; 4JZJ; -.
PDBsum; 5UV8; -.
PDBsum; 5UWC; -.
PDBsum; 6NMY; -.
SMR; P26951; -.
BioGRID; 109778; 12.
DIP; DIP-3293N; -.
IntAct; P26951; 29.
STRING; 9606.ENSP00000327890; -.
ChEMBL; CHEMBL3712987; -.
DrugBank; DB00020; Sargramostim.
DrugBank; DB14731; Tagraxofusp.
GlyGen; P26951; 9 sites.
iPTMnet; P26951; -.
PhosphoSitePlus; P26951; -.
BioMuta; IL3RA; -.
DMDM; 417184; -.
jPOST; P26951; -.
MassIVE; P26951; -.
PaxDb; P26951; -.
PeptideAtlas; P26951; -.
PRIDE; P26951; -.
ProteomicsDB; 54369; -. [P26951-1]
ProteomicsDB; 54370; -. [P26951-2]
ABCD; P26951; 60 sequenced antibodies.
Antibodypedia; 565; 1076 antibodies.
DNASU; 3563; -.
Ensembl; ENST00000331035; ENSP00000327890; ENSG00000185291. [P26951-1]
Ensembl; ENST00000381469; ENSP00000370878; ENSG00000185291. [P26951-2]
GeneID; 3563; -.
KEGG; hsa:3563; -.
UCSC; uc004cps.4; human. [P26951-1]
CTD; 3563; -.
DisGeNET; 3563; -.
EuPathDB; HostDB:ENSG00000185291.11; -.
GeneCards; IL3RA; -.
HGNC; HGNC:6012; IL3RA.
HPA; ENSG00000185291; Group enriched (blood, breast, vagina).
MIM; 308385; gene.
MIM; 430000; gene.
neXtProt; NX_P26951; -.
OpenTargets; ENSG00000185291; -.
PharmGKB; PA29831; -.
eggNOG; ENOG502RZVR; Eukaryota.
GeneTree; ENSGT00940000163802; -.
HOGENOM; CLU_039627_2_0_1; -.
InParanoid; P26951; -.
KO; K04737; -.
OMA; RVASPPF; -.
OrthoDB; 1201451at2759; -.
PhylomeDB; P26951; -.
TreeFam; TF331549; -.
PathwayCommons; P26951; -.
Reactome; R-HSA-512988; Interleukin-3, Interleukin-5 and GM-CSF signaling.
Reactome; R-HSA-5673001; RAF/MAP kinase cascade.
Reactome; R-HSA-912526; Interleukin receptor SHC signaling.
SignaLink; P26951; -.
SIGNOR; P26951; -.
BioGRID-ORCS; 3563; 7 hits in 451 CRISPR screens.
ChiTaRS; IL3RA; human.
GeneWiki; IL3RA; -.
GenomeRNAi; 3563; -.
Pharos; P26951; Tbio.
PRO; PR:P26951; -.
Proteomes; UP000005640; Chromosome X.
RNAct; P26951; protein.
Bgee; ENSG00000185291; Expressed in right uterine tube and 175 other tissues.
ExpressionAtlas; P26951; baseline and differential.
Genevisible; P26951; HS.
GO; GO:0009897; C:external side of plasma membrane; IBA:GO_Central.
GO; GO:0016021; C:integral component of membrane; IEA:UniProtKB-KW.
GO; GO:0005886; C:plasma membrane; TAS:Reactome.
GO; GO:0043235; C:receptor complex; IBA:GO_Central.
GO; GO:0019955; F:cytokine binding; IBA:GO_Central.
GO; GO:0004896; F:cytokine receptor activity; IBA:GO_Central.
GO; GO:0004912; F:interleukin-3 receptor activity; TAS:ProtInc.
GO; GO:0019221; P:cytokine-mediated signaling pathway; IBA:GO_Central.
GO; GO:0000165; P:MAPK cascade; TAS:Reactome.
Gene3D; 2.60.40.10; -; 2.
InterPro; IPR036116; FN3_sf.
InterPro; IPR013783; Ig-like_fold.
InterPro; IPR040907; IL3Ra_N.
InterPro; IPR003532; Short_hematopoietin_rcpt_2_CS.
InterPro; IPR015321; TypeI_recpt_CBD.
Pfam; PF18611; IL3Ra_N; 1.
Pfam; PF09240; IL6Ra-bind; 1.
SUPFAM; SSF49265; SSF49265; 2.
PROSITE; PS01356; HEMATOPO_REC_S_F2; 1.
1: Evidence at protein level;
3D-structure; Alternative splicing; Glycoprotein; Membrane; Polymorphism;
Receptor; Reference proteome; Signal; Transmembrane; Transmembrane helix.
SIGNAL 1..18
/evidence="ECO:0000255"
CHAIN 19..378
/note="Interleukin-3 receptor subunit alpha"
/id="PRO_0000010883"
TOPO_DOM 19..305
/note="Extracellular"
/evidence="ECO:0000255"
TRANSMEM 306..325
/note="Helical"
/evidence="ECO:0000255"
TOPO_DOM 326..378
/note="Cytoplasmic"
/evidence="ECO:0000255"
MOTIF 282..286
/note="WSXWS motif"
MOTIF 334..342
/note="Box 1 motif"
CARBOHYD 46
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 64
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 80
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 109
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 212
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
CARBOHYD 218
/note="N-linked (GlcNAc...) asparagine"
/evidence="ECO:0000255"
VAR_SEQ 22..100
/note="DPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAI
SLCEVTNYTVRVANPPFSTWILFPENS -> G (in isoform 2)"
/evidence="ECO:0000303|PubMed:19109256"
/id="VSP_040622"
VARIANT 12
/note="A -> T (in dbSNP:rs6647004)"
/evidence="ECO:0000269|PubMed:15772651, ECO:0000269|Ref.5"
/id="VAR_021113"
VARIANT 77
/note="E -> G (in dbSNP:rs17886756)"
/evidence="ECO:0000269|Ref.5"
/id="VAR_021114"
VARIANT 123
/note="S -> T (in dbSNP:rs17883572)"
/evidence="ECO:0000269|Ref.5"
/id="VAR_021115"
VARIANT 323
/note="V -> L (in dbSNP:rs17883366)"
/evidence="ECO:0000269|Ref.5"
/id="VAR_021116"
STRAND 31..33
/evidence="ECO:0000244|PDB:5UV8"
TURN 34..37
/evidence="ECO:0000244|PDB:5UWC"
STRAND 38..40
/evidence="ECO:0000244|PDB:5UV8"
STRAND 52..54
/evidence="ECO:0000244|PDB:5UWC"
TURN 55..57
/evidence="ECO:0000244|PDB:5UWC"
STRAND 58..60
/evidence="ECO:0000244|PDB:5UWC"
TURN 64..66
/evidence="ECO:0000244|PDB:5UWC"
STRAND 67..69
/evidence="ECO:0000244|PDB:5UWC"
STRAND 75..77
/evidence="ECO:0000244|PDB:5UWC"
STRAND 79..83
/evidence="ECO:0000244|PDB:5UWC"
TURN 86..89
/evidence="ECO:0000244|PDB:4JZJ"
STRAND 92..97
/evidence="ECO:0000244|PDB:5UWC"
STRAND 108..115
/evidence="ECO:0000244|PDB:5UWC"
TURN 116..118
/evidence="ECO:0000244|PDB:5UWC"
STRAND 119..125
/evidence="ECO:0000244|PDB:5UWC"
STRAND 135..142
/evidence="ECO:0000244|PDB:5UWC"
TURN 143..146
/evidence="ECO:0000244|PDB:6NMY"
STRAND 148..150
/evidence="ECO:0000244|PDB:5UWC"
STRAND 153..156
/evidence="ECO:0000244|PDB:5UWC"
STRAND 158..160
/evidence="ECO:0000244|PDB:6NMY"
STRAND 162..168
/evidence="ECO:0000244|PDB:5UWC"
HELIX 170..174
/evidence="ECO:0000244|PDB:5UWC"
STRAND 179..187
/evidence="ECO:0000244|PDB:5UWC"
STRAND 189..191
/evidence="ECO:0000244|PDB:5UWC"
STRAND 196..201
/evidence="ECO:0000244|PDB:5UWC"
HELIX 202..204
/evidence="ECO:0000244|PDB:5UWC"
STRAND 212..216
/evidence="ECO:0000244|PDB:5UWC"
STRAND 219..227
/evidence="ECO:0000244|PDB:5UWC"
STRAND 236..243
/evidence="ECO:0000244|PDB:5UWC"
STRAND 250..256
/evidence="ECO:0000244|PDB:5UWC"
STRAND 258..264
/evidence="ECO:0000244|PDB:5UWC"
STRAND 266..276
/evidence="ECO:0000244|PDB:5UWC"
TURN 277..279
/evidence="ECO:0000244|PDB:5UWC"
STRAND 289..292
/evidence="ECO:0000244|PDB:5UWC"
SEQUENCE 378 AA; 43330 MW; 716CE1803F2E5FC0 CRC64;
MVLLWLTLLL IALPCLLQTK EDPNPPITNL RMKAKAQQLT WDLNRNVTDI ECVKDADYSM
PAVNNSYCQF GAISLCEVTN YTVRVANPPF STWILFPENS GKPWAGAENL TCWIHDVDFL
SCSWAVGPGA PADVQYDLYL NVANRRQQYE CLHYKTDAQG TRIGCRFDDI SRLSSGSQSS
HILVRGRSAA FGIPCTDKFV VFSQIEILTP PNMTAKCNKT HSFMHWKMRS HFNRKFRYEL
QIQKRMQPVI TEQVRDRTSF QLLNPGTYTV QIRARERVYE FLSAWSTPQR FECDQEEGAN
TRAWRTSLLI ALGTLLALVC VFVICRRYLV MQRLFPRIPH MKDPIGDSFQ NDKLVVWEAG
KAGLEECLVT EVQVVQKT


Related products :

Catalog number Product name Quantity
E0229h ELISA kit Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229h ELISA Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U0229h CLIA Homo sapiens,Human,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U1815h CLIA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E1815h ELISA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
U1815h CLIA kit gp80,Homo sapiens,Human,IL-6 receptor subunit alpha,IL6R,IL-6R 1,IL-6R subunit alpha,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Membrane glycoprotein 80 96T
E2031h ELISA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E2031h ELISA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
U2031h CLIA 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
U2031h CLIA kit 582J2.1,Homo sapiens,Human,IL-4 receptor subunit alpha,IL4R,IL-4R subunit alpha,IL4RA,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha 96T
E0229b ELISA Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U0229b CLIA Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
E0229b ELISA kit Bos taurus,Bovine,IL-2 receptor subunit alpha,IL-2R subunit alpha,IL2RA,IL-2-RA,IL2-RA,Interleukin-2 receptor subunit alpha,p55,TAC antigen 96T
U2031m CLIA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
E2031r ELISA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
E2031m ELISA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
U2031r CLIA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
U1815r CLIA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Rat,Rattus norvegicus 96T
E1815m ELISA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
E2031m ELISA IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Mouse,Mus musculus 96T
U1815m CLIA IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
E2031r ELISA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
U1815m CLIA kit IL-6 receptor subunit alpha,Il6r,IL-6R 1,IL-6R subunit alpha,Il6ra,IL-6RA,IL-6R-alpha,Interleukin-6 receptor subunit alpha,Mouse,Mus musculus 96T
U2031r CLIA kit IL-4 receptor subunit alpha,Il4r,IL-4R subunit alpha,Il4ra,IL-4RA,IL-4R-alpha,Interleukin-4 receptor subunit alpha,Rat,Rattus norvegicus 96T
Pathways :
WP1566: Citrate cycle (TCA cycle)
WP1614: 1- and 2-Methylnaphthalene degradation
WP1655: Geraniol degradation
WP1963: The effect of Glucocorticoids on target gene expression
WP566: canonical wnt - zebrafish
WP2272: Pathogenic Escherichia coli infection
WP2292: Chemokine signaling pathway
WP1618: alpha-Linolenic acid metabolism
WP219: Cytoplasmic tRNA Synthetases
WP457: TNF-alpha NF-kB Signaling Pathway
WP1003: Ovarian Infertility Genes
WP262: EBV LMP1 signaling
WP537: Translation Factors
WP1369: TNF-alpha NF-kB Signaling Pathway
WP231: TNF alpha Signaling Pathway
WP811: TNF-alpha NF-kB Signaling Pathway
WP1225: estrogen signalling
WP34: Ovarian Infertility Genes
WP2100: AhR pathway
WP402: ERK1 - ERK2 MAPK cascade
WP246: TNF-alpha NF-kB Signaling Pathway
WP1835: Interferon alpha/beta signaling
WP773: Ovarian Infertility Genes
WP215: noncanonical wnt pathway
WP2199: Seed Development

Related Genes :
[IL3RA IL3R] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (CD antigen CD123)
[Il3ra Sut-1] Interleukin-3 receptor subunit alpha (IL-3 receptor subunit alpha) (IL-3R subunit alpha) (IL-3R-alpha) (IL-3RA) (Interleukin-3 receptor class II alpha chain) (CD antigen CD123)
[IL1R1 IL1R IL1RA IL1RT1] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL6ST] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (CDw130) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[IL15RA] Interleukin-15 receptor subunit alpha (IL-15 receptor subunit alpha) (IL-15R-alpha) (IL-15RA) (CD antigen CD215) [Cleaved into: Soluble interleukin-15 receptor subunit alpha (sIL-15 receptor subunit alpha) (sIL-15R-alpha) (sIL-15RA)]
[Il1r1 Il-1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[Il1r1 Il1ra] Interleukin-1 receptor type 1 (IL-1R-1) (IL-1RT-1) (IL-1RT1) (EC 3.2.2.6) (CD121 antigen-like family member A) (Interleukin-1 receptor alpha) (IL-1R-alpha) (Interleukin-1 receptor type I) (p80) (CD antigen CD121a) [Cleaved into: Interleukin-1 receptor type 1, membrane form (mIL-1R1) (mIL-1RI); Interleukin-1 receptor type 1, soluble form (sIL-1R1) (sIL-1RI)]
[IL13RA1 IL13R IL13RA] Interleukin-13 receptor subunit alpha-1 (IL-13 receptor subunit alpha-1) (IL-13R subunit alpha-1) (IL-13R-alpha-1) (IL-13RA1) (Cancer/testis antigen 19) (CT19) (CD antigen CD213a1)
[IL4R IL4RA 582J2.1] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124) [Cleaved into: Soluble interleukin-4 receptor subunit alpha (Soluble IL-4 receptor subunit alpha) (Soluble IL-4R-alpha) (sIL4Ralpha/prot) (IL-4-binding protein) (IL4-BP)]
[IL6R] Interleukin-6 receptor subunit alpha (IL-6 receptor subunit alpha) (IL-6R subunit alpha) (IL-6R-alpha) (IL-6RA) (IL-6R 1) (Membrane glycoprotein 80) (gp80) (CD antigen CD126) [Cleaved into: Soluble interleukin-6 receptor subunit alpha (sIL6R)]
[IL7R] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CDw127) (CD antigen CD127)
[IL10RA IL10R] Interleukin-10 receptor subunit alpha (IL-10 receptor subunit alpha) (IL-10R subunit alpha) (IL-10RA) (CDw210a) (Interleukin-10 receptor subunit 1) (IL-10R subunit 1) (IL-10R1) (CD antigen CD210)
[IL31RA CRL3 GPL UNQ6368/PRO21073/PRO21384] Interleukin-31 receptor subunit alpha (IL-31 receptor subunit alpha) (IL-31R subunit alpha) (IL-31R-alpha) (IL-31RA) (Cytokine receptor-like 3) (GLM-R) (hGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (ZcytoR17)
[IL18R1 IL1RRP] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (CDw218a) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[Il18r1] Interleukin-18 receptor 1 (IL-18R-1) (IL-18R1) (EC 3.2.2.6) (CD218 antigen-like family member A) (IL1 receptor-related protein) (IL-1Rrp) (IL1R-rp) (Interleukin-18 receptor alpha) (IL-18R-alpha) (IL-18Ralpha) (CD antigen CD218a)
[Il4r Il4ra] Interleukin-4 receptor subunit alpha (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA) (CD antigen CD124)
[IL13RA2 IL13R] Interleukin-13 receptor subunit alpha-2 (IL-13 receptor subunit alpha-2) (IL-13R subunit alpha-2) (IL-13R-alpha-2) (IL-13RA2) (Interleukin-13-binding protein) (CD antigen CD213a2)
[IL5RA IL5R] Interleukin-5 receptor subunit alpha (IL-5 receptor subunit alpha) (IL-5R subunit alpha) (IL-5R-alpha) (IL-5RA) (CDw125) (CD antigen CD125)
[Il7r] Interleukin-7 receptor subunit alpha (IL-7 receptor subunit alpha) (IL-7R subunit alpha) (IL-7R-alpha) (IL-7RA) (CD antigen CD127)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[IFNLR1 IL28RA LICR2] Interferon lambda receptor 1 (IFN-lambda receptor 1) (IFN-lambda-R1) (Cytokine receptor class-II member 12) (Cytokine receptor family 2 member 12) (CRF2-12) (Interleukin-28 receptor subunit alpha) (IL-28 receptor subunit alpha) (IL-28R-alpha) (IL-28RA) (Likely interleukin or cytokine receptor 2) (LICR2)
[Il6st] Interleukin-6 receptor subunit beta (IL-6 receptor subunit beta) (IL-6R subunit beta) (IL-6R-beta) (IL-6RB) (Interleukin-6 signal transducer) (Membrane glycoprotein 130) (gp130) (Oncostatin-M receptor subunit alpha) (CD antigen CD130)
[Il11ra1 Etl2 Il11ra] Interleukin-11 receptor subunit alpha-1 (IL-11 receptor subunit alpha-1) (IL-11R subunit alpha-1) (IL-11R-alpha-1) (IL-11RA1) (Enhancer trap locus homolog 2) (Etl-2) (Novel cytokine receptor 1) (NR-1) (NR1) [Cleaved into: Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)]
[IL11RA] Interleukin-11 receptor subunit alpha (IL-11 receptor subunit alpha) (IL-11R subunit alpha) (IL-11R-alpha) (IL-11RA) [Cleaved into: Soluble interleukin-11 receptor subunit alpha (sIL-11R) (sIL-11RA) (sIL11RA)]
[Csf2rb2 Ai2ca Il3r Il3rb2] Interleukin-3 receptor class 2 subunit beta (IL-3 receptor class 2 subunit beta) (IL-3R class 2 subunit beta) (Colony-stimulating factor 2 receptor subunit beta-2) (Interleukin-3 receptor class II beta chain)
[IL27RA CRL1 TCCR WSX1 UNQ296/PRO336] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Cytokine receptor WSX-1) (Cytokine receptor-like 1) (Type I T-cell cytokine receptor) (TCCR) (ZcytoR1)
[Il27ra Tccr Wsx1] Interleukin-27 receptor subunit alpha (IL-27 receptor subunit alpha) (IL-27R subunit alpha) (IL-27R-alpha) (IL-27RA) (Type I T-cell cytokine receptor) (TCCR) (WSX-1)
[Il1rl1 Ly84 St2 Ste2] Interleukin-1 receptor-like 1 (EC 3.2.2.6) (Interleukin-33 receptor alpha chain) (Lymphocyte antigen 84) (Protein ST2) (Protein T1)
[OSMR OSMRB] Oncostatin-M-specific receptor subunit beta (Interleukin-31 receptor subunit beta) (IL-31 receptor subunit beta) (IL-31R subunit beta) (IL-31R-beta) (IL-31RB)

Bibliography :
No related Items